F368530

General Info

Members Datasets Scaffolds Average Seq Length
259 226 198 197

Family's Representative Sequence

Representative Sequence 3300003856|Ga0058692_1000844|Ga0058692_10008449
Length 220
Sequence MAARDDDTIGFYTDNATAYTTRGQAADRPHLKTFLSQLEKGATILELGCGGGQDSEYMLAAGFDVHPTDGTPDIAKAAEARLGIPVRTLLFEXIDEVGRYHGXWANACLLHVPRPALXGIIGRIHTALKQGGVFYASFKAGEAEGRDTFGRYYNYPSRSWLEELYGQYDWTGVEIEARQGSGYDKLPTDWLHVXAKKXXPTATGXRLQKGAAPVLIAVLX

Samples

Sample ID Description Type Environment
1 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
2 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
3 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
4 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
5 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
6 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
7 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
8 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
9 2643221568 Rhizobium sp. Root564 Isolate Unclassified
10 2643221582 Rhizobium sp. Root651 Isolate Unclassified
11 2643221693 Rhizobium sp. Root491 Isolate Unclassified
12 2643221736 Bosea sp. Root483D1 Isolate Unclassified
13 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
14 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
15 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
16 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
17 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
18 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
19 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
20 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
21 2841760612 Bosea sp. Tri-49 Isolate Nodule
22 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
23 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
24 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
25 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
26 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
27 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
28 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
29 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
30 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
31 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
32 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
33 2844104063 Bosea sp. Tri-39 Isolate Nodule
34 2851182111 Bosea sp. Tri-44 Isolate Nodule
35 2851246043 Bosea sp. Tri-54 Isolate Nodule
36 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
37 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
38 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
39 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
40 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
41 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
42 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
43 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
44 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
45 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
46 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
47 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
48 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
49 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
50 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
51 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
52 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
53 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
54 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
55 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
56 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
57 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
58 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
59 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
60 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
61 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
71 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
72 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
73 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
126 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
132 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
217 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
218 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
219 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
220 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
221 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
222 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
223 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
224 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
225 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
226 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.06
Metatranscriptomes 0.39
Isolates 23.55

Biome Distribution

Category Percentage (%)
Aerial Root 1.93
Bulb 0
Endosphere 16.6
Nodule 11.2
Rhizoplane 2.7
Rhizosphere 48.26
Stem 0
Stem Tuber 0
Unclassified 19.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1007359 3300002987 Bacteria 3165
2 rootH1_10111682 3300003316 Bacteria 1020
3 rootH2_10192079 3300003320 Bacteria 2711
4 Ga0055540_1001648 3300003792 Bacteria 12965
5 Ga0055531_10001132 3300003794 Bacteria 20631
6 Ga0058692_1000844 3300003856 Bacteria 12122
7 Ga0058692_1014451 3300003856 Bacteria 1808
8 Ga0065165_1000143 3300005262 Bacteria 124381
9 Ga0065165_1002359 3300005262 Bacteria 16358
10 Ga0065165_1059499 3300005262 Bacteria 1051
11 Ga0068869_100397617 3300005334 Bacteria 1133
12 Ga0070668_100214519 3300005347 Bacteria 1585
13 Ga0070675_100737921 3300005354 Bacteria 898
14 Ga0070688_100511064 3300005365 Bacteria 908
15 Ga0070667_100238377 3300005367 Bacteria 1623
16 Ga0070709_10235099 3300005434 Bacteria 1313
17 Ga0070714_100030514 3300005435 Bacteria 4487
18 Ga0070714_100148831 3300005435 Bacteria 2108
19 Ga0070713_100045016 3300005436 Bacteria 3614
20 Ga0070701_10617321 3300005438 Bacteria 720
21 Ga0070663_100203452 3300005455 Bacteria 1546
22 Ga0070663_100257595 3300005455 Bacteria 1383
23 Ga0070678_100631444 3300005456 Bacteria 959
24 Ga0070685_10570561 3300005466 Bacteria 810
25 Ga0068853_101202099 3300005539 Bacteria 732
26 Ga0070665_100009102 3300005548 Bacteria 10059
27 Ga0068864_100788873 3300005618 Bacteria 933
28 Ga0068858_100368370 3300005842 Bacteria 1377
29 Ga0068860_100299328 3300005843 Bacteria 1575
30 Ga0081540_1003158 3300005983 Bacteria 13152
31 Ga0081540_1021269 3300005983 Bacteria 3871
32 Ga0075365_10081439 3300006038 Bacteria 2193
33 Ga0075365_10264841 3300006038 Bacteria 1209
34 Ga0075368_10002196 3300006042 Bacteria 6328
35 Ga0075363_100229932 3300006048 Bacteria 1064
36 Ga0075364_10018253 3300006051 Bacteria 4390
37 Ga0075367_10319892 3300006178 Bacteria 978
38 Ga0075367_10529391 3300006178 Bacteria 748
39 Ga0075369_10038716 3300006186 Bacteria 2035
40 Ga0075366_10490172 3300006195 Bacteria 759
41 Ga0075370_10521881 3300006353 Bacteria 717
42 Ga0068871_100305229 3300006358 Bacteria 1398
43 Ga0099826_10000462 3300006948 Bacteria 19553
44 Ga0099826_10017022 3300006948 Bacteria 5492
45 Ga0105243_10009454 3300009148 Bacteria 7426
46 Ga0105249_10293562 3300009553 Bacteria 1628
47 Ga0099796_10020497 3300010159 Bacteria 2021
48 Ga0157371_10000017 3300013102 Bacteria 320830
49 Ga0157371_10007942 3300013102 Bacteria 8514
50 Ga0157370_10045517 3300013104 Bacteria 4209
51 Ga0157369_10099405 3300013105 Bacteria 3102
52 Ga0157374_10310414 3300013296 Bacteria 1561
53 Ga0163162_10700718 3300013306 Bacteria 1134
54 Ga0157375_10217916 3300013308 Bacteria 2067
55 Ga0163163_10858822 3300014325 Bacteria 971
56 Ga0209130_1000342 3300025284 Bacteria 53602
57 Ga0209130_1014132 3300025284 Bacteria 2016
58 Ga0209676_1005961 3300025292 Bacteria 6163
59 Ga0209025_1000154 3300025294 Bacteria 170288
60 Ga0209025_1007701 3300025294 Bacteria 7945
61 Ga0209758_1000170 3300025297 Bacteria 149476
62 Ga0209050_1008825 3300025298 Bacteria 5291
63 Ga0209256_1047716 3300025299 Bacteria 1052
64 Ga0209051_1005142 3300025303 Bacteria 7759
65 Ga0209257_1000940 3300025304 Bacteria 40225
66 Ga0207688_10032942 3300025901 Bacteria 2864
67 Ga0207693_10366191 3300025915 Bacteria 1128
68 Ga0207662_10088981 3300025918 Bacteria 1896
69 Ga0207700_10010852 3300025928 Bacteria 5779
70 Ga0207664_10070887 3300025929 Bacteria 2806
71 Ga0207669_10348264 3300025937 Bacteria 1143
72 Ga0207691_10255880 3300025940 Bacteria 1510
73 Ga0207711_10141923 3300025941 Bacteria 2162
74 Ga0207689_10379214 3300025942 Bacteria 1177
75 Ga0207668_10551554 3300025972 Bacteria 998
76 Ga0207678_10412670 3300026067 Bacteria 1170
77 Ga0207641_10627094 3300026088 Bacteria 1054
78 Ga0207676_10916967 3300026095 Bacteria 860
79 Ga0207683_10657748 3300026121 Bacteria 971
80 Ga0209281_1000043 3300027111 Bacteria 341543
81 Ga0209371_1000022 3300027312 Bacteria 536342
82 Ga0209371_1000341 3300027312 Bacteria 50975
83 Ga0209282_1001698 3300027666 Bacteria 12281
84 Ga0209282_1009320 3300027666 Bacteria 6206
85 Ga0268266_10007279 3300028379 Bacteria 10008
86 Ga0268266_10017562 3300028379 Bacteria 6103
87 Ga0268266_10054352 3300028379 Bacteria 3440
88 Ga0268264_10286109 3300028381 Bacteria 1546
89 Ga0268264_10597808 3300028381 Bacteria 1087
90 Ga0307515_10000070 3300028794 Bacteria 239322
91 Ga0268256_1000019 3300030500 Bacteria 587949
92 Ga0268256_1002662 3300030500 Bacteria 8808
93 Ga0316181_1280734 3300030744 Bacteria 1567
94 Ga0265330_10029380 3300031235 Bacteria 2473
95 Ga0307513_10039488 3300031456 Bacteria 5232
96 Ga0307509_10224089 3300031507 Bacteria 1689
97 Ga0307408_100728598 3300031548 Bacteria 894
98 Ga0307516_10590298 3300031730 Bacteria 765
99 Ga0307413_10225666 3300031824 Bacteria 1371
100 Ga0307406_10491492 3300031901 Bacteria 993
101 Ga0307412_10722800 3300031911 Bacteria 857
102 Ga0307409_100221484 3300031995 Bacteria 1708
103 Ga0307414_10178093 3300032004 Bacteria 1707
104 Ga0316215_1000526 3300033544 Bacteria 4216
105 Ga0373923_0073157 3300035111 Bacteria 1475
106 Ga0373946_0003228 3300035171 Bacteria 5789
107 Ga0373924_0017596 3300035410 Bacteria 2744
108 Ga0373935_0000435 3300035692 Bacteria 21766
109 Ga0373927_0002587 3300035695 Bacteria 13194
110 Ga0373933_0069361 3300035724 Bacteria 2143
111 Ga0373933_0544879 3300035724 Bacteria 761
112 Ga0373947_0012060 3300035725 Bacteria 4949
113 Ga0373937_0244436 3300036401 Bacteria 1691
114 Ga0372808_030490 3300036459 Bacteria 773
115 Ga0373925_0001774 3300037068 Bacteria 18013
116 Ga0237819_08538 3300038705 Bacteria 1414
117 Ga0436363_0603998 3300039450 Bacteria 1515
118 Ga0451791_1596591 3300041451 Bacteria 1358
119 Ga0495592_0047468 3300046454 Bacteria 3198
120 Ga0495603_0001446 3300046455 Bacteria 13824
121 Ga0495629_0008069 3300046459 Bacteria 7750
122 Ga0495629_0195442 3300046459 Bacteria 1399
123 Ga0495638_0262847 3300046460 Bacteria 946
124 Ga0495641_0007242 3300046461 Bacteria 6978
125 Ga0495580_0001310 3300046472 Bacteria 21988
126 Ga0495582_0000545 3300046473 Bacteria 20797
127 Ga0495639_0010592 3300046475 Bacteria 3970
128 Ga0495664_0123109 3300046477 Bacteria 1568
129 Ga0495594_0000020 3300046499 Bacteria 80534
130 Ga0495628_0313602 3300046516 Bacteria 1159
131 Ga0495630_0010792 3300046517 Bacteria 6594
132 Ga0495632_0107859 3300046519 Bacteria 1309
133 Ga0495666_0010941 3300046526 Bacteria 4525
134 Ga0495665_0000170 3300046531 Bacteria 32921
135 Ga0495640_0002547 3300046533 Bacteria 14649
136 Ga0495622_0002079 3300046557 Bacteria 9785
137 Ga0495633_0156901 3300046558 Bacteria 1050
138 Ga0495634_0000998 3300046642 Bacteria 26678
139 Ga0495635_0030879 3300046663 Bacteria 3722
140 Ga0495599_0049581 3300046678 Bacteria 2632
141 Ga0495646_0040056 3300046680 Bacteria 2887
142 Ga0495647_0001303 3300046681 Bacteria 7665
143 Ga0495658_0002344 3300046683 Bacteria 9568
144 Ga0495613_0017244 3300046689 Bacteria 5380
145 Ga0495624_0009089 3300046690 Bacteria 6894
146 Ga0495671_0051175 3300046692 Bacteria 2055
147 Ga0495581_0003140 3300047315 Bacteria 9453
148 Ga0495674_0000600 3300047319 Bacteria 33795
149 Ga0495674_0107505 3300047319 Bacteria 2368
150 Ga0495672_0238223 3300047320 Bacteria 890
151 Ga0495676_0037688 3300047321 Bacteria 4021
152 Ga0495680_0695862 3300047322 Bacteria 672
153 Ga0495681_0014467 3300047470 Bacteria 4519
154 Ga0495684_0041506 3300047471 Bacteria 3526
155 Ga0495593_0005773 3300047673 Bacteria 7300
156 Ga0495614_0028553 3300048089 Bacteria 2403
157 Ga0496104_0117879 3300048907 Bacteria 2548
158 Ga0496111_0488387 3300048914 Bacteria 907
159 Ga0496112_0306590 3300048915 Bacteria 1533
160 Ga0496116_0000105 3300048919 Bacteria 192704
161 Ga0496116_0011861 3300048919 Bacteria 7171
162 Ga0496116_0104323 3300048919 Bacteria 1685
163 Ga0496117_0000002 3300048920 Bacteria 2483758
164 Ga0496117_0035242 3300048920 Bacteria 3759
165 Ga0496118_0001193 3300048921 Bacteria 40048
166 Ga0496118_0084440 3300048921 Bacteria 2215
167 Ga0496118_0277564 3300048921 Bacteria 935
168 Ga0496119_0005864 3300048922 Bacteria 11594
169 Ga0496119_0016585 3300048922 Bacteria 5595
170 Ga0496120_0000309 3300048923 Bacteria 81375
171 Ga0496120_0361126 3300048923 Bacteria 650
172 Ga0496121_0112578 3300048924 Bacteria 2073
173 Ga0496122_0000004 3300048925 Bacteria 645283
174 Ga0496122_0163340 3300048925 Bacteria 1354
175 Ga0496123_0000007 3300048926 Bacteria 645283
176 Ga0496124_0004618 3300048927 Bacteria 15949
177 Ga0496125_0023661 3300048928 Bacteria 5665
178 Ga0496125_0113065 3300048928 Bacteria 1959
179 Ga0496126_0000780 3300048929 Bacteria 57510
180 Ga0496126_0514629 3300048929 Bacteria 954
181 nmdc:mga03683_113567_c1 3300050489 Bacteria 1200
182 nmdc:mga03n38_101412_c1 3300050490 Bacteria 1389
183 nmdc:mga00v17_7_c1 3300050491 Bacteria 167228
184 nmdc:mga0yw44_384661_c1 3300050492 Bacteria 947
185 nmdc:mga0yw44_64433_c1 3300050492 Bacteria 2256
186 nmdc:mga0k408_38110_c1 3300050493 Bacteria 2760
187 nmdc:mga06z11_500099_c1 3300050494 Bacteria 736
188 nmdc:mga04h51_37225_c1 3300050495 Bacteria 1570
189 nmdc:mga0sz30_298601_c1 3300050516 Unclassified 718
190 nmdc:mga0sz30_313_c1 3300050516 Bacteria 18658
191 Ga0495619_0072468 3300053085 Bacteria 2307
192 Ga0500643_011780 3300053087 Bacteria 3168
193 Ga0500641_0035993 3300053096 Bacteria 1978
194 Ga0500560_005772 3300053107 Bacteria 2770
195 Ga0500561_0000333 3300053137 Bacteria 7873
196 Ga0500634_0023543 3300053161 Bacteria 3347
197 Ga0500636_0000783 3300053177 Bacteria 17103
198 Ga0500645_074365 3300053730 Bacteria 973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006178 Ga0075367_10529391 Ga0075367_105293911 191
2 3300050494 nmdc:mga06z11_500099_c1 nmdc:mga06z11_500099_c1_15_590 191
3 iso_pu_bacteria 2791355196 2793062534 192
4 iso_pu_bacteria 2854896431 2854897939 192
5 iso_pu_bacteria 2889033259 2889039974 192
6 iso_pu_bacteria 8006964411 8006965607 192
7 3300053087 Ga0500643_011780 Ga0500643_011780_1815_2396 193
8 iso_pu_bacteria 2643221568 2643856515 193
9 iso_pu_bacteria 2919166419 2919169561 193
10 iso_pu_bacteria 2919171160 2919172335 193
11 iso_pu_bacteria 2978969890 2978971964 193
12 iso_pu_bacteria 2984587000 2984590248 193
13 iso_pu_bacteria 2537561587 2537873845 194
14 iso_pu_bacteria 2554235003 2554248460 194
15 iso_pu_bacteria 2558860242 2559295576 194
16 iso_pu_bacteria 2600255279 2601609847 194
17 iso_pu_bacteria 2600255308 2601746622 194
18 iso_pu_bacteria 2643221582 2643920106 194
19 iso_pu_bacteria 2643221693 2644521729 194
20 iso_pu_bacteria 2808606387 2808987691 194
21 iso_pu_bacteria 2818991439 2819559292 194
22 iso_pu_bacteria 2838724970 2838725178 194
23 iso_pu_bacteria 2841846520 2841848764 194
24 iso_pu_bacteria 2841859092 2841862366 194
25 iso_pu_bacteria 2842130223 2842130431 194
26 iso_pu_bacteria 2842170452 2842170660 194
27 iso_pu_bacteria 2842187318 2842187526 194
28 iso_pu_bacteria 2842211629 2842211837 194
29 iso_pu_bacteria 2842224351 2842226543 194
30 iso_pu_bacteria 2842515876 2842519150 194
31 iso_pu_bacteria 2899792073 2899795548 194
32 iso_pu_bacteria 2899845264 2899848836 194
33 iso_pu_bacteria 2919114240 2919114454 194
34 iso_pu_bacteria 2926754445 2926755468 194
35 iso_pu_bacteria 2926760298 2926762600 194
36 iso_pu_bacteria 2933011516 2933014676 194
37 iso_pu_bacteria 2933594066 2933596358 194
38 iso_pu_bacteria 2979089926 2979092090 194
39 iso_pu_bacteria 2979095461 2979100522 194
40 iso_pu_bacteria 2979100975 2979104147 194
41 iso_pu_bacteria 2984509177 2984511283 194
42 iso_pu_bacteria 2984518228 2984522356 194
43 iso_pu_bacteria 2984537506 2984541658 194
44 iso_pu_bacteria 2984601300 2984603931 194
45 iso_pu_bacteria 650716007 650740785 194
46 3300005354 Ga0070675_100737921 Ga0070675_1007379211 195
47 3300005455 Ga0070663_100257595 Ga0070663_1002575952 195
48 3300005456 Ga0070678_100631444 Ga0070678_1006314442 195
49 3300005466 Ga0070685_10570561 Ga0070685_105705611 195
50 3300006358 Ga0068871_100305229 Ga0068871_1003052292 195
51 3300025915 Ga0207693_10366191 Ga0207693_103661912 195
52 3300026121 Ga0207683_10657748 Ga0207683_106577482 195
53 3300031507 Ga0307509_10224089 Ga0307509_102240892 195
54 3300033544 Ga0316215_1000526 Ga0316215_10005265 195
55 3300035111 Ga0373923_0073157 Ga0373923_0073157_551_1141 195
56 3300035171 Ga0373946_0003228 Ga0373946_0003228_3672_4262 195
57 3300035410 Ga0373924_0017596 Ga0373924_0017596_439_1029 195
58 3300035692 Ga0373935_0000435 Ga0373935_0000435_2727_3317 195
59 3300035695 Ga0373927_0002587 Ga0373927_0002587_10092_10682 195
60 3300035724 Ga0373933_0069361 Ga0373933_0069361_235_825 195
61 3300035725 Ga0373947_0012060 Ga0373947_0012060_805_1395 195
62 3300036401 Ga0373937_0244436 Ga0373937_0244436_192_782 195
63 3300036459 Ga0372808_030490 Ga0372808_030490_36_626 195
64 3300037068 Ga0373925_0001774 Ga0373925_0001774_5509_6099 195
65 3300046454 Ga0495592_0047468 Ga0495592_0047468_857_1447 195
66 3300046455 Ga0495603_0001446 Ga0495603_0001446_11570_12160 195
67 3300046459 Ga0495629_0008069 Ga0495629_0008069_3820_4410 195
68 3300046461 Ga0495641_0007242 Ga0495641_0007242_2571_3161 195
69 3300046472 Ga0495580_0001310 Ga0495580_0001310_2947_3537 195
70 3300046473 Ga0495582_0000545 Ga0495582_0000545_5707_6297 195
71 3300046475 Ga0495639_0010592 Ga0495639_0010592_1590_2180 195
72 3300046477 Ga0495664_0123109 Ga0495664_0123109_495_1085 195
73 3300046499 Ga0495594_0000020 Ga0495594_0000020_77338_77928 195
74 3300046517 Ga0495630_0010792 Ga0495630_0010792_5762_6352 195
75 3300046526 Ga0495666_0010941 Ga0495666_0010941_3162_3752 195
76 3300046531 Ga0495665_0000170 Ga0495665_0000170_1590_2180 195
77 3300046533 Ga0495640_0002547 Ga0495640_0002547_12249_12839 195
78 3300046557 Ga0495622_0002079 Ga0495622_0002079_1976_2566 195
79 3300046642 Ga0495634_0000998 Ga0495634_0000998_4324_4914 195
80 3300046663 Ga0495635_0030879 Ga0495635_0030879_1017_1607 195
81 3300046678 Ga0495599_0049581 Ga0495599_0049581_56_646 195
82 3300046680 Ga0495646_0040056 Ga0495646_0040056_336_926 195
83 3300046681 Ga0495647_0001303 Ga0495647_0001303_2548_3138 195
84 3300046683 Ga0495658_0002344 Ga0495658_0002344_2348_2938 195
85 3300046689 Ga0495613_0017244 Ga0495613_0017244_1088_1678 195
86 3300046690 Ga0495624_0009089 Ga0495624_0009089_3261_3851 195
87 3300047315 Ga0495581_0003140 Ga0495581_0003140_1590_2180 195
88 3300047319 Ga0495674_0000600 Ga0495674_0000600_6795_7385 195
89 3300047321 Ga0495676_0037688 Ga0495676_0037688_871_1461 195
90 3300047471 Ga0495684_0041506 Ga0495684_0041506_1002_1592 195
91 3300047673 Ga0495593_0005773 Ga0495593_0005773_2594_3184 195
92 3300048089 Ga0495614_0028553 Ga0495614_0028553_23_613 195
93 3300053085 Ga0495619_0072468 Ga0495619_0072468_1063_1653 195
94 iso_pu_bacteria 2582581306 2585266088 195
95 iso_pu_bacteria 2582581865 2585387086 195
96 iso_pu_bacteria 2599185210 2599601899 195
97 iso_pu_bacteria 2643221736 2644742057 195
98 iso_pu_bacteria 2738541317 2738945357 195
99 iso_pu_bacteria 2838675328 2838675536 195
100 iso_pu_bacteria 2838714209 2838714417 195
101 iso_pu_bacteria 2838719591 2838721781 195
102 iso_pu_bacteria 2841760612 2841763460 195
103 iso_pu_bacteria 2842124991 2842125205 195
104 iso_pu_bacteria 2842152218 2842154399 195
105 iso_pu_bacteria 2842175837 2842178019 195
106 iso_pu_bacteria 2844104063 2844109636 195
107 iso_pu_bacteria 2851182111 2851182694 195
108 iso_pu_bacteria 2851246043 2851251743 195
109 iso_pu_bacteria 2913308742 2913310063 195
110 iso_pu_bacteria 2933006813 2933009044 195
111 iso_pu_bacteria 8003570095 8003571861 195
112 iso_pu_bacteria 8057529695 8057534604 195
113 3300003316 rootH1_10111682 rootH1_101116821 196
114 3300005262 Ga0065165_1002359 Ga0065165_10023597 196
115 3300005262 Ga0065165_1059499 Ga0065165_10594992 196
116 3300005334 Ga0068869_100397617 Ga0068869_1003976172 196
117 3300005347 Ga0070668_100214519 Ga0070668_1002145192 196
118 3300005365 Ga0070688_100511064 Ga0070688_1005110642 196
119 3300005367 Ga0070667_100238377 Ga0070667_1002383772 196
120 3300005438 Ga0070701_10617321 Ga0070701_106173211 196
121 3300005455 Ga0070663_100203452 Ga0070663_1002034522 196
122 3300005539 Ga0068853_101202099 Ga0068853_1012020991 196
123 3300005618 Ga0068864_100788873 Ga0068864_1007888732 196
124 3300005842 Ga0068858_100368370 Ga0068858_1003683702 196
125 3300005843 Ga0068860_100299328 Ga0068860_1002993282 196
126 3300005983 Ga0081540_1003158 Ga0081540_100315812 196
127 3300005983 Ga0081540_1021269 Ga0081540_10212695 196
128 3300006038 Ga0075365_10081439 Ga0075365_100814392 196
129 3300006051 Ga0075364_10018253 Ga0075364_100182532 196
130 3300006178 Ga0075367_10319892 Ga0075367_103198921 196
131 3300006195 Ga0075366_10490172 Ga0075366_104901721 196
132 3300009553 Ga0105249_10293562 Ga0105249_102935622 196
133 3300013296 Ga0157374_10310414 Ga0157374_103104142 196
134 3300013306 Ga0163162_10700718 Ga0163162_107007182 196
135 3300013308 Ga0157375_10217916 Ga0157375_102179162 196
136 3300014325 Ga0163163_10858822 Ga0163163_108588222 196
137 3300025901 Ga0207688_10032942 Ga0207688_100329422 196
138 3300025918 Ga0207662_10088981 Ga0207662_100889812 196
139 3300025937 Ga0207669_10348264 Ga0207669_103482642 196
140 3300025940 Ga0207691_10255880 Ga0207691_102558802 196
141 3300025941 Ga0207711_10141923 Ga0207711_101419233 196
142 3300025942 Ga0207689_10379214 Ga0207689_103792142 196
143 3300025972 Ga0207668_10551554 Ga0207668_105515542 196
144 3300026067 Ga0207678_10412670 Ga0207678_104126702 196
145 3300026088 Ga0207641_10627094 Ga0207641_106270942 196
146 3300026095 Ga0207676_10916967 Ga0207676_109169671 196
147 3300028379 Ga0268266_10054352 Ga0268266_100543522 196
148 3300028381 Ga0268264_10286109 Ga0268264_102861092 196
149 3300028381 Ga0268264_10597808 Ga0268264_105978082 196
150 3300031548 Ga0307408_100728598 Ga0307408_1007285982 196
151 3300031730 Ga0307516_10590298 Ga0307516_105902982 196
152 3300031824 Ga0307413_10225666 Ga0307413_102256662 196
153 3300031901 Ga0307406_10491492 Ga0307406_104914922 196
154 3300031911 Ga0307412_10722800 Ga0307412_107228002 196
155 3300031995 Ga0307409_100221484 Ga0307409_1002214842 196
156 3300032004 Ga0307414_10178093 Ga0307414_101780932 196
157 3300041451 Ga0451791_1596591 Ga0451791_1596591_418_1011 196
158 3300046459 Ga0495629_0195442 Ga0495629_0195442_273_866 196
159 3300046519 Ga0495632_0107859 Ga0495632_0107859_202_795 196
160 3300047319 Ga0495674_0107505 Ga0495674_0107505_1382_1975 196
161 3300048914 Ga0496111_0488387 Ga0496111_0488387_99_692 196
162 3300048923 Ga0496120_0361126 Ga0496120_0361126_22_612 196
163 3300048929 Ga0496126_0000780 Ga0496126_0000780_3882_4472 196
164 3300053730 Ga0500645_074365 Ga0500645_074365_74_667 196
165 3300003792 Ga0055540_1001648 Ga0055540_100164816 197
166 3300003794 Ga0055531_10001132 Ga0055531_100011327 197
167 3300005434 Ga0070709_10235099 Ga0070709_102350992 197
168 3300005435 Ga0070714_100148831 Ga0070714_1001488312 197
169 3300005436 Ga0070713_100045016 Ga0070713_1000450162 197
170 3300013102 Ga0157371_10007942 Ga0157371_100079427 197
171 3300013105 Ga0157369_10099405 Ga0157369_100994052 197
172 3300025292 Ga0209676_1005961 Ga0209676_10059616 197
173 3300025297 Ga0209758_1000170 Ga0209758_1000170115 197
174 3300025298 Ga0209050_1008825 Ga0209050_10088255 197
175 3300025303 Ga0209051_1005142 Ga0209051_10051429 197
176 3300025304 Ga0209257_1000940 Ga0209257_100094025 197
177 3300025928 Ga0207700_10010852 Ga0207700_100108522 197
178 3300025929 Ga0207664_10070887 Ga0207664_100708873 197
179 3300028794 Ga0307515_10000070 Ga0307515_10000070106 197
180 3300031456 Ga0307513_10039488 Ga0307513_100394884 197
181 3300039450 Ga0436363_0603998 Ga0436363_0603998_320_919 197
182 3300048919 Ga0496116_0000105 Ga0496116_0000105_110396_110989 197
183 3300048921 Ga0496118_0277564 Ga0496118_0277564_147_740 197
184 3300048925 Ga0496122_0163340 Ga0496122_0163340_699_1292 197
185 3300003320 rootH2_10192079 rootH2_101920792 198
186 3300003856 Ga0058692_1014451 Ga0058692_10144512 198
187 3300005435 Ga0070714_100030514 Ga0070714_1000305145 198
188 3300005548 Ga0070665_100009102 Ga0070665_1000091028 198
189 3300006038 Ga0075365_10264841 Ga0075365_102648412 198
190 3300006042 Ga0075368_10002196 Ga0075368_100021966 198
191 3300006048 Ga0075363_100229932 Ga0075363_1002299322 198
192 3300006186 Ga0075369_10038716 Ga0075369_100387162 198
193 3300006353 Ga0075370_10521881 Ga0075370_105218811 198
194 3300006948 Ga0099826_10000462 Ga0099826_100004626 198
195 3300006948 Ga0099826_10017022 Ga0099826_100170223 198
196 3300009148 Ga0105243_10009454 Ga0105243_100094542 198
197 3300013102 Ga0157371_10000017 Ga0157371_10000017291 198
198 3300013104 Ga0157370_10045517 Ga0157370_100455174 198
199 3300025294 Ga0209025_1000154 Ga0209025_100015472 198
200 3300027111 Ga0209281_1000043 Ga0209281_1000043231 198
201 3300027312 Ga0209371_1000022 Ga0209371_1000022319 198
202 3300027312 Ga0209371_1000341 Ga0209371_100034129 198
203 3300027666 Ga0209282_1001698 Ga0209282_10016986 198
204 3300027666 Ga0209282_1009320 Ga0209282_10093206 198
205 3300028379 Ga0268266_10007279 Ga0268266_100072793 198
206 3300030500 Ga0268256_1000019 Ga0268256_1000019201 198
207 3300030500 Ga0268256_1002662 Ga0268256_10026626 198
208 3300030744 Ga0316181_1280734 Ga0316181_12807342 198
209 3300031235 Ga0265330_10029380 Ga0265330_100293803 198
210 3300035724 Ga0373933_0544879 Ga0373933_0544879_47_655 198
211 3300046516 Ga0495628_0313602 Ga0495628_0313602_337_945 198
212 3300046558 Ga0495633_0156901 Ga0495633_0156901_33_629 198
213 3300046692 Ga0495671_0051175 Ga0495671_0051175_424_1020 198
214 3300047470 Ga0495681_0014467 Ga0495681_0014467_1204_1800 198
215 3300048907 Ga0496104_0117879 Ga0496104_0117879_647_1243 198
216 3300048915 Ga0496112_0306590 Ga0496112_0306590_847_1443 198
217 3300048919 Ga0496116_0011861 Ga0496116_0011861_5386_5982 198
218 3300048919 Ga0496116_0104323 Ga0496116_0104323_495_1091 198
219 3300048920 Ga0496117_0000002 Ga0496117_0000002_225433_226029 198
220 3300048920 Ga0496117_0035242 Ga0496117_0035242_879_1475 198
221 3300048921 Ga0496118_0001193 Ga0496118_0001193_23519_24115 198
222 3300048921 Ga0496118_0084440 Ga0496118_0084440_582_1178 198
223 3300048922 Ga0496119_0005864 Ga0496119_0005864_8001_8597 198
224 3300048922 Ga0496119_0016585 Ga0496119_0016585_1771_2367 198
225 3300048923 Ga0496120_0000309 Ga0496120_0000309_4985_5581 198
226 3300048924 Ga0496121_0112578 Ga0496121_0112578_1177_1773 198
227 3300048925 Ga0496122_0000004 Ga0496122_0000004_419647_420243 198
228 3300048926 Ga0496123_0000007 Ga0496123_0000007_419647_420243 198
229 3300048927 Ga0496124_0004618 Ga0496124_0004618_11722_12318 198
230 3300048928 Ga0496125_0023661 Ga0496125_0023661_4203_4799 198
231 3300048928 Ga0496125_0113065 Ga0496125_0113065_1341_1937 198
232 3300048929 Ga0496126_0514629 Ga0496126_0514629_280_876 198
233 3300050489 nmdc:mga03683_113567_c1 nmdc:mga03683_113567_c1_188_784 198
234 3300050490 nmdc:mga03n38_101412_c1 nmdc:mga03n38_101412_c1_598_1194 198
235 3300050491 nmdc:mga00v17_7_c1 nmdc:mga00v17_7_c1_44924_45520 198
236 3300050492 nmdc:mga0yw44_384661_c1 nmdc:mga0yw44_384661_c1_163_762 198
237 3300050492 nmdc:mga0yw44_64433_c1 nmdc:mga0yw44_64433_c1_895_1491 198
238 3300050493 nmdc:mga0k408_38110_c1 nmdc:mga0k408_38110_c1_1913_2509 198
239 3300050495 nmdc:mga04h51_37225_c1 nmdc:mga04h51_37225_c1_195_791 198
240 3300050516 nmdc:mga0sz30_313_c1 nmdc:mga0sz30_313_c1_12716_13312 198
241 3300053107 Ga0500560_005772 Ga0500560_005772_675_1271 198
242 3300053137 Ga0500561_0000333 Ga0500561_0000333_5835_6431 198
243 3300053161 Ga0500634_0023543 Ga0500634_0023543_1694_2290 198
244 3300002987 JGI25159J45721_1007359 JGI25159J45721_10073592 199
245 3300003856 Ga0058692_1000844 Ga0058692_10008449 199
246 3300005262 Ga0065165_1000143 Ga0065165_100014334 199
247 3300010159 Ga0099796_10020497 Ga0099796_100204972 199
248 3300025284 Ga0209130_1000342 Ga0209130_100034219 199
249 3300025284 Ga0209130_1014132 Ga0209130_10141323 199
250 3300025294 Ga0209025_1007701 Ga0209025_10077016 199
251 3300025299 Ga0209256_1047716 Ga0209256_10477162 199
252 3300028379 Ga0268266_10017562 Ga0268266_100175622 199
253 3300038705 Ga0237819_08538 Ga0237819_08538_460_1059 199
254 3300046460 Ga0495638_0262847 Ga0495638_0262847_58_657 199
255 3300047320 Ga0495672_0238223 Ga0495672_0238223_18_629 199
256 3300047322 Ga0495680_0695862 Ga0495680_0695862_33_644 199
257 3300050516 nmdc:mga0sz30_298601_c1 nmdc:mga0sz30_298601_c1_48_650 199
258 3300053096 Ga0500641_0035993 Ga0500641_0035993_272_883 199
259 3300053177 Ga0500636_0000783 Ga0500636_0000783_9006_9623 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

44

132

0.92

PF13489

Methyltransf_23

Methyltransferase domain

19

175

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e23-assembly1.cif.gz_A crystal structure of the rpa2492 protein in complex with sam from rhodopseudomonas palustris, northeast structural genomics consortium target rpr299 0.9701 2 199
3e23-assembly1.cif.gz_A crystal structure of the rpa2492 protein in complex with sam from rhodopseudomonas palustris, northeast structural genomics consortium target rpr299 0.9605 2 199
3sm3-assembly1.cif.gz_A-2 crystal structure of sam-dependent methyltransferases q8puk2_metma from methanosarcina mazei. northeast structural genomics consortium target mar262. 0.8595 36 198
2p8j-assembly1.cif.gz_B crystal structure of s-adenosylmethionine-dependent methyltransferase (np_349143.1) from clostridium acetobutylicum at 2.00 a resolution 0.8011 22 199
2p8j-assembly1.cif.gz_A crystal structure of s-adenosylmethionine-dependent methyltransferase (np_349143.1) from clostridium acetobutylicum at 2.00 a resolution 0.7921 22 199
ID Description Score Start End Superfamily
3e23A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9699 2 199 3.40.50.150
3e23A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9602 2 199 3.40.50.150
af_O53979_54_244_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.866 28 128 3.40.50.150
3sm3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8595 36 198 3.40.50.150
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8322 23 136 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W6ZUR4-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9816 59 198 GO:0008757
AF-A0A5B9DT68-F1-model_v4 Class I SAM-dependent methyltransferase 0.9738 4 197 GO:0008168
GO:0032259
AF-G9A821-F1-model_v4 Uncharacterized protein 0.9712 110 199
AF-A0A7S8EFC3-F1-model_v4 Methyltransferase domain-containing protein 0.9699 5 199 GO:0008168
GO:0032259
AF-A0A2E7M4T4-F1-model_v4 deleted 0.9639 32 198

Feature Viewer

pLDDT pTM Quality
93.57 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map