F368463

General Info

Members Datasets Scaffolds Average Seq Length
258 158 241 245

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221559|2643818739
Length 290
Sequence AEPAFVLHTRPWRETSLLVEVLSRNHGRIGLVARGVQGPKKQLLRAALQPLQWIRFDAVQMGEMARLTAAEALDAAPRLSGDGMLAGFYLNELTLRLAPRNDPLPDLFAAYEQARARLGSDASPGWTLRRFERDLLDALGFGFDWHHDGDGAAIDPAARYRLDPEHGPRRLLSDRGHADRSGAATGQALLALADDRLPSTDDLAGLRRAMRGVLAHHLGPRGLKSWELLAELARVAPRAKPGASATATDETTTGEVMPGEAMPDDVVLDEVMPDEVMPDDREPDTDSRDG

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221573 Lysobacter sp. Root604 Isolate Unclassified
6 2643221586 Lysobacter sp. Root667 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221695 Lysobacter sp. Root494 Isolate Unclassified
9 2643221720 Lysobacter sp. Root916 Isolate Unclassified
10 2643221727 Lysobacter sp. Root96 Isolate Unclassified
11 2643221728 Lysobacter sp. Root983 Isolate Unclassified
12 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
13 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
14 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
15 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
16 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
91 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
101 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
106 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
109 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
113 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
114 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
115 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
116 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
117 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
118 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
119 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
158 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.41
Metatranscriptomes 0
Isolates 6.59

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0
Endosphere 22.09
Nodule 0
Rhizoplane 3.49
Rhizosphere 56.2
Stem 0
Stem Tuber 0
Unclassified 17.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10016448 3300003320 Bacteria 31308
2 Ga0055537_1000306 3300003773 Bacteria 33928
3 Ga0055524_1004882 3300003775 Bacteria 6092
4 Ga0055524_1009915 3300003775 Bacteria 3831
5 Ga0055536_1001400 3300003781 Bacteria 14570
6 Ga0055536_1008916 3300003781 Bacteria 4233
7 Ga0055536_1028530 3300003781 Bacteria 1518
8 Ga0055534_1000388 3300003784 Bacteria 27515
9 Ga0055528_1000867 3300003790 Bacteria 20519
10 Ga0055528_1001434 3300003790 Bacteria 14584
11 Ga0055530_10002733 3300003791 Bacteria 10932
12 Ga0055531_10002202 3300003794 Bacteria 13259
13 Ga0055531_10006458 3300003794 Bacteria 6655
14 Ga0055531_10008163 3300003794 Bacteria 5577
15 Ga0055531_10014542 3300003794 Bacteria 3536
16 Ga0055531_10021811 3300003794 Bacteria 2468
17 Ga0065715_10029858 3300005293 Bacteria 1891
18 Ga0065715_10091456 3300005293 Bacteria 5783
19 Ga0068869_100079355 3300005334 Bacteria 2446
20 Ga0068868_100075928 3300005338 Bacteria 2686
21 Ga0070661_100097116 3300005344 Bacteria 2187
22 Ga0070692_10376986 3300005345 Unclassified 889
23 Ga0070669_100182545 3300005353 Bacteria 1642
24 Ga0070701_10119625 3300005438 Bacteria 1482
25 Ga0070663_100000372 3300005455 Bacteria 23558
26 Ga0068867_100147099 3300005459 Bacteria 1848
27 Ga0068853_100000696 3300005539 Bacteria 23230
28 Ga0068853_100032825 3300005539 Bacteria 4400
29 Ga0068853_100203281 3300005539 Bacteria 1803
30 Ga0070672_100011466 3300005543 Bacteria 6182
31 Ga0070672_100015298 3300005543 Bacteria 5460
32 Ga0070665_100000512 3300005548 Bacteria 55689
33 Ga0070665_100036244 3300005548 Bacteria 4962
34 Ga0068855_100058777 3300005563 Bacteria 4501
35 Ga0068855_100509613 3300005563 Bacteria 1307
36 Ga0068856_100359665 3300005614 Bacteria 1474
37 Ga0068852_100203095 3300005616 Bacteria 1876
38 Ga0068852_100617783 3300005616 Bacteria 1089
39 Ga0068852_100622474 3300005616 Unclassified 1085
40 Ga0068852_100622555 3300005616 Bacteria 1085
41 Ga0068858_100068485 3300005842 Bacteria 3289
42 Ga0075364_10000037 3300006051 Bacteria 47111
43 Ga0105240_10009014 3300009093 Bacteria 14171
44 Ga0105240_10010222 3300009093 Bacteria 13208
45 Ga0105240_10016314 3300009093 Bacteria 10061
46 Ga0105243_10411820 3300009148 Bacteria 1258
47 Ga0105248_10000457 3300009177 Bacteria 46486
48 Ga0105248_10012880 3300009177 Bacteria 9223
49 Ga0105237_10002511 3300009545 Bacteria 22722
50 Ga0105249_10000707 3300009553 Bacteria 30264
51 Ga0105239_10000022 3300010375 Bacteria 257744
52 Ga0105239_10009236 3300010375 Bacteria 11149
53 Ga0105239_10038993 3300010375 Bacteria 5204
54 Ga0105239_10420643 3300010375 Bacteria 1514
55 Ga0157371_10059313 3300013102 Bacteria 2713
56 Ga0157370_10176966 3300013104 Bacteria 1983
57 Ga0157374_10117148 3300013296 Bacteria 2567
58 Ga0157378_10030199 3300013297 Bacteria 4788
59 Ga0157375_10003676 3300013308 Bacteria 13318
60 Ga0157375_10077337 3300013308 Bacteria 3357
61 Ga0182008_10014100 3300014497 Bacteria 4191
62 Ga0157376_10052237 3300014969 Bacteria 3398
63 Ga0163161_10028216 3300017792 Bacteria 3984
64 Ga0207425_1012348 3300025245 Bacteria 2008
65 Ga0209565_1000119 3300025263 Bacteria 112825
66 Ga0209673_1000866 3300025273 Bacteria 39283
67 Ga0209673_1047029 3300025273 Bacteria 1173
68 Ga0209675_1000048 3300025291 Bacteria 221457
69 Ga0209675_1005300 3300025291 Bacteria 5430
70 Ga0209675_1015067 3300025291 Bacteria 2316
71 Ga0209676_1000472 3300025292 Bacteria 67063
72 Ga0209676_1000857 3300025292 Bacteria 39244
73 Ga0209676_1001048 3300025292 Bacteria 31833
74 Ga0209676_1002293 3300025292 Bacteria 13961
75 Ga0209676_1006272 3300025292 Bacteria 5918
76 Ga0209676_1006491 3300025292 Bacteria 5758
77 Ga0209676_1006984 3300025292 Bacteria 5428
78 Ga0209025_1001267 3300025294 Bacteria 34816
79 Ga0209025_1013136 3300025294 Bacteria 5229
80 Ga0209025_1035573 3300025294 Bacteria 2248
81 Ga0209025_1036704 3300025294 Bacteria 2189
82 Ga0209025_1068668 3300025294 Bacteria 1272
83 Ga0209564_1000106 3300025295 Bacteria 216131
84 Ga0209564_1012188 3300025295 Bacteria 3769
85 Ga0209564_1014645 3300025295 Bacteria 3244
86 Ga0209758_1025359 3300025297 Bacteria 2605
87 Ga0209050_1001432 3300025298 Bacteria 25688
88 Ga0209050_1033487 3300025298 Bacteria 1557
89 Ga0209256_1001506 3300025299 Bacteria 23600
90 Ga0209256_1004781 3300025299 Bacteria 8237
91 Ga0209256_1007727 3300025299 Bacteria 5207
92 Ga0209051_1007281 3300025303 Bacteria 6073
93 Ga0209051_1034679 3300025303 Bacteria 1888
94 Ga0209257_1000255 3300025304 Bacteria 123098
95 Ga0209257_1000715 3300025304 Bacteria 51044
96 Ga0209257_1001117 3300025304 Bacteria 34675
97 Ga0209257_1003071 3300025304 Bacteria 15043
98 Ga0209257_1003627 3300025304 Bacteria 12981
99 Ga0209257_1026561 3300025304 Bacteria 1948
100 Ga0209257_1028262 3300025304 Bacteria 1849
101 Ga0207695_10005349 3300025913 Bacteria 17073
102 Ga0207695_10008040 3300025913 Bacteria 13278
103 Ga0207695_10012767 3300025913 Bacteria 10057
104 Ga0207671_10004702 3300025914 Bacteria 12904
105 Ga0207652_10342170 3300025921 Bacteria 1350
106 Ga0207681_10025235 3300025923 Bacteria 3821
107 Ga0207659_10211204 3300025926 Bacteria 1555
108 Ga0207644_10364660 3300025931 Bacteria 1176
109 Ga0207709_10304921 3300025935 Bacteria 1186
110 Ga0207691_10003987 3300025940 Bacteria 14334
111 Ga0207691_10027247 3300025940 Bacteria 5361
112 Ga0207711_10000938 3300025941 Bacteria 28108
113 Ga0207689_10226984 3300025942 Bacteria 1543
114 Ga0207679_10314521 3300025945 Bacteria 1354
115 Ga0207667_10098593 3300025949 Bacteria 3015
116 Ga0207667_10492028 3300025949 Bacteria 1244
117 Ga0207651_10391177 3300025960 Bacteria 1181
118 Ga0207658_10000050 3300025986 Bacteria 129714
119 Ga0207658_10027287 3300025986 Bacteria 4010
120 Ga0207639_10001639 3300026041 Bacteria 15076
121 Ga0207678_10001234 3300026067 Bacteria 23558
122 Ga0207702_11009733 3300026078 Bacteria 825
123 Ga0207648_10059186 3300026089 Bacteria 3341
124 Ga0207674_10092989 3300026116 Bacteria 3005
125 Ga0207698_10428005 3300026142 Bacteria 1272
126 Ga0207698_10865922 3300026142 Bacteria 909
127 Ga0209974_10028878 3300027876 Bacteria 1837
128 Ga0268266_10000001 3300028379 Bacteria 4040580
129 Ga0268266_10638276 3300028379 Bacteria 1024
130 Ga0316180_1038155 3300030736 Bacteria 961
131 Ga0316182_1329806 3300030745 Bacteria 1167
132 Ga0307408_100055557 3300031548 Bacteria 2867
133 Ga0307405_10128661 3300031731 Bacteria 1746
134 Ga0307413_10007974 3300031824 Bacteria 4962
135 Ga0307413_10188144 3300031824 Bacteria 1480
136 Ga0307413_10517893 3300031824 Bacteria 961
137 Ga0307412_10056214 3300031911 Bacteria 2622
138 Ga0307416_100542057 3300032002 Bacteria 1235
139 Ga0307414_10015482 3300032004 Bacteria 4603
140 Ga0307414_10046675 3300032004 Bacteria 2975
141 Ga0307414_10166501 3300032004 Bacteria 1757
142 Ga0307414_10784341 3300032004 Bacteria 868
143 Ga0307411_10215197 3300032005 Bacteria 1487
144 Ga0307415_100782832 3300032126 Bacteria 869
145 Ga0307507_10095478 3300033179 Bacteria 2521
146 Ga0373950_0013221 3300034818 Bacteria 1373
147 Ga0395898_0490270 3300037466 Bacteria 1169
148 Ga0395905_0110072 3300037471 Bacteria 2586
149 Ga0436365_0981243 3300039437 Bacteria 1709
150 Ga0436365_1340318 3300039437 Bacteria 6203
151 Ga0439436_0005772 3300041404 Bacteria 3791
152 Ga0439436_0005945 3300041404 Bacteria 3741
153 Ga0439436_0013854 3300041404 Bacteria 2437
154 Ga0439436_0039637 3300041404 Bacteria 1352
155 Ga0439436_0080152 3300041404 Bacteria 909
156 Ga0439439_0005835 3300041406 Bacteria 2831
157 Ga0439439_0044230 3300041406 Bacteria 1159
158 Ga0439465_0001022 3300041413 Bacteria 8908
159 Ga0451837_1083830 3300041494 Bacteria 1239
160 Ga0439445_0010076 3300042004 Bacteria 2231
161 Ga0439432_007793 3300042006 Bacteria 3776
162 Ga0439432_009398 3300042006 Bacteria 3411
163 Ga0439432_068240 3300042006 Bacteria 1087
164 Ga0439449_0000402 3300042007 Bacteria 16035
165 Ga0439449_0015974 3300042007 Bacteria 2821
166 Ga0439449_0028436 3300042007 Bacteria 2083
167 Ga0439449_0081452 3300042007 Bacteria 1194
168 Ga0439462_0087690 3300042015 Bacteria 852
169 Ga0495663_0040924 3300046525 Bacteria 1409
170 Ga0495598_0000663 3300046537 Bacteria 6522
171 Ga0495621_0003468 3300046539 Bacteria 4352
172 Ga0495656_0008092 3300046615 Bacteria 3743
173 Ga0495656_0063857 3300046615 Bacteria 1615
174 Ga0495656_0120215 3300046615 Bacteria 1239
175 Ga0495659_0034021 3300046664 Bacteria 1790
176 Ga0495636_0002202 3300047318 Bacteria 7481
177 Ga0495615_0012671 3300048090 Bacteria 1744
178 Ga0496100_0581265 3300048903 Bacteria 868
179 Ga0496101_0325766 3300048904 Bacteria 1206
180 Ga0496103_0047931 3300048906 Bacteria 2640
181 Ga0496104_0039443 3300048907 Bacteria 4422
182 Ga0496105_0009026 3300048908 Bacteria 7781
183 Ga0496107_0135758 3300048910 Bacteria 1817
184 Ga0496108_0647339 3300048911 Bacteria 919
185 Ga0496115_0000153 3300048918 Bacteria 64207
186 Ga0496115_0005675 3300048918 Bacteria 9083
187 Ga0496116_0039802 3300048919 Bacteria 3244
188 Ga0496117_0000476 3300048920 Bacteria 66684
189 Ga0496117_0005501 3300048920 Bacteria 13273
190 Ga0496117_0042635 3300048920 Bacteria 3310
191 Ga0496117_0088538 3300048920 Bacteria 2003
192 Ga0496118_0000403 3300048921 Bacteria 72390
193 Ga0496118_0012209 3300048921 Bacteria 8275
194 Ga0496118_0012728 3300048921 Bacteria 8041
195 Ga0496118_0024308 3300048921 Bacteria 5234
196 Ga0496119_0000868 3300048922 Bacteria 39828
197 Ga0496119_0006239 3300048922 Bacteria 11136
198 Ga0496120_0001305 3300048923 Bacteria 30984
199 Ga0496120_0003544 3300048923 Bacteria 14111
200 Ga0496121_0001970 3300048924 Bacteria 32682
201 Ga0496121_0054581 3300048924 Bacteria 3336
202 Ga0496121_0101997 3300048924 Bacteria 2212
203 Ga0496122_0000126 3300048925 Bacteria 178362
204 Ga0496122_0000560 3300048925 Bacteria 76145
205 Ga0496122_0086346 3300048925 Bacteria 2160
206 Ga0496123_0000647 3300048926 Bacteria 58089
207 Ga0496123_0007301 3300048926 Bacteria 10482
208 Ga0496123_0046583 3300048926 Bacteria 2939
209 Ga0496124_0016353 3300048927 Bacteria 7058
210 Ga0496124_0117778 3300048927 Bacteria 2127
211 Ga0496125_0036877 3300048928 Bacteria 4259
212 Ga0496125_0045704 3300048928 Bacteria 3681
213 Ga0496126_0000199 3300048929 Bacteria 133742
214 Ga0496126_0002725 3300048929 Bacteria 23349
215 Ga0496126_0155109 3300048929 Bacteria 1960
216 Ga0496126_0515205 3300048929 Bacteria 954
217 Ga0501031_0001587 3300049568 Bacteria 14184
218 Ga0501031_0106763 3300049568 Bacteria 1828
219 Ga0501032_0020481 3300049569 Bacteria 4605
220 Ga0501033_0044682 3300049570 Bacteria 3297
221 Ga0501034_0002793 3300049571 Bacteria 20426
222 Ga0501034_0488004 3300049571 Bacteria 1147
223 Ga0501036_0033768 3300049572 Bacteria 4327
224 Ga0501037_0004911 3300049573 Bacteria 9732
225 Ga0501038_0019115 3300049574 Bacteria 6178
226 Ga0501039_0066943 3300049575 Bacteria 2789
227 Ga0501043_0090295 3300049579 Bacteria 2408
228 Ga0501043_0096414 3300049579 Unclassified 2324
229 Ga0501046_0000225 3300049580 Bacteria 58907
230 Ga0501047_0001964 3300049581 Bacteria 19745
231 Ga0501047_0294874 3300049581 Bacteria 1465
232 Ga0501048_0153609 3300049582 Bacteria 1628
233 Ga0501070_0160587 3300049586 Bacteria 1853
234 Ga0501070_0227454 3300049586 Bacteria 1529
235 Ga0501073_0029843 3300049589 Bacteria 3896
236 Ga0501044_0039239 3300049823 Bacteria 4940
237 Ga0501044_0091159 3300049823 Bacteria 3074
238 nmdc:mga00v17_370_c1 3300050491 Bacteria 25524
239 Ga0500610_0001511 3300053079 Bacteria 7977
240 Ga0500651_0000691 3300053093 Bacteria 16746
241 Ga0500588_0026075 3300053146 Bacteria 1631

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026078 Ga0207702_11009733 Ga0207702_110097332 195
2 3300027876 Ga0209974_10028878 Ga0209974_100288782 200
3 3300032126 Ga0307415_100782832 Ga0307415_1007828322 209
4 3300025931 Ga0207644_10364660 Ga0207644_103646602 221
5 3300025960 Ga0207651_10391177 Ga0207651_103911772 221
6 3300049586 Ga0501070_0160587 Ga0501070_0160587_465_1262 222
7 3300046537 Ga0495598_0000663 Ga0495598_0000663_574_1314 223
8 3300046539 Ga0495621_0003468 Ga0495621_0003468_3191_3931 223
9 3300046615 Ga0495656_0120215 Ga0495656_0120215_426_1166 223
10 3300048090 Ga0495615_0012671 Ga0495615_0012671_605_1345 223
11 3300048920 Ga0496117_0088538 Ga0496117_0088538_796_1491 225
12 3300032005 Ga0307411_10215197 Ga0307411_102151972 227
13 3300005455 Ga0070663_100000372 Ga0070663_1000003728 229
14 3300005539 Ga0068853_100000696 Ga0068853_10000069611 229
15 3300005539 Ga0068853_100032825 Ga0068853_1000328253 229
16 3300005548 Ga0070665_100000512 Ga0070665_10000051210 229
17 3300005563 Ga0068855_100058777 Ga0068855_1000587773 229
18 3300005616 Ga0068852_100617783 Ga0068852_1006177832 229
19 3300005842 Ga0068858_100068485 Ga0068858_1000684853 229
20 3300009177 Ga0105248_10000457 Ga0105248_1000045740 229
21 3300009545 Ga0105237_10002511 Ga0105237_100025111 229
22 3300009553 Ga0105249_10000707 Ga0105249_1000070714 229
23 3300010375 Ga0105239_10009236 Ga0105239_1000923610 229
24 3300010375 Ga0105239_10420643 Ga0105239_104206432 229
25 3300025303 Ga0209051_1034679 Ga0209051_10346792 229
26 3300025914 Ga0207671_10004702 Ga0207671_1000470211 229
27 3300025941 Ga0207711_10000938 Ga0207711_100009382 229
28 3300025949 Ga0207667_10098593 Ga0207667_100985932 229
29 3300025986 Ga0207658_10000050 Ga0207658_10000050111 229
30 3300025986 Ga0207658_10027287 Ga0207658_100272872 229
31 3300026041 Ga0207639_10001639 Ga0207639_1000163913 229
32 3300026067 Ga0207678_10001234 Ga0207678_100012348 229
33 3300026116 Ga0207674_10092989 Ga0207674_100929893 229
34 3300026142 Ga0207698_10428005 Ga0207698_104280052 229
35 3300028379 Ga0268266_10000001 Ga0268266_100000012585 229
36 3300048924 Ga0496121_0101997 Ga0496121_0101997_208_924 229
37 3300048925 Ga0496122_0000126 Ga0496122_0000126_18587_19303 229
38 3300048926 Ga0496123_0007301 Ga0496123_0007301_5391_6107 229
39 3300049568 Ga0501031_0001587 Ga0501031_0001587_4632_5354 229
40 3300049569 Ga0501032_0020481 Ga0501032_0020481_414_1136 229
41 3300049570 Ga0501033_0044682 Ga0501033_0044682_934_1656 229
42 3300049571 Ga0501034_0002793 Ga0501034_0002793_15285_16007 229
43 3300049572 Ga0501036_0033768 Ga0501036_0033768_531_1253 229
44 3300049573 Ga0501037_0004911 Ga0501037_0004911_6144_6866 229
45 3300049574 Ga0501038_0019115 Ga0501038_0019115_4665_5387 229
46 3300049575 Ga0501039_0066943 Ga0501039_0066943_1326_2048 229
47 3300049579 Ga0501043_0096414 Ga0501043_0096414_105_827 229
48 3300049580 Ga0501046_0000225 Ga0501046_0000225_10920_11642 229
49 3300049581 Ga0501047_0001964 Ga0501047_0001964_10600_11322 229
50 3300049582 Ga0501048_0153609 Ga0501048_0153609_513_1235 229
51 3300049586 Ga0501070_0227454 Ga0501070_0227454_180_902 229
52 3300049589 Ga0501073_0029843 Ga0501073_0029843_2738_3460 229
53 3300049823 Ga0501044_0039239 Ga0501044_0039239_792_1514 229
54 3300053079 Ga0500610_0001511 Ga0500610_0001511_6853_7572 229
55 3300053146 Ga0500588_0026075 Ga0500588_0026075_532_1251 229
56 iso_pu_bacteria 2643221559 2643818739 229
57 iso_pu_bacteria 2643221573 2643878393 229
58 iso_pu_bacteria 2643221586 2643940990 229
59 iso_pu_bacteria 2643221612 2644079968 229
60 iso_pu_bacteria 2643221720 2644659697 229
61 iso_pu_bacteria 2643221727 2644695563 229
62 iso_pu_bacteria 2643221728 2644700558 229
63 iso_pu_bacteria 2524614729 2525555785 230
64 iso_pu_bacteria 2571042365 2572255261 230
65 iso_pu_bacteria 2627854209 2630650799 230
66 iso_pu_bacteria 2643221695 2644529956 230
67 iso_pu_bacteria 2939589442 2939591272 230
68 iso_pu_bacteria 2974307012 2974308078 230
69 iso_pu_bacteria 2977247770 2977248810 230
70 iso_pu_bacteria 2984514374 2984516715 230
71 iso_pu_bacteria 2987605356 2987608303 230
72 iso_pu_bacteria 8003014200 8003016307 230
73 3300005293 Ga0065715_10029858 Ga0065715_100298582 233
74 3300005293 Ga0065715_10091456 Ga0065715_100914562 233
75 3300005344 Ga0070661_100097116 Ga0070661_1000971162 233
76 3300005438 Ga0070701_10119625 Ga0070701_101196252 233
77 3300005459 Ga0068867_100147099 Ga0068867_1001470992 233
78 3300005543 Ga0070672_100011466 Ga0070672_1000114665 233
79 3300005543 Ga0070672_100015298 Ga0070672_1000152983 233
80 3300005563 Ga0068855_100509613 Ga0068855_1005096132 233
81 3300005616 Ga0068852_100203095 Ga0068852_1002030952 233
82 3300005616 Ga0068852_100622555 Ga0068852_1006225552 233
83 3300006051 Ga0075364_10000037 Ga0075364_1000003716 233
84 3300009148 Ga0105243_10411820 Ga0105243_104118202 233
85 3300013102 Ga0157371_10059313 Ga0157371_100593134 233
86 3300013104 Ga0157370_10176966 Ga0157370_101769662 233
87 3300013308 Ga0157375_10077337 Ga0157375_100773374 233
88 3300025921 Ga0207652_10342170 Ga0207652_103421702 233
89 3300025926 Ga0207659_10211204 Ga0207659_102112042 233
90 3300025935 Ga0207709_10304921 Ga0207709_103049212 233
91 3300025940 Ga0207691_10003987 Ga0207691_100039876 233
92 3300025940 Ga0207691_10027247 Ga0207691_100272473 233
93 3300025945 Ga0207679_10314521 Ga0207679_103145212 233
94 3300025949 Ga0207667_10492028 Ga0207667_104920282 233
95 3300026089 Ga0207648_10059186 Ga0207648_100591862 233
96 3300030736 Ga0316180_1038155 Ga0316180_10381551 233
97 3300033179 Ga0307507_10095478 Ga0307507_100954784 233
98 3300034818 Ga0373950_0013221 Ga0373950_0013221_557_1300 233
99 3300037466 Ga0395898_0490270 Ga0395898_0490270_71_814 233
100 3300041404 Ga0439436_0005772 Ga0439436_0005772_2576_3310 233
101 3300041404 Ga0439436_0005945 Ga0439436_0005945_1320_2156 233
102 3300041406 Ga0439439_0044230 Ga0439439_0044230_232_1068 233
103 3300041413 Ga0439465_0001022 Ga0439465_0001022_7705_8439 233
104 3300042004 Ga0439445_0010076 Ga0439445_0010076_65_793 233
105 3300042007 Ga0439449_0000402 Ga0439449_0000402_10870_11604 233
106 3300042007 Ga0439449_0081452 Ga0439449_0081452_210_938 233
107 3300046615 Ga0495656_0008092 Ga0495656_0008092_2094_2852 233
108 3300048911 Ga0496108_0647339 Ga0496108_0647339_22_765 233
109 3300049568 Ga0501031_0106763 Ga0501031_0106763_778_1587 233
110 3300049581 Ga0501047_0294874 Ga0501047_0294874_494_1303 233
111 3300049823 Ga0501044_0091159 Ga0501044_0091159_1066_1875 233
112 3300050491 nmdc:mga00v17_370_c1 nmdc:mga00v17_370_c1_4157_4894 233
113 3300053093 Ga0500651_0000691 Ga0500651_0000691_15962_16687 233
114 3300003773 Ga0055537_1000306 Ga0055537_100030612 234
115 3300003775 Ga0055524_1004882 Ga0055524_10048823 234
116 3300003775 Ga0055524_1009915 Ga0055524_10099152 234
117 3300003781 Ga0055536_1001400 Ga0055536_10014006 234
118 3300003781 Ga0055536_1008916 Ga0055536_10089163 234
119 3300003781 Ga0055536_1028530 Ga0055536_10285302 234
120 3300003784 Ga0055534_1000388 Ga0055534_100038812 234
121 3300003790 Ga0055528_1000867 Ga0055528_10008674 234
122 3300003790 Ga0055528_1001434 Ga0055528_10014345 234
123 3300003791 Ga0055530_10002733 Ga0055530_100027339 234
124 3300003794 Ga0055531_10002202 Ga0055531_100022026 234
125 3300003794 Ga0055531_10006458 Ga0055531_100064584 234
126 3300003794 Ga0055531_10008163 Ga0055531_100081632 234
127 3300003794 Ga0055531_10014542 Ga0055531_100145423 234
128 3300003794 Ga0055531_10021811 Ga0055531_100218112 234
129 3300005334 Ga0068869_100079355 Ga0068869_1000793552 234
130 3300005338 Ga0068868_100075928 Ga0068868_1000759283 234
131 3300005345 Ga0070692_10376986 Ga0070692_103769861 234
132 3300005353 Ga0070669_100182545 Ga0070669_1001825452 234
133 3300005539 Ga0068853_100203281 Ga0068853_1002032812 234
134 3300005548 Ga0070665_100036244 Ga0070665_1000362446 234
135 3300005614 Ga0068856_100359665 Ga0068856_1003596652 234
136 3300005616 Ga0068852_100622474 Ga0068852_1006224742 234
137 3300009093 Ga0105240_10010222 Ga0105240_100102226 234
138 3300009177 Ga0105248_10012880 Ga0105248_100128806 234
139 3300013297 Ga0157378_10030199 Ga0157378_100301992 234
140 3300013308 Ga0157375_10003676 Ga0157375_1000367611 234
141 3300014497 Ga0182008_10014100 Ga0182008_100141006 234
142 3300017792 Ga0163161_10028216 Ga0163161_100282162 234
143 3300025245 Ga0207425_1012348 Ga0207425_10123482 234
144 3300025263 Ga0209565_1000119 Ga0209565_10001196 234
145 3300025273 Ga0209673_1000866 Ga0209673_100086622 234
146 3300025273 Ga0209673_1047029 Ga0209673_10470292 234
147 3300025291 Ga0209675_1000048 Ga0209675_100004832 234
148 3300025291 Ga0209675_1005300 Ga0209675_10053006 234
149 3300025291 Ga0209675_1015067 Ga0209675_10150672 234
150 3300025292 Ga0209676_1000472 Ga0209676_100047215 234
151 3300025292 Ga0209676_1000857 Ga0209676_100085720 234
152 3300025292 Ga0209676_1001048 Ga0209676_100104819 234
153 3300025292 Ga0209676_1002293 Ga0209676_100229310 234
154 3300025292 Ga0209676_1006272 Ga0209676_10062723 234
155 3300025292 Ga0209676_1006491 Ga0209676_10064913 234
156 3300025292 Ga0209676_1006984 Ga0209676_10069845 234
157 3300025294 Ga0209025_1001267 Ga0209025_100126727 234
158 3300025294 Ga0209025_1013136 Ga0209025_10131363 234
159 3300025294 Ga0209025_1035573 Ga0209025_10355732 234
160 3300025294 Ga0209025_1036704 Ga0209025_10367041 234
161 3300025294 Ga0209025_1068668 Ga0209025_10686682 234
162 3300025295 Ga0209564_1000106 Ga0209564_1000106133 234
163 3300025295 Ga0209564_1012188 Ga0209564_10121882 234
164 3300025295 Ga0209564_1014645 Ga0209564_10146453 234
165 3300025297 Ga0209758_1025359 Ga0209758_10253593 234
166 3300025298 Ga0209050_1001432 Ga0209050_100143221 234
167 3300025298 Ga0209050_1033487 Ga0209050_10334872 234
168 3300025299 Ga0209256_1001506 Ga0209256_10015062 234
169 3300025299 Ga0209256_1004781 Ga0209256_10047816 234
170 3300025299 Ga0209256_1007727 Ga0209256_10077276 234
171 3300025303 Ga0209051_1007281 Ga0209051_10072812 234
172 3300025304 Ga0209257_1000255 Ga0209257_10002559 234
173 3300025304 Ga0209257_1000715 Ga0209257_100071553 234
174 3300025304 Ga0209257_1001117 Ga0209257_10011175 234
175 3300025304 Ga0209257_1003071 Ga0209257_10030719 234
176 3300025304 Ga0209257_1003627 Ga0209257_10036276 234
177 3300025304 Ga0209257_1026561 Ga0209257_10265613 234
178 3300025304 Ga0209257_1028262 Ga0209257_10282622 234
179 3300025913 Ga0207695_10008040 Ga0207695_1000804011 234
180 3300025923 Ga0207681_10025235 Ga0207681_100252355 234
181 3300025942 Ga0207689_10226984 Ga0207689_102269842 234
182 3300026142 Ga0207698_10865922 Ga0207698_108659221 234
183 3300028379 Ga0268266_10638276 Ga0268266_106382762 234
184 3300030745 Ga0316182_1329806 Ga0316182_13298062 234
185 3300031548 Ga0307408_100055557 Ga0307408_1000555572 234
186 3300031731 Ga0307405_10128661 Ga0307405_101286612 234
187 3300031824 Ga0307413_10007974 Ga0307413_100079743 234
188 3300031824 Ga0307413_10188144 Ga0307413_101881442 234
189 3300031824 Ga0307413_10517893 Ga0307413_105178932 234
190 3300031911 Ga0307412_10056214 Ga0307412_100562143 234
191 3300032002 Ga0307416_100542057 Ga0307416_1005420572 234
192 3300032004 Ga0307414_10015482 Ga0307414_100154826 234
193 3300032004 Ga0307414_10046675 Ga0307414_100466753 234
194 3300032004 Ga0307414_10166501 Ga0307414_101665012 234
195 3300032004 Ga0307414_10784341 Ga0307414_107843411 234
196 3300037471 Ga0395905_0110072 Ga0395905_0110072_588_1337 234
197 3300041404 Ga0439436_0013854 Ga0439436_0013854_1142_1912 234
198 3300041404 Ga0439436_0039637 Ga0439436_0039637_87_818 234
199 3300041404 Ga0439436_0080152 Ga0439436_0080152_76_807 234
200 3300041406 Ga0439439_0005835 Ga0439439_0005835_1964_2695 234
201 3300041494 Ga0451837_1083830 Ga0451837_1083830_100_855 234
202 3300042006 Ga0439432_007793 Ga0439432_007793_1310_2041 234
203 3300042006 Ga0439432_009398 Ga0439432_009398_1526_2257 234
204 3300042006 Ga0439432_068240 Ga0439432_068240_84_815 234
205 3300042007 Ga0439449_0015974 Ga0439449_0015974_1013_1744 234
206 3300042007 Ga0439449_0028436 Ga0439449_0028436_167_898 234
207 3300042015 Ga0439462_0087690 Ga0439462_0087690_73_804 234
208 3300046525 Ga0495663_0040924 Ga0495663_0040924_629_1354 234
209 3300046615 Ga0495656_0063857 Ga0495656_0063857_92_823 234
210 3300046664 Ga0495659_0034021 Ga0495659_0034021_171_902 234
211 3300047318 Ga0495636_0002202 Ga0495636_0002202_2974_3705 234
212 3300048919 Ga0496116_0039802 Ga0496116_0039802_2215_2937 234
213 3300048920 Ga0496117_0000476 Ga0496117_0000476_3392_4114 234
214 3300048920 Ga0496117_0042635 Ga0496117_0042635_1958_2680 234
215 3300048921 Ga0496118_0000403 Ga0496118_0000403_3389_4111 234
216 3300048921 Ga0496118_0024308 Ga0496118_0024308_4061_4783 234
217 3300048925 Ga0496122_0000560 Ga0496122_0000560_35637_36362 234
218 3300048925 Ga0496122_0086346 Ga0496122_0086346_1025_1747 234
219 3300048926 Ga0496123_0000647 Ga0496123_0000647_35615_36340 234
220 3300048926 Ga0496123_0046583 Ga0496123_0046583_1019_1741 234
221 3300048927 Ga0496124_0016353 Ga0496124_0016353_2030_2752 234
222 3300048927 Ga0496124_0117778 Ga0496124_0117778_426_1148 234
223 3300048928 Ga0496125_0036877 Ga0496125_0036877_2808_3530 234
224 3300048928 Ga0496125_0045704 Ga0496125_0045704_777_1499 234
225 3300048929 Ga0496126_0515205 Ga0496126_0515205_181_906 234
226 3300049571 Ga0501034_0488004 Ga0501034_0488004_353_1066 234
227 3300049579 Ga0501043_0090295 Ga0501043_0090295_1323_2072 234
228 3300010375 Ga0105239_10038993 Ga0105239_100389932 235
229 3300013296 Ga0157374_10117148 Ga0157374_101171482 235
230 3300014969 Ga0157376_10052237 Ga0157376_100522373 235
231 3300039437 Ga0436365_0981243 Ga0436365_0981243_841_1566 235
232 3300039437 Ga0436365_1340318 Ga0436365_1340318_1396_2121 235
233 3300048906 Ga0496103_0047931 Ga0496103_0047931_1063_1788 235
234 3300048918 Ga0496115_0000153 Ga0496115_0000153_47374_48099 235
235 3300048929 Ga0496126_0000199 Ga0496126_0000199_38036_38761 235
236 3300003320 rootH2_10016448 rootH2_1001644824 238
237 3300009093 Ga0105240_10009014 Ga0105240_1000901410 238
238 3300009093 Ga0105240_10016314 Ga0105240_100163143 238
239 3300010375 Ga0105239_10000022 Ga0105239_1000002215 238
240 3300025913 Ga0207695_10005349 Ga0207695_1000534910 238
241 3300025913 Ga0207695_10012767 Ga0207695_100127673 238
242 3300048903 Ga0496100_0581265 Ga0496100_0581265_41_766 238
243 3300048904 Ga0496101_0325766 Ga0496101_0325766_149_874 238
244 3300048907 Ga0496104_0039443 Ga0496104_0039443_2223_2948 238
245 3300048908 Ga0496105_0009026 Ga0496105_0009026_232_957 238
246 3300048910 Ga0496107_0135758 Ga0496107_0135758_252_977 238
247 3300048918 Ga0496115_0005675 Ga0496115_0005675_286_1011 238
248 3300048920 Ga0496117_0005501 Ga0496117_0005501_11541_12368 238
249 3300048921 Ga0496118_0012209 Ga0496118_0012209_1979_2806 238
250 3300048921 Ga0496118_0012728 Ga0496118_0012728_7157_7882 238
251 3300048922 Ga0496119_0000868 Ga0496119_0000868_12560_13285 238
252 3300048922 Ga0496119_0006239 Ga0496119_0006239_2426_3253 238
253 3300048923 Ga0496120_0001305 Ga0496120_0001305_11906_12733 238
254 3300048923 Ga0496120_0003544 Ga0496120_0003544_5444_6169 238
255 3300048924 Ga0496121_0001970 Ga0496121_0001970_30901_31626 238
256 3300048924 Ga0496121_0054581 Ga0496121_0054581_1535_2260 238
257 3300048929 Ga0496126_0002725 Ga0496126_0002725_18148_18873 238
258 3300048929 Ga0496126_0155109 Ga0496126_0155109_999_1826 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11967

RecO_N

Recombination protein O N terminal

1

76

0.94

PF02565

RecO_C

Recombination protein O C terminal

78

227

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q8d-assembly1.cif.gz_A e. coli reco complex with ssb c-terminus 0.9247 6 232
3q8d-assembly1.cif.gz_A e. coli reco complex with ssb c-terminus 0.9017 6 232
7ymo-assembly1.cif.gz_A crystal structure of the recombination mediator protein reco from campylobacter jejuni 0.7604 3 213
7ymo-assembly1.cif.gz_A crystal structure of the recombination mediator protein reco from campylobacter jejuni 0.7509 3 213
1u5k-assembly1.cif.gz_B recombinational repair protein reco 0.7431 2 228
ID Description Score Start End Superfamily
3q8dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9091 3 82 2.40.50.140
af_P0A7H3_79_242_1.20.1440.120 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);Recombination protein O, C-terminal domain 0.8997 83 232 1.20.1440.120
3q8dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8981 3 82 2.40.50.140
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8824 1 81 2.40.50.140
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8234 1 81 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1G3F5S8-F1-model_v4 DNA repair protein RecO 0.9807 63 235 GO:0006302
GO:0006310
GO:0043590
AF-A0A0G9HJN1-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9794 1 230 GO:0006302
GO:0006310
GO:0043590
AF-A0A0G9HJN1-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.971 1 230 GO:0006302
GO:0006310
GO:0043590
AF-A0A3D3S8E5-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9613 1 234 GO:0006302
GO:0006310
GO:0043590
AF-A0A534AGH9-F1-model_v4 DNA repair protein RecO 0.9609 52 237 GO:0006302
GO:0006310
GO:0043590

Feature Viewer

pLDDT pTM Quality
90.92 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map