F368308

General Info

Members Datasets Scaffolds Average Seq Length
258 197 241 211

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0000003|Ga0495629_0000003_260474_261208
Length 244
Sequence LDDSGGSLEGSFARLAGHSGDNRTHGTHTGQEVRVTPYRLPDLEYDYGALEPHISGKIMELHHNKHHAAYVKQANETLARLDEARVSADAGARLMRLSALEHALAFNLSGHILHSIFWKNLKPQAGDKPAGELASAIDRDFGSFSQFRKQMNGVAAGIMGSGWAALTWEPYGSRLLITQIYDHQSNLNQAGVPLMLIDAWEHAYYLQYYNEKTKYFDAIWNLWNWNDIAVRFTAARQLDLALAG

Samples

Sample ID Description Type Environment
1 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221616 Leifsonia sp. Root227 Isolate Unclassified
4 2643221630 Microbacterium sp. Root322 Isolate Unclassified
5 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
6 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
7 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
8 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
9 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
10 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
11 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
12 2919395869 Microbacterium resistens 2980 Isolate Unclassified
13 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
14 2922554459 Rhodococcus sp. 66b Isolate Unclassified
15 2928153084 Leifsonia sp. 563 Isolate Unclassified
16 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
21 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
192 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.31
Metatranscriptomes 3.1
Isolates 6.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.47
Nodule 0
Rhizoplane 1.94
Rhizosphere 81.01
Stem 0
Stem Tuber 0.39
Unclassified 6.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10019964 3300001979 Bacteria 2350
2 JGI24740J21852_10068086 3300001979 Bacteria 961
3 JGI25164J39214_1000773 3300002772 Bacteria 11667
4 Ga0055539_1000008 3300003752 Bacteria 537665
5 Ga0058860_12244880 3300004801 Bacteria 815
6 Ga0058862_12598435 3300004803 Bacteria 807
7 Ga0070683_100591653 3300005329 Bacteria 1061
8 Ga0070690_100051457 3300005330 Bacteria 2630
9 Ga0070690_100368112 3300005330 Bacteria 1048
10 Ga0070670_100113895 3300005331 Bacteria 2331
11 Ga0070670_100145678 3300005331 Bacteria 2049
12 Ga0068868_100064716 3300005338 Bacteria 2903
13 Ga0070660_100220123 3300005339 Bacteria 1543
14 Ga0070689_100018437 3300005340 Bacteria 5141
15 Ga0070689_100095059 3300005340 Bacteria 2354
16 Ga0070687_100010580 3300005343 Bacteria 3998
17 Ga0070668_100222993 3300005347 Bacteria 1555
18 Ga0070675_100018866 3300005354 Bacteria 5492
19 Ga0070675_100735354 3300005354 Bacteria 900
20 Ga0070673_100433126 3300005364 Bacteria 1181
21 Ga0070688_100043305 3300005365 Bacteria 2773
22 Ga0070659_100201680 3300005366 Bacteria 1638
23 Ga0070705_100057147 3300005440 Bacteria 2301
24 Ga0070708_100006593 3300005445 Bacteria 9240
25 Ga0070708_100056289 3300005445 Bacteria 3498
26 Ga0070708_100150064 3300005445 Bacteria 2167
27 Ga0070663_100085073 3300005455 Bacteria 2333
28 Ga0068867_100011974 3300005459 Bacteria 6128
29 Ga0070685_10027889 3300005466 Bacteria 3125
30 Ga0070706_100047859 3300005467 Bacteria 3946
31 Ga0070707_100325147 3300005468 Bacteria 1494
32 Ga0070699_100329183 3300005518 Bacteria 1374
33 Ga0070684_100310391 3300005535 Bacteria 1448
34 Ga0070684_100959641 3300005535 Bacteria 802
35 Ga0070697_100130482 3300005536 Bacteria 2107
36 Ga0070686_100010270 3300005544 Bacteria 5273
37 Ga0070695_100208215 3300005545 Bacteria 1402
38 Ga0070696_100035577 3300005546 Bacteria 3430
39 Ga0070693_100388123 3300005547 Bacteria 965
40 Ga0070704_100183490 3300005549 Bacteria 1676
41 Ga0070664_100036505 3300005564 Bacteria 4129
42 Ga0070702_100053996 3300005615 Bacteria 2310
43 Ga0068852_100217854 3300005616 Bacteria 1814
44 Ga0068859_100097083 3300005617 Bacteria 2999
45 Ga0068864_100630202 3300005618 Bacteria 1043
46 Ga0068866_10332270 3300005718 Bacteria 960
47 Ga0068861_100071838 3300005719 Bacteria 2683
48 Ga0068870_10020039 3300005840 Bacteria 3251
49 Ga0068863_100040802 3300005841 Bacteria 4412
50 Ga0068858_100077482 3300005842 Bacteria 3088
51 Ga0068858_100587329 3300005842 Bacteria 1080
52 Ga0068860_100086200 3300005843 Bacteria 2988
53 Ga0068862_100057830 3300005844 Bacteria 3326
54 Ga0075365_10008050 3300006038 Bacteria 5952
55 Ga0075365_10064137 3300006038 Bacteria 2460
56 Ga0075368_10100720 3300006042 Bacteria 1186
57 Ga0075363_100038937 3300006048 Bacteria 2501
58 Ga0075363_100071934 3300006048 Bacteria 1880
59 Ga0075364_10049857 3300006051 Bacteria 2731
60 Ga0075364_10158061 3300006051 Bacteria 1529
61 Ga0075362_10114123 3300006177 Bacteria 1274
62 Ga0075367_10000137 3300006178 Bacteria 21968
63 Ga0075367_10003218 3300006178 Bacteria 7717
64 Ga0075366_10004118 3300006195 Bacteria 7780
65 Ga0075366_10239065 3300006195 Bacteria 1107
66 Ga0068871_100114724 3300006358 Bacteria 2270
67 Ga0075428_100003374 3300006844 Bacteria 17466
68 Ga0075428_100080849 3300006844 Bacteria 3547
69 Ga0075428_100231996 3300006844 Bacteria 1992
70 Ga0075428_100337015 3300006844 Bacteria 1620
71 Ga0075431_100008511 3300006847 Bacteria 10274
72 Ga0075431_100093396 3300006847 Bacteria 3105
73 Ga0075433_10262420 3300006852 Bacteria 1531
74 Ga0075433_10949041 3300006852 Bacteria 750
75 Ga0075434_100523363 3300006871 Bacteria 1206
76 Ga0075429_100055806 3300006880 Bacteria 3437
77 Ga0075429_100419178 3300006880 Bacteria 1172
78 Ga0068865_100086398 3300006881 Bacteria 2264
79 Ga0075436_100209382 3300006914 Bacteria 1382
80 Ga0097620_100097088 3300006931 Bacteria 2999
81 Ga0075435_100007062 3300007076 Bacteria 7973
82 Ga0075435_100283344 3300007076 Bacteria 1415
83 Ga0111539_10002695 3300009094 Bacteria 23526
84 Ga0105245_10076293 3300009098 Bacteria 3053
85 Ga0114129_10631147 3300009147 Bacteria 1385
86 Ga0114129_10729837 3300009147 Bacteria 1270
87 Ga0105242_10714096 3300009176 Bacteria 982
88 Ga0105248_10008725 3300009177 Bacteria 11135
89 Ga0105248_10028123 3300009177 Bacteria 6262
90 Ga0105238_10296710 3300009551 Bacteria 1599
91 Ga0105238_10506208 3300009551 Bacteria 1209
92 Ga0105249_11367904 3300009553 Bacteria 780
93 Ga0105239_10646698 3300010375 Bacteria 1208
94 Ga0157373_10535421 3300013100 Bacteria 848
95 Ga0157378_10267570 3300013297 Bacteria 1642
96 Ga0163162_10309505 3300013306 Bacteria 1712
97 Ga0157372_10629845 3300013307 Bacteria 1250
98 Ga0157375_10051763 3300013308 Bacteria 4034
99 Ga0163163_10593667 3300014325 Eukaryota 1171
100 Ga0206349_1073246 3300020075 Bacteria 1152
101 Ga0206352_10868500 3300020078 Bacteria 923
102 Ga0224712_10096998 3300022467 Bacteria 1244
103 Ga0207643_10095194 3300025908 Bacteria 1740
104 Ga0207684_10233150 3300025910 Bacteria 1588
105 Ga0207707_10383466 3300025912 Bacteria 1208
106 Ga0207693_10329424 3300025915 Bacteria 1195
107 Ga0207662_10000306 3300025918 Bacteria 22584
108 Ga0207649_10106286 3300025920 Bacteria 1867
109 Ga0207649_10646527 3300025920 Bacteria 817
110 Ga0207646_10034156 3300025922 Bacteria 4596
111 Ga0207681_10566700 3300025923 Bacteria 936
112 Ga0207650_10185188 3300025925 Bacteria 1661
113 Ga0207687_10401876 3300025927 Bacteria 1127
114 Ga0207706_10053223 3300025933 Bacteria 3573
115 Ga0207706_10200881 3300025933 Bacteria 1748
116 Ga0207669_10193494 3300025937 Bacteria 1469
117 Ga0207665_10150591 3300025939 Bacteria 1666
118 Ga0207691_10004713 3300025940 Bacteria 13198
119 Ga0207691_10707070 3300025940 Bacteria 850
120 Ga0207711_10123866 3300025941 Bacteria 2310
121 Ga0207711_10862403 3300025941 Bacteria 842
122 Ga0207689_10076908 3300025942 Bacteria 2744
123 Ga0207661_10389835 3300025944 Bacteria 1262
124 Ga0207668_10195588 3300025972 Bacteria 1606
125 Ga0207677_10208614 3300026023 Bacteria 1558
126 Ga0207677_10648747 3300026023 Bacteria 931
127 Ga0207703_10029835 3300026035 Bacteria 4305
128 Ga0207678_10006195 3300026067 Bacteria 10625
129 Ga0207708_10910159 3300026075 Bacteria 761
130 Ga0207648_10006745 3300026089 Bacteria 11387
131 Ga0207674_10389993 3300026116 Bacteria 1346
132 Ga0207675_100067066 3300026118 Bacteria 3354
133 Ga0207698_10157568 3300026142 Bacteria 1981
134 Ga0209974_10002257 3300027876 Bacteria 7008
135 Ga0209974_10175700 3300027876 Bacteria 782
136 Ga0207428_10000343 3300027907 Bacteria 60532
137 Ga0268265_10110453 3300028380 Bacteria 2243
138 Ga0268264_10467094 3300028381 Bacteria 1225
139 Ga0265334_10004066 3300028573 Bacteria 6565
140 Ga0265331_10026265 3300031250 Bacteria 2930
141 Ga0373923_0055896 3300035111 Bacteria 1665
142 Ga0373936_0045619 3300035113 Bacteria 1766
143 Ga0373943_0003901 3300035170 Bacteria 6789
144 Ga0373943_0147774 3300035170 Bacteria 1271
145 Ga0373927_0447053 3300035695 Bacteria 853
146 Ga0373947_0379694 3300035725 Bacteria 951
147 Ga0373937_1167628 3300036401 Bacteria 718
148 Ga0373925_0116680 3300037068 Bacteria 2068
149 Ga0450889_030992 3300042144 Bacteria 625
150 Ga0466972_0114807 3300044658 Bacteria 1271
151 Ga0466960_0226461 3300044901 Bacteria 1030
152 Ga0495629_0000003 3300046459 Bacteria 529162
153 Ga0495622_0301255 3300046557 Bacteria 698
154 Ga0495635_0000948 3300046663 Bacteria 19132
155 Ga0495600_0024489 3300046809 Bacteria 3885
156 Ga0495581_0148676 3300047315 Bacteria 1368
157 Ga0495672_0000494 3300047320 Bacteria 45566
158 Ga0495680_0007984 3300047322 Bacteria 9648
159 Ga0495684_0001602 3300047471 Bacteria 18172
160 Ga0496101_0092877 3300048904 Unclassified 2247
161 Ga0496102_0132492 3300048905 Bacteria 2334
162 Ga0496104_0533340 3300048907 Bacteria 1085
163 Ga0496110_0186628 3300048913 Bacteria 1883
164 Ga0496113_1055824 3300048916 Bacteria 638
165 Ga0496122_0000430 3300048925 Bacteria 88467
166 Ga0496122_0046810 3300048925 Bacteria 3345
167 Ga0496123_0000634 3300048926 Bacteria 58737
168 Ga0496124_0001172 3300048927 Bacteria 41005
169 Ga0496125_0007370 3300048928 Bacteria 11715
170 Ga0496126_0067009 3300048929 Bacteria 3209
171 Ga0501310_000146 3300049130 Bacteria 7009
172 Ga0501032_0008693 3300049569 Bacteria 7396
173 Ga0501032_0095859 3300049569 Bacteria 1967
174 Ga0501033_0565044 3300049570 Bacteria 783
175 Ga0501036_0493443 3300049572 Bacteria 1019
176 Ga0501046_0389634 3300049580 Bacteria 1007
177 Ga0501067_0178621 3300049583 Bacteria 1182
178 Ga0501068_0009378 3300049584 Bacteria 5474
179 Ga0501068_0035534 3300049584 Bacteria 2975
180 Ga0501068_0040193 3300049584 Bacteria 2807
181 Ga0501069_0017518 3300049585 Bacteria 3857
182 Ga0501069_0112927 3300049585 Bacteria 1548
183 Ga0501070_0000101 3300049586 Bacteria 74887
184 Ga0501071_0121889 3300049587 Bacteria 1933
185 Ga0501071_0161434 3300049587 Bacteria 1675
186 Ga0501071_0387241 3300049587 Bacteria 1067
187 Ga0501072_0125883 3300049588 Bacteria 2042
188 Ga0501072_0618516 3300049588 Bacteria 853
189 Ga0501073_0002695 3300049589 Bacteria 13298
190 Ga0501073_0031182 3300049589 Bacteria 3804
191 Ga0501073_0528674 3300049589 Bacteria 815
192 Ga0501074_0014317 3300049590 Bacteria 5770
193 Ga0501074_0109627 3300049590 Bacteria 1975
194 Ga0501075_0061457 3300049591 Bacteria 2831
195 Ga0501076_0013318 3300049592 Bacteria 6166
196 Ga0501076_0023558 3300049592 Bacteria 4748
197 Ga0501076_0070486 3300049592 Bacteria 2795
198 Ga0501079_0546812 3300049741 Bacteria 910
199 Ga0501080_0039068 3300049742 Bacteria 4429
200 Ga0501080_0115629 3300049742 Bacteria 2487
201 Ga0501080_0206026 3300049742 Bacteria 1804
202 Ga0501080_0299510 3300049742 Bacteria 1459
203 Ga0501081_0176454 3300049743 Bacteria 1544
204 Ga0501083_0001816 3300049744 Bacteria 14627
205 Ga0501083_0044202 3300049744 Bacteria 3015
206 Ga0501083_0147619 3300049744 Bacteria 1540
207 Ga0501035_0329686 3300049822 Unclassified 1281
208 Ga0501045_0221145 3300049824 Bacteria 1410
209 Ga0501045_0662831 3300049824 Bacteria 771
210 nmdc:mga03683_4979_c1 3300050489 Bacteria 4445
211 nmdc:mga03n38_240457_c1 3300050490 Bacteria 952
212 nmdc:mga00v17_288578_c1 3300050491 Bacteria 1065
213 nmdc:mga00v17_6528_c1 3300050491 Bacteria 6192
214 nmdc:mga0yw44_52719_c1 3300050492 Bacteria 2467
215 nmdc:mga0yw44_5607_c1 3300050492 Bacteria 5964
216 nmdc:mga0k408_2231_c1 3300050493 Bacteria 10365
217 nmdc:mga06z11_2252_c1 3300050494 Bacteria 7334
218 nmdc:mga04h51_49742_c1 3300050495 Bacteria 1402
219 nmdc:mga07m45_159181_c1 3300050496 Bacteria 1310
220 nmdc:mga07m45_246028_c1 3300050496 Bacteria 1040
221 nmdc:mga09592_58545_c1 3300050508 Bacteria 3258
222 nmdc:mga0qj67_24522_c1 3300050509 Bacteria 4650
223 nmdc:mga06r32_4111_c1 3300050510 Bacteria 13039
224 nmdc:mga06r32_419230_c1 3300050510 Bacteria 1320
225 nmdc:mga08y16_5129_c1 3300050511 Bacteria 13690
226 nmdc:mga0n895_120875_c1 3300050512 Bacteria 2640
227 nmdc:mga0n895_505869_c1 3300050512 Bacteria 1217
228 nmdc:mga0rr50_941594_c1 3300050513 Bacteria 736
229 nmdc:mga0a205_219291_c1 3300050515 Bacteria 1788
230 nmdc:mga0a205_378089_c1 3300050515 Bacteria 1282
231 Ga0500624_015599 3300053157 Bacteria 1164
232 Ga0500637_0301433 3300053178 Bacteria 874
233 Ga0501084_0152504 3300054114 Bacteria 1948
234 Ga0501084_0561040 3300054114 Bacteria 965
235 Ga0501084_0814911 3300054114 Bacteria 786
236 Ga0587082_058621 3300059504 Bacteria 754
237 Ga0587090_014258 3300059510 Bacteria 1160
238 Ga0501082_0014234 3300060353 Bacteria 6846
239 Ga0501082_0170087 3300060353 Bacteria 1894
240 Ga0501082_0716903 3300060353 Bacteria 875
241 Ga0530510_0013757 3300061734 Bacteria 5696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025940 Ga0207691_10707070 Ga0207691_107070701 168
2 3300046557 Ga0495622_0301255 Ga0495622_0301255_35_559 170
3 3300025912 Ga0207707_10383466 Ga0207707_103834663 178
4 3300049824 Ga0501045_0662831 Ga0501045_0662831_37_573 178
5 3300035695 Ga0373927_0447053 Ga0373927_0447053_274_825 183
6 3300049585 Ga0501069_0017518 Ga0501069_0017518_30_581 183
7 3300025941 Ga0207711_10862403 Ga0207711_108624032 184
8 3300042144 Ga0450889_030992 Ga0450889_030992_14_586 184
9 3300048916 Ga0496113_1055824 Ga0496113_1055824_22_576 184
10 3300049742 Ga0501080_0206026 Ga0501080_0206026_434_1033 192
11 3300005366 Ga0070659_100201680 Ga0070659_1002016802 198
12 3300059510 Ga0587090_014258 Ga0587090_014258_213_812 199
13 3300049742 Ga0501080_0299510 Ga0501080_0299510_114_716 200
14 3300049587 Ga0501071_0387241 Ga0501071_0387241_145_783 201
15 3300049588 Ga0501072_0125883 Ga0501072_0125883_1304_1942 201
16 3300061734 Ga0530510_0013757 Ga0530510_0013757_1954_2592 201
17 3300005535 Ga0070684_100310391 Ga0070684_1003103912 202
18 3300010375 Ga0105239_10646698 Ga0105239_106466982 202
19 3300013307 Ga0157372_10629845 Ga0157372_106298452 202
20 3300025944 Ga0207661_10389835 Ga0207661_103898352 202
21 3300048905 Ga0496102_0132492 Ga0496102_0132492_353_967 202
22 3300048913 Ga0496110_0186628 Ga0496110_0186628_211_825 202
23 3300049584 Ga0501068_0035534 Ga0501068_0035534_2068_2682 202
24 iso_pu_bacteria 2565956761 2566997292 202
25 iso_pu_bacteria 2738541308 2738891203 202
26 iso_pu_bacteria 2904535858 2904536234 202
27 iso_pu_bacteria 2922554459 2922558162 202
28 3300044901 Ga0466960_0226461 Ga0466960_0226461_67_678 203
29 iso_pu_bacteria 2883821847 2883823162 203
30 iso_pu_bacteria 2883821847 2883824442 203
31 3300027876 Ga0209974_10002257 Ga0209974_100022576 204
32 3300049130 Ga0501310_000146 Ga0501310_000146_5862_6479 204
33 3300053157 Ga0500624_015599 Ga0500624_015599_326_943 204
34 3300053178 Ga0500637_0301433 Ga0500637_0301433_124_741 204
35 iso_pu_bacteria 2643221542 2643733403 204
36 iso_pu_bacteria 2643221616 2644096119 204
37 iso_pu_bacteria 2643221630 2644169977 204
38 iso_pu_bacteria 2844841374 2844842532 204
39 iso_pu_bacteria 2852632344 2852633423 204
40 iso_pu_bacteria 2862993130 2862996288 204
41 iso_pu_bacteria 2884763398 2884765485 204
42 iso_pu_bacteria 2919395869 2919398338 204
43 iso_pu_bacteria 2919523602 2919524591 204
44 iso_pu_bacteria 2928153084 2928156486 204
45 iso_pu_bacteria 2964326757 2964329695 204
46 3300006852 Ga0075433_10262420 Ga0075433_102624202 205
47 3300006871 Ga0075434_100523363 Ga0075434_1005233631 205
48 3300006914 Ga0075436_100209382 Ga0075436_1002093821 205
49 3300050512 nmdc:mga0n895_505869_c1 nmdc:mga0n895_505869_c1_502_1119 205
50 3300050515 nmdc:mga0a205_378089_c1 nmdc:mga0a205_378089_c1_291_908 205
51 3300006048 Ga0075363_100071934 Ga0075363_1000719342 206
52 3300046459 Ga0495629_0000003 Ga0495629_0000003_260474_261208 206
53 3300046663 Ga0495635_0000948 Ga0495635_0000948_12273_12938 206
54 3300046809 Ga0495600_0024489 Ga0495600_0024489_2135_2800 206
55 3300047315 Ga0495581_0148676 Ga0495581_0148676_316_981 206
56 3300047322 Ga0495680_0007984 Ga0495680_0007984_1582_2247 206
57 3300047471 Ga0495684_0001602 Ga0495684_0001602_6681_7346 206
58 3300005445 Ga0070708_100150064 Ga0070708_1001500642 207
59 3300005467 Ga0070706_100047859 Ga0070706_1000478592 207
60 3300005468 Ga0070707_100325147 Ga0070707_1003251472 207
61 3300005518 Ga0070699_100329183 Ga0070699_1003291831 207
62 3300005535 Ga0070684_100959641 Ga0070684_1009596411 207
63 3300005536 Ga0070697_100130482 Ga0070697_1001304822 207
64 3300005546 Ga0070696_100035577 Ga0070696_1000355774 207
65 3300005549 Ga0070704_100183490 Ga0070704_1001834901 207
66 3300006852 Ga0075433_10949041 Ga0075433_109490411 207
67 3300007076 Ga0075435_100283344 Ga0075435_1002833442 207
68 3300009147 Ga0114129_10631147 Ga0114129_106311472 207
69 3300025910 Ga0207684_10233150 Ga0207684_102331502 207
70 3300025922 Ga0207646_10034156 Ga0207646_100341561 207
71 3300035170 Ga0373943_0147774 Ga0373943_0147774_502_1125 207
72 3300037068 Ga0373925_0116680 Ga0373925_0116680_618_1241 207
73 3300048907 Ga0496104_0533340 Ga0496104_0533340_403_1026 207
74 3300049584 Ga0501068_0040193 Ga0501068_0040193_1742_2365 207
75 3300049585 Ga0501069_0112927 Ga0501069_0112927_640_1263 207
76 3300049586 Ga0501070_0000101 Ga0501070_0000101_15131_15754 207
77 3300049589 Ga0501073_0031182 Ga0501073_0031182_950_1573 207
78 3300049590 Ga0501074_0014317 Ga0501074_0014317_527_1150 207
79 3300049742 Ga0501080_0115629 Ga0501080_0115629_319_942 207
80 3300049744 Ga0501083_0001816 Ga0501083_0001816_3083_3706 207
81 3300060353 Ga0501082_0014234 Ga0501082_0014234_433_1056 207
82 3300001979 JGI24740J21852_10019964 JGI24740J21852_100199641 208
83 3300001979 JGI24740J21852_10068086 JGI24740J21852_100680861 208
84 3300002772 JGI25164J39214_1000773 JGI25164J39214_10007737 208
85 3300003752 Ga0055539_1000008 Ga0055539_1000008205 208
86 3300004801 Ga0058860_12244880 Ga0058860_122448802 208
87 3300004803 Ga0058862_12598435 Ga0058862_125984351 208
88 3300005329 Ga0070683_100591653 Ga0070683_1005916532 208
89 3300005330 Ga0070690_100051457 Ga0070690_1000514572 208
90 3300005330 Ga0070690_100368112 Ga0070690_1003681121 208
91 3300005331 Ga0070670_100113895 Ga0070670_1001138955 208
92 3300005331 Ga0070670_100145678 Ga0070670_1001456783 208
93 3300005338 Ga0068868_100064716 Ga0068868_1000647163 208
94 3300005339 Ga0070660_100220123 Ga0070660_1002201233 208
95 3300005340 Ga0070689_100018437 Ga0070689_1000184373 208
96 3300005340 Ga0070689_100095059 Ga0070689_1000950592 208
97 3300005343 Ga0070687_100010580 Ga0070687_1000105803 208
98 3300005347 Ga0070668_100222993 Ga0070668_1002229932 208
99 3300005354 Ga0070675_100018866 Ga0070675_1000188661 208
100 3300005354 Ga0070675_100735354 Ga0070675_1007353541 208
101 3300005364 Ga0070673_100433126 Ga0070673_1004331261 208
102 3300005365 Ga0070688_100043305 Ga0070688_1000433053 208
103 3300005440 Ga0070705_100057147 Ga0070705_1000571472 208
104 3300005445 Ga0070708_100006593 Ga0070708_1000065935 208
105 3300005445 Ga0070708_100056289 Ga0070708_1000562893 208
106 3300005455 Ga0070663_100085073 Ga0070663_1000850733 208
107 3300005459 Ga0068867_100011974 Ga0068867_1000119745 208
108 3300005466 Ga0070685_10027889 Ga0070685_100278892 208
109 3300005544 Ga0070686_100010270 Ga0070686_1000102702 208
110 3300005545 Ga0070695_100208215 Ga0070695_1002082152 208
111 3300005547 Ga0070693_100388123 Ga0070693_1003881232 208
112 3300005564 Ga0070664_100036505 Ga0070664_1000365054 208
113 3300005615 Ga0070702_100053996 Ga0070702_1000539962 208
114 3300005616 Ga0068852_100217854 Ga0068852_1002178541 208
115 3300005617 Ga0068859_100097083 Ga0068859_1000970833 208
116 3300005618 Ga0068864_100630202 Ga0068864_1006302022 208
117 3300005718 Ga0068866_10332270 Ga0068866_103322701 208
118 3300005719 Ga0068861_100071838 Ga0068861_1000718381 208
119 3300005840 Ga0068870_10020039 Ga0068870_100200392 208
120 3300005841 Ga0068863_100040802 Ga0068863_1000408023 208
121 3300005842 Ga0068858_100077482 Ga0068858_1000774822 208
122 3300005842 Ga0068858_100587329 Ga0068858_1005873292 208
123 3300005843 Ga0068860_100086200 Ga0068860_1000862002 208
124 3300005844 Ga0068862_100057830 Ga0068862_1000578303 208
125 3300006038 Ga0075365_10008050 Ga0075365_100080503 208
126 3300006038 Ga0075365_10064137 Ga0075365_100641372 208
127 3300006042 Ga0075368_10100720 Ga0075368_101007202 208
128 3300006048 Ga0075363_100038937 Ga0075363_1000389372 208
129 3300006051 Ga0075364_10049857 Ga0075364_100498572 208
130 3300006051 Ga0075364_10158061 Ga0075364_101580612 208
131 3300006177 Ga0075362_10114123 Ga0075362_101141232 208
132 3300006178 Ga0075367_10000137 Ga0075367_1000013712 208
133 3300006178 Ga0075367_10003218 Ga0075367_100032187 208
134 3300006195 Ga0075366_10004118 Ga0075366_100041183 208
135 3300006195 Ga0075366_10239065 Ga0075366_102390652 208
136 3300006358 Ga0068871_100114724 Ga0068871_1001147243 208
137 3300006844 Ga0075428_100003374 Ga0075428_1000033748 208
138 3300006844 Ga0075428_100080849 Ga0075428_1000808493 208
139 3300006844 Ga0075428_100231996 Ga0075428_1002319961 208
140 3300006844 Ga0075428_100337015 Ga0075428_1003370152 208
141 3300006847 Ga0075431_100008511 Ga0075431_1000085118 208
142 3300006847 Ga0075431_100093396 Ga0075431_1000933962 208
143 3300006880 Ga0075429_100055806 Ga0075429_1000558063 208
144 3300006880 Ga0075429_100419178 Ga0075429_1004191781 208
145 3300006881 Ga0068865_100086398 Ga0068865_1000863982 208
146 3300006931 Ga0097620_100097088 Ga0097620_1000970883 208
147 3300007076 Ga0075435_100007062 Ga0075435_1000070622 208
148 3300009094 Ga0111539_10002695 Ga0111539_100026953 208
149 3300009098 Ga0105245_10076293 Ga0105245_100762933 208
150 3300009147 Ga0114129_10729837 Ga0114129_107298372 208
151 3300009176 Ga0105242_10714096 Ga0105242_107140961 208
152 3300009177 Ga0105248_10008725 Ga0105248_100087255 208
153 3300009177 Ga0105248_10028123 Ga0105248_100281233 208
154 3300009551 Ga0105238_10296710 Ga0105238_102967102 208
155 3300009551 Ga0105238_10506208 Ga0105238_105062082 208
156 3300009553 Ga0105249_11367904 Ga0105249_113679041 208
157 3300013100 Ga0157373_10535421 Ga0157373_105354211 208
158 3300013297 Ga0157378_10267570 Ga0157378_102675702 208
159 3300013306 Ga0163162_10309505 Ga0163162_103095052 208
160 3300013308 Ga0157375_10051763 Ga0157375_100517632 208
161 3300014325 Ga0163163_10593667 Ga0163163_105936671 208
162 3300020075 Ga0206349_1073246 Ga0206349_10732463 208
163 3300020078 Ga0206352_10868500 Ga0206352_108685002 208
164 3300022467 Ga0224712_10096998 Ga0224712_100969982 208
165 3300025908 Ga0207643_10095194 Ga0207643_100951942 208
166 3300025915 Ga0207693_10329424 Ga0207693_103294241 208
167 3300025918 Ga0207662_10000306 Ga0207662_1000030613 208
168 3300025920 Ga0207649_10106286 Ga0207649_101062862 208
169 3300025920 Ga0207649_10646527 Ga0207649_106465271 208
170 3300025923 Ga0207681_10566700 Ga0207681_105667002 208
171 3300025925 Ga0207650_10185188 Ga0207650_101851882 208
172 3300025927 Ga0207687_10401876 Ga0207687_104018762 208
173 3300025933 Ga0207706_10053223 Ga0207706_100532232 208
174 3300025933 Ga0207706_10200881 Ga0207706_102008811 208
175 3300025937 Ga0207669_10193494 Ga0207669_101934942 208
176 3300025939 Ga0207665_10150591 Ga0207665_101505911 208
177 3300025940 Ga0207691_10004713 Ga0207691_100047139 208
178 3300025941 Ga0207711_10123866 Ga0207711_101238662 208
179 3300025942 Ga0207689_10076908 Ga0207689_100769082 208
180 3300025972 Ga0207668_10195588 Ga0207668_101955882 208
181 3300026023 Ga0207677_10208614 Ga0207677_102086142 208
182 3300026023 Ga0207677_10648747 Ga0207677_106487471 208
183 3300026035 Ga0207703_10029835 Ga0207703_100298353 208
184 3300026067 Ga0207678_10006195 Ga0207678_100061957 208
185 3300026075 Ga0207708_10910159 Ga0207708_109101592 208
186 3300026089 Ga0207648_10006745 Ga0207648_100067453 208
187 3300026116 Ga0207674_10389993 Ga0207674_103899932 208
188 3300026118 Ga0207675_100067066 Ga0207675_1000670662 208
189 3300026142 Ga0207698_10157568 Ga0207698_101575682 208
190 3300027876 Ga0209974_10175700 Ga0209974_101757001 208
191 3300027907 Ga0207428_10000343 Ga0207428_1000034334 208
192 3300028380 Ga0268265_10110453 Ga0268265_101104532 208
193 3300028381 Ga0268264_10467094 Ga0268264_104670942 208
194 3300028573 Ga0265334_10004066 Ga0265334_100040664 208
195 3300031250 Ga0265331_10026265 Ga0265331_100262652 208
196 3300035111 Ga0373923_0055896 Ga0373923_0055896_650_1282 208
197 3300035113 Ga0373936_0045619 Ga0373936_0045619_935_1567 208
198 3300035170 Ga0373943_0003901 Ga0373943_0003901_5118_5825 208
199 3300035725 Ga0373947_0379694 Ga0373947_0379694_308_940 208
200 3300036401 Ga0373937_1167628 Ga0373937_1167628_20_652 208
201 3300044658 Ga0466972_0114807 Ga0466972_0114807_463_1092 208
202 3300047320 Ga0495672_0000494 Ga0495672_0000494_3813_4454 208
203 3300048904 Ga0496101_0092877 Ga0496101_0092877_1298_1942 208
204 3300048925 Ga0496122_0000430 Ga0496122_0000430_6381_7010 208
205 3300048925 Ga0496122_0046810 Ga0496122_0046810_57_698 208
206 3300048926 Ga0496123_0000634 Ga0496123_0000634_30878_31507 208
207 3300048927 Ga0496124_0001172 Ga0496124_0001172_36707_37336 208
208 3300048928 Ga0496125_0007370 Ga0496125_0007370_10950_11579 208
209 3300048929 Ga0496126_0067009 Ga0496126_0067009_405_1037 208
210 3300049569 Ga0501032_0008693 Ga0501032_0008693_4665_5291 208
211 3300049569 Ga0501032_0095859 Ga0501032_0095859_275_901 208
212 3300049570 Ga0501033_0565044 Ga0501033_0565044_135_773 208
213 3300049572 Ga0501036_0493443 Ga0501036_0493443_269_895 208
214 3300049580 Ga0501046_0389634 Ga0501046_0389634_20_667 208
215 3300049583 Ga0501067_0178621 Ga0501067_0178621_367_1005 208
216 3300049584 Ga0501068_0009378 Ga0501068_0009378_1812_2438 208
217 3300049587 Ga0501071_0121889 Ga0501071_0121889_420_1046 208
218 3300049587 Ga0501071_0161434 Ga0501071_0161434_331_1020 208
219 3300049588 Ga0501072_0618516 Ga0501072_0618516_71_748 208
220 3300049589 Ga0501073_0002695 Ga0501073_0002695_463_1089 208
221 3300049589 Ga0501073_0528674 Ga0501073_0528674_82_708 208
222 3300049590 Ga0501074_0109627 Ga0501074_0109627_161_787 208
223 3300049591 Ga0501075_0061457 Ga0501075_0061457_2073_2762 208
224 3300049592 Ga0501076_0013318 Ga0501076_0013318_4221_4910 208
225 3300049592 Ga0501076_0023558 Ga0501076_0023558_307_981 208
226 3300049592 Ga0501076_0070486 Ga0501076_0070486_575_1252 208
227 3300049741 Ga0501079_0546812 Ga0501079_0546812_185_811 208
228 3300049742 Ga0501080_0039068 Ga0501080_0039068_791_1417 208
229 3300049743 Ga0501081_0176454 Ga0501081_0176454_733_1380 208
230 3300049744 Ga0501083_0044202 Ga0501083_0044202_2041_2667 208
231 3300049744 Ga0501083_0147619 Ga0501083_0147619_716_1393 208
232 3300049822 Ga0501035_0329686 Ga0501035_0329686_498_1187 208
233 3300049824 Ga0501045_0221145 Ga0501045_0221145_492_1151 208
234 3300050489 nmdc:mga03683_4979_c1 nmdc:mga03683_4979_c1_1287_1931 208
235 3300050490 nmdc:mga03n38_240457_c1 nmdc:mga03n38_240457_c1_138_770 208
236 3300050491 nmdc:mga00v17_288578_c1 nmdc:mga00v17_288578_c1_285_917 208
237 3300050491 nmdc:mga00v17_6528_c1 nmdc:mga00v17_6528_c1_1033_1677 208
238 3300050492 nmdc:mga0yw44_52719_c1 nmdc:mga0yw44_52719_c1_1371_2015 208
239 3300050492 nmdc:mga0yw44_5607_c1 nmdc:mga0yw44_5607_c1_3271_3915 208
240 3300050493 nmdc:mga0k408_2231_c1 nmdc:mga0k408_2231_c1_7536_8180 208
241 3300050494 nmdc:mga06z11_2252_c1 nmdc:mga06z11_2252_c1_5664_6308 208
242 3300050495 nmdc:mga04h51_49742_c1 nmdc:mga04h51_49742_c1_622_1266 208
243 3300050496 nmdc:mga07m45_159181_c1 nmdc:mga07m45_159181_c1_155_787 208
244 3300050496 nmdc:mga07m45_246028_c1 nmdc:mga07m45_246028_c1_69_713 208
245 3300050508 nmdc:mga09592_58545_c1 nmdc:mga09592_58545_c1_1071_1715 208
246 3300050509 nmdc:mga0qj67_24522_c1 nmdc:mga0qj67_24522_c1_3894_4574 208
247 3300050510 nmdc:mga06r32_4111_c1 nmdc:mga06r32_4111_c1_4513_5157 208
248 3300050510 nmdc:mga06r32_419230_c1 nmdc:mga06r32_419230_c1_361_1005 208
249 3300050511 nmdc:mga08y16_5129_c1 nmdc:mga08y16_5129_c1_1363_2007 208
250 3300050512 nmdc:mga0n895_120875_c1 nmdc:mga0n895_120875_c1_645_1289 208
251 3300050513 nmdc:mga0rr50_941594_c1 nmdc:mga0rr50_941594_c1_96_725 208
252 3300050515 nmdc:mga0a205_219291_c1 nmdc:mga0a205_219291_c1_371_1015 208
253 3300054114 Ga0501084_0152504 Ga0501084_0152504_313_990 208
254 3300054114 Ga0501084_0561040 Ga0501084_0561040_192_881 208
255 3300054114 Ga0501084_0814911 Ga0501084_0814911_97_723 208
256 3300059504 Ga0587082_058621 Ga0587082_058621_40_666 208
257 3300060353 Ga0501082_0170087 Ga0501082_0170087_134_760 208
258 3300060353 Ga0501082_0716903 Ga0501082_0716903_185_862 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

129

231

0.97

PF00081

Sod_Fe_N

Iron/manganese superoxide dismutases, alpha-hairpin domain

37

122

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gn2-assembly1.cif.gz_A s123c mutant of the iron-superoxide dismutase from mycobacterium tuberculosis. 0.9684 2 197
1gn4-assembly1.cif.gz_D h145e mutant of mycobacterium tuberculosis iron-superoxide dismutase. 0.9683 2 197
1ids-assembly1.cif.gz_C x-ray structure analysis of the iron-dependent superoxide dismutase from mycobacterium tuberculosis at 2.0 angstroms resolutions reveals novel dimer-dimer interactions 0.9682 2 197
1gn6-assembly1.cif.gz_A g152a mutant of mycobacterium tuberculosis iron-superoxide dismutase. 0.9679 2 197
1gn3-assembly1.cif.gz_A h145q mutant of mycobacterium tuberculosis iron-superoxide dismutase. 0.9664 2 197
ID Description Score Start End Superfamily
1ar4B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9939 21 84 1.10.287.990
1ar4A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9932 21 84 1.10.287.990
1ar5B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9931 21 84 1.10.287.990
1avmB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9922 21 84 1.10.287.990
1idsC01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9918 21 84 1.10.287.990
ID Description Score Start End GO Terms
AF-A0A0K2RT14-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9946 1 128 GO:0004784
GO:0046872
AF-A0A1I7SXX9-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9916 1 122 GO:0004784
GO:0046872
AF-A0A1I2QXU2-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9899 2 115 GO:0004784
GO:0046872
AF-A0A2V6SUL7-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9885 1 139 GO:0004784
GO:0046872
AF-A0A6N7ZP99-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9871 7 123 GO:0004784
GO:0046872

Feature Viewer

pLDDT pTM Quality
90.49 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map