F368244

General Info

Members Datasets Scaffolds Average Seq Length
258 185 516 297

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0416519|Ga0436364_0416519_83675_84658
Length 327
Sequence MGRRDHLRPVGQRGILGQPIKREEILKMATVIERARVMVRPSGKALAADIEGVDLAGPLASETTAAIRQAWSDHLVLRFRGQNLSDDDLMRVSRELGDLDWAPIAAAKIKVPDEDRYIDGTPEGRQYVMVISNVVENGVAIGQLGAYEAIWHTDMSYIAEPPMASVLYSLEVPASGGDTGFCNMYLALETLPAELRRQIEGRACRHDASRNSAGELRRGFVDAPDASQTVGAEHPIVRTHPETRRKALFLGRRRNAYIPGLPLAESEALLDALWAHATKPEFTWYQQWKLGDLILWDNRCVMHRRDAFDPNARRVMHRTQIKGDRPY

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
183 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.02
Nodule 0
Rhizoplane 0
Rhizosphere 84.5
Stem 0
Stem Tuber 0
Unclassified 6.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0416519 3300037853 Bacteria 115750
2 Ga0070676_10000037 3300005328 Bacteria 39444
3 Ga0070690_100147345 3300005330 Bacteria 1603
4 Ga0068869_100172021 3300005334 Bacteria 1692
5 Ga0070680_100041633 3300005336 Bacteria 3724
6 Ga0070680_100045406 3300005336 Bacteria 3572
7 Ga0070689_100081874 3300005340 Bacteria 2534
8 Ga0070691_10003281 3300005341 Bacteria 7256
9 Ga0070691_10025969 3300005341 Bacteria 2729
10 Ga0070692_10023559 3300005345 Unclassified 3017
11 Ga0070668_100296320 3300005347 Bacteria 1355
12 Ga0070668_100318885 3300005347 Bacteria 1308
13 Ga0070669_100075728 3300005353 Bacteria 2496
14 Ga0070675_100099040 3300005354 Unclassified 2453
15 Ga0070671_100230526 3300005355 Unclassified 1571
16 Ga0070673_100465295 3300005364 Bacteria 1139
17 Ga0070709_10015806 3300005434 Bacteria 4297
18 Ga0070713_100197688 3300005436 Bacteria 1814
19 Ga0070701_10151263 3300005438 Unclassified 1337
20 Ga0070705_100016227 3300005440 Unclassified 3868
21 Ga0070705_100353700 3300005440 Bacteria 1072
22 Ga0070694_100079657 3300005444 Unclassified 2274
23 Ga0070694_100256281 3300005444 Bacteria 1325
24 Ga0070694_100379821 3300005444 Bacteria 1102
25 Ga0070678_100196051 3300005456 Bacteria 1664
26 Ga0070681_10057799 3300005458 Bacteria 3859
27 Ga0070706_100038894 3300005467 Bacteria 4390
28 Ga0070707_100010317 3300005468 Bacteria 8697
29 Ga0070707_100084094 3300005468 Unclassified 3075
30 Ga0070698_100000587 3300005471 Bacteria 39046
31 Ga0070698_100040996 3300005471 Bacteria 4755
32 Ga0070698_100155188 3300005471 Bacteria 2235
33 Ga0070699_100015567 3300005518 Bacteria 6534
34 Ga0070679_100155237 3300005530 Bacteria 2264
35 Ga0070679_100234032 3300005530 Bacteria 1796
36 Ga0070684_100052966 3300005535 Bacteria 3530
37 Ga0070684_100195242 3300005535 Bacteria 1843
38 Ga0070697_100095699 3300005536 Bacteria 2463
39 Ga0068853_100269896 3300005539 Unclassified 1566
40 Ga0068853_100360789 3300005539 Bacteria 1354
41 Ga0070672_100124906 3300005543 Bacteria 2110
42 Ga0070686_100205410 3300005544 Bacteria 1415
43 Ga0070695_100049213 3300005545 Bacteria 2698
44 Ga0070696_100284984 3300005546 Unclassified 1261
45 Ga0070693_100026209 3300005547 Bacteria 3146
46 Ga0070665_100004342 3300005548 Bacteria 14911
47 Ga0068855_100049658 3300005563 Bacteria 4947
48 Ga0070664_100036858 3300005564 Bacteria 4109
49 Ga0068857_100107168 3300005577 Bacteria 2510
50 Ga0068861_100046992 3300005719 Bacteria 3257
51 Ga0068863_100369709 3300005841 Bacteria 1399
52 Ga0068858_100182135 3300005842 Bacteria 1984
53 Ga0068860_100384501 3300005843 Bacteria 1386
54 Ga0081455_10002011 3300005937 Bacteria 24306
55 Ga0081455_10008680 3300005937 Bacteria 10527
56 Ga0081455_10020722 3300005937 Bacteria 6183
57 Ga0081538_10011032 3300005981 Bacteria 7349
58 Ga0081539_10000987 3300005985 Bacteria 52947
59 Ga0070717_10010538 3300006028 Bacteria 6984
60 Ga0075365_10018056 3300006038 Bacteria 4330
61 Ga0075365_10023396 3300006038 Bacteria 3885
62 Ga0070712_100079222 3300006175 Bacteria 2374
63 Ga0075362_10001891 3300006177 Bacteria 6870
64 Ga0075362_10019329 3300006177 Bacteria 2831
65 Ga0075362_10051884 3300006177 Bacteria 1837
66 Ga0075367_10000816 3300006178 Bacteria 12304
67 Ga0075367_10078260 3300006178 Bacteria 1997
68 Ga0075367_10078279 3300006178 Bacteria 1996
69 Ga0075369_10025639 3300006186 Bacteria 2453
70 Ga0075369_10058277 3300006186 Bacteria 1681
71 Ga0075369_10066564 3300006186 Bacteria 1580
72 Ga0075366_10016729 3300006195 Bacteria 4217
73 Ga0075366_10054698 3300006195 Bacteria 2371
74 Ga0097621_100453326 3300006237 Bacteria 1156
75 Ga0075370_10024979 3300006353 Bacteria 3303
76 Ga0075428_100008998 3300006844 Bacteria 11077
77 Ga0075430_100096993 3300006846 Bacteria 2464
78 Ga0075431_100007203 3300006847 Bacteria 11065
79 Ga0075431_100029524 3300006847 Bacteria 5645
80 Ga0075433_10056840 3300006852 Bacteria 3419
81 Ga0075434_100021759 3300006871 Bacteria 6237
82 Ga0075429_100038439 3300006880 Bacteria 4166
83 Ga0075436_100208651 3300006914 Bacteria 1385
84 Ga0105240_10012631 3300009093 Bacteria 11644
85 Ga0105240_10027768 3300009093 Bacteria 7406
86 Ga0111539_10010131 3300009094 Bacteria 11877
87 Ga0111539_10055558 3300009094 Bacteria 4707
88 Ga0111539_10075708 3300009094 Bacteria 3964
89 Ga0111539_10549235 3300009094 Bacteria 1346
90 Ga0105245_10118561 3300009098 Bacteria 2470
91 Ga0114129_10090383 3300009147 Bacteria 4245
92 Ga0105243_10023456 3300009148 Bacteria 4699
93 Ga0105243_10151152 3300009148 Bacteria 1992
94 Ga0105243_10159963 3300009148 Bacteria 1941
95 Ga0105241_10059385 3300009174 Bacteria 2940
96 Ga0105242_10152687 3300009176 Unclassified 2015
97 Ga0105248_11047782 3300009177 Bacteria 922
98 Ga0105237_10029301 3300009545 Bacteria 5597
99 Ga0105237_10316751 3300009545 Bacteria 1563
100 Ga0105249_10286660 3300009553 Bacteria 1647
101 Ga0105239_10164814 3300010375 Bacteria 2478
102 Ga0105239_10458824 3300010375 Bacteria 1446
103 Ga0105246_10405163 3300011119 Bacteria 1134
104 Ga0157373_10061152 3300013100 Bacteria 2668
105 Ga0157370_10135158 3300013104 Bacteria 2299
106 Ga0157369_10079126 3300013105 Bacteria 3521
107 Ga0157374_10106458 3300013296 Bacteria 2694
108 Ga0157378_10279560 3300013297 Bacteria 1608
109 Ga0163162_10097638 3300013306 Bacteria 3026
110 Ga0157375_10472574 3300013308 Bacteria 1419
111 Ga0182008_10048639 3300014497 Bacteria 2106
112 Ga0213876_10006402 3300021384 Bacteria 6418
113 Ga0213875_10007443 3300021388 Bacteria 5654
114 Ga0213875_10052404 3300021388 Bacteria 1911
115 Ga0213871_10004891 3300021441 Bacteria 2720
116 Ga0207426_1028548 3300025302 Bacteria 1848
117 Ga0207647_10179304 3300025904 Bacteria 1231
118 Ga0207645_10140694 3300025907 Bacteria 1572
119 Ga0207705_10010305 3300025909 Bacteria 6798
120 Ga0207684_10021975 3300025910 Bacteria 5448
121 Ga0207654_10030896 3300025911 Bacteria 2945
122 Ga0207707_10193098 3300025912 Bacteria 1776
123 Ga0207707_10196314 3300025912 Bacteria 1760
124 Ga0207695_10015634 3300025913 Bacteria 8926
125 Ga0207695_10230154 3300025913 Bacteria 1758
126 Ga0207671_10079344 3300025914 Bacteria 2459
127 Ga0207671_10253589 3300025914 Bacteria 1383
128 Ga0207693_10095364 3300025915 Bacteria 2332
129 Ga0207660_10037183 3300025917 Bacteria 3391
130 Ga0207660_10104698 3300025917 Bacteria 2119
131 Ga0207660_10313956 3300025917 Unclassified 1250
132 Ga0207662_10179471 3300025918 Bacteria 1362
133 Ga0207652_10159315 3300025921 Bacteria 2023
134 Ga0207646_10005497 3300025922 Bacteria 13321
135 Ga0207659_10058362 3300025926 Unclassified 2770
136 Ga0207644_10109531 3300025931 Bacteria 2087
137 Ga0207644_10138956 3300025931 Bacteria 1869
138 Ga0207644_10167847 3300025931 Unclassified 1711
139 Ga0207686_10226653 3300025934 Bacteria 1352
140 Ga0207686_10251704 3300025934 Bacteria 1291
141 Ga0207709_10013594 3300025935 Bacteria 4491
142 Ga0207670_10121266 3300025936 Bacteria 1901
143 Ga0207670_10138578 3300025936 Bacteria 1792
144 Ga0207669_10163018 3300025937 Bacteria 1577
145 Ga0207691_10008541 3300025940 Bacteria 9833
146 Ga0207689_10373623 3300025942 Unclassified 1187
147 Ga0207661_10328779 3300025944 Bacteria 1375
148 Ga0207679_10272009 3300025945 Bacteria 1449
149 Ga0207667_10628880 3300025949 Bacteria 1080
150 Ga0207651_10234922 3300025960 Bacteria 1491
151 Ga0207677_10247642 3300026023 Bacteria 1445
152 Ga0207703_10236631 3300026035 Bacteria 1640
153 Ga0207703_10513684 3300026035 Bacteria 1126
154 Ga0207639_10225933 3300026041 Bacteria 1620
155 Ga0207708_10123396 3300026075 Bacteria 2020
156 Ga0207674_10120066 3300026116 Bacteria 2597
157 Ga0207698_10152647 3300026142 Bacteria 2007
158 Ga0209971_1054065 3300027682 Bacteria 970
159 Ga0209974_10007496 3300027876 Bacteria 3757
160 Ga0207428_10001927 3300027907 Bacteria 21011
161 Ga0268265_10344608 3300028380 Bacteria 1358
162 Ga0265332_10036053 3300031238 Bacteria 2148
163 Ga0307411_10546668 3300032005 Bacteria 987
164 Ga0307510_10064844 3300033180 Bacteria 3706
165 Ga0373948_0028295 3300034817 Bacteria 1115
166 Ga0373941_0044001 3300035115 Bacteria 1392
167 Ga0373953_0003752 3300035117 Bacteria 4775
168 Ga0373957_0055189 3300035120 Bacteria 1527
169 Ga0373943_0210836 3300035170 Bacteria 1079
170 Ga0373924_0034628 3300035410 Bacteria 2045
171 Ga0373931_0055190 3300035691 Bacteria 2125
172 Ga0373933_0008857 3300035724 Bacteria 5487
173 Ga0373933_0048979 3300035724 Bacteria 2518
174 Ga0373937_0002602 3300036401 Bacteria 15024
175 Ga0373937_0240188 3300036401 Bacteria 1707
176 Ga0373925_0264535 3300037068 Bacteria 1382
177 Ga0395899_0001978 3300037312 Bacteria 16855
178 Ga0395900_0044617 3300037418 Bacteria 4567
179 Ga0395900_0395427 3300037418 Bacteria 1347
180 Ga0395900_0416198 3300037418 Bacteria 1305
181 Ga0395898_0034987 3300037466 Bacteria 4999
182 Ga0436364_0287070 3300037853 Bacteria 4995
183 Ga0395901_0001952 3300038443 Bacteria 21231
184 Ga0395901_0010514 3300038443 Bacteria 9372
185 Ga0395901_0021996 3300038443 Bacteria 6536
186 Ga0395901_0175388 3300038443 Bacteria 2248
187 Ga0436365_1798893 3300039437 Unclassified 1540
188 Ga0436360_0326163 3300039438 Bacteria 2433
189 Ga0436360_0393926 3300039438 Bacteria 1335
190 Ga0436360_0484814 3300039438 Bacteria 2390
191 Ga0436361_0392287 3300039447 Bacteria 6754
192 Ga0436363_0851919 3300039450 Bacteria 2374
193 Ga0436363_1450707 3300039450 Bacteria 2672
194 Ga0436362_0068775 3300039453 Bacteria 1140
195 Ga0466963_0054664 3300044694 Bacteria 2654
196 Ga0466957_0016491 3300044842 Bacteria 4322
197 Ga0495592_0067912 3300046454 Bacteria 2604
198 Ga0495584_0074034 3300046491 Bacteria 1712
199 Ga0495667_0082872 3300046559 Bacteria 2083
200 Ga0495656_0017329 3300046615 Bacteria 2748
201 Ga0495656_0205964 3300046615 Bacteria 978
202 Ga0495669_0042362 3300046684 Bacteria 2024
203 Ga0495669_0069740 3300046684 Bacteria 1600
204 Ga0495680_0038502 3300047322 Bacteria 3821
205 Ga0501034_0001685 3300049571 Bacteria 28484
206 Ga0501034_0039623 3300049571 Bacteria 4772
207 Ga0501034_0380101 3300049571 Bacteria 1337
208 Ga0501036_0262330 3300049572 Bacteria 1447
209 Ga0501038_0060238 3300049574 Bacteria 3249
210 Ga0501039_0267246 3300049575 Bacteria 1344
211 Ga0501040_0051152 3300049576 Bacteria 2827
212 Ga0501040_0073374 3300049576 Bacteria 2364
213 Ga0501042_0118844 3300049578 Bacteria 1903
214 Ga0501043_0017804 3300049579 Bacteria 5569
215 Ga0501046_0118840 3300049580 Bacteria 2013
216 Ga0501047_0120114 3300049581 Bacteria 2510
217 Ga0501072_0233219 3300049588 Bacteria 1466
218 Ga0501075_0025256 3300049591 Bacteria 4365
219 Ga0501077_0015125 3300049593 Bacteria 4852
220 Ga0501079_0088593 3300049741 Bacteria 2396
221 Ga0501079_0184368 3300049741 Bacteria 1629
222 Ga0501081_0054368 3300049743 Bacteria 2766
223 Ga0501081_0122756 3300049743 Bacteria 1851
224 Ga0501035_0119385 3300049822 Unclassified 2306
225 Ga0501044_0013328 3300049823 Bacteria 8898
226 Ga0501044_0154664 3300049823 Bacteria 2273
227 Ga0501044_0230446 3300049823 Bacteria 1800
228 Ga0501045_0055173 3300049824 Bacteria 2906
229 nmdc:mga03683_18689_c1 3300050489 Bacteria 2637
230 nmdc:mga03683_9871_c1 3300050489 Bacteria 3409
231 nmdc:mga0yw44_161570_c1 3300050492 Bacteria 1467
232 nmdc:mga0yw44_227260_c1 3300050492 Bacteria 1238
233 nmdc:mga0k408_74058_c1 3300050493 Bacteria 1989
234 nmdc:mga0k408_8651_c1 3300050493 Bacteria 5472
235 nmdc:mga06z11_333466_c1 3300050494 Bacteria 906
236 nmdc:mga06z11_37919_c1 3300050494 Bacteria 2390
237 nmdc:mga06z11_99756_c1 3300050494 Bacteria 1591
238 nmdc:mga07m45_39028_c2 3300050496 Bacteria 1551
239 nmdc:mga07m45_44936_c1 3300050496 Bacteria 1302
240 nmdc:mga09592_62310_c1 3300050508 Bacteria 3155
241 nmdc:mga0qj67_89784_c1 3300050509 Bacteria 2468
242 nmdc:mga06r32_2111_c1 3300050510 Bacteria 17801
243 nmdc:mga06r32_95993_c1 3300050510 Bacteria 2902
244 nmdc:mga08y16_240307_c1 3300050511 Bacteria 1872
245 nmdc:mga08y16_25223_c1 3300050511 Bacteria 6269
246 nmdc:mga08y16_289670_c1 3300050511 Bacteria 1688
247 nmdc:mga08y16_97548_c1 3300050511 Bacteria 3061
248 nmdc:mga08x19_172764_c1 3300050514 Bacteria 1472
249 nmdc:mga0a205_17557_c1 3300050515 Bacteria 6713
250 nmdc:mga0sz30_43067_c1 3300050516 Bacteria 1900
251 Ga0495601_0012439 3300053077 Bacteria 5106
252 Ga0500641_0001585 3300053096 Bacteria 8103
253 Ga0500616_0001986 3300053153 Bacteria 18171
254 Ga0500622_0005812 3300053156 Bacteria 7311
255 Ga0500552_001661 3300053733 Bacteria 2125
256 Ga0501084_0001066 3300054114 Bacteria 21315
257 Ga0501084_0296281 3300054114 Bacteria 1366
258 Ga0501082_0326551 3300060353 Bacteria 1337
259 Ga0436364_0416519
260 Ga0070676_10000037
261 Ga0070690_100147345
262 Ga0068869_100172021
263 Ga0070680_100041633
264 Ga0070680_100045406
265 Ga0070689_100081874
266 Ga0070691_10003281
267 Ga0070691_10025969
268 Ga0070692_10023559
269 Ga0070668_100296320
270 Ga0070668_100318885
271 Ga0070669_100075728
272 Ga0070675_100099040
273 Ga0070671_100230526
274 Ga0070673_100465295
275 Ga0070709_10015806
276 Ga0070713_100197688
277 Ga0070701_10151263
278 Ga0070705_100016227
279 Ga0070705_100353700
280 Ga0070694_100079657
281 Ga0070694_100256281
282 Ga0070694_100379821
283 Ga0070678_100196051
284 Ga0070681_10057799
285 Ga0070706_100038894
286 Ga0070707_100010317
287 Ga0070707_100084094
288 Ga0070698_100000587
289 Ga0070698_100040996
290 Ga0070698_100155188
291 Ga0070699_100015567
292 Ga0070679_100155237
293 Ga0070679_100234032
294 Ga0070684_100052966
295 Ga0070684_100195242
296 Ga0070697_100095699
297 Ga0068853_100269896
298 Ga0068853_100360789
299 Ga0070672_100124906
300 Ga0070686_100205410
301 Ga0070695_100049213
302 Ga0070696_100284984
303 Ga0070693_100026209
304 Ga0070665_100004342
305 Ga0068855_100049658
306 Ga0070664_100036858
307 Ga0068857_100107168
308 Ga0068861_100046992
309 Ga0068863_100369709
310 Ga0068858_100182135
311 Ga0068860_100384501
312 Ga0081455_10002011
313 Ga0081455_10008680
314 Ga0081455_10020722
315 Ga0081538_10011032
316 Ga0081539_10000987
317 Ga0070717_10010538
318 Ga0075365_10018056
319 Ga0075365_10023396
320 Ga0070712_100079222
321 Ga0075362_10001891
322 Ga0075362_10019329
323 Ga0075362_10051884
324 Ga0075367_10000816
325 Ga0075367_10078260
326 Ga0075367_10078279
327 Ga0075369_10025639
328 Ga0075369_10058277
329 Ga0075369_10066564
330 Ga0075366_10016729
331 Ga0075366_10054698
332 Ga0097621_100453326
333 Ga0075370_10024979
334 Ga0075428_100008998
335 Ga0075430_100096993
336 Ga0075431_100007203
337 Ga0075431_100029524
338 Ga0075433_10056840
339 Ga0075434_100021759
340 Ga0075429_100038439
341 Ga0075436_100208651
342 Ga0105240_10012631
343 Ga0105240_10027768
344 Ga0111539_10010131
345 Ga0111539_10055558
346 Ga0111539_10075708
347 Ga0111539_10549235
348 Ga0105245_10118561
349 Ga0114129_10090383
350 Ga0105243_10023456
351 Ga0105243_10151152
352 Ga0105243_10159963
353 Ga0105241_10059385
354 Ga0105242_10152687
355 Ga0105248_11047782
356 Ga0105237_10029301
357 Ga0105237_10316751
358 Ga0105249_10286660
359 Ga0105239_10164814
360 Ga0105239_10458824
361 Ga0105246_10405163
362 Ga0157373_10061152
363 Ga0157370_10135158
364 Ga0157369_10079126
365 Ga0157374_10106458
366 Ga0157378_10279560
367 Ga0163162_10097638
368 Ga0157375_10472574
369 Ga0182008_10048639
370 Ga0213876_10006402
371 Ga0213875_10007443
372 Ga0213875_10052404
373 Ga0213871_10004891
374 Ga0207426_1028548
375 Ga0207647_10179304
376 Ga0207645_10140694
377 Ga0207705_10010305
378 Ga0207684_10021975
379 Ga0207654_10030896
380 Ga0207707_10193098
381 Ga0207707_10196314
382 Ga0207695_10015634
383 Ga0207695_10230154
384 Ga0207671_10079344
385 Ga0207671_10253589
386 Ga0207693_10095364
387 Ga0207660_10037183
388 Ga0207660_10104698
389 Ga0207660_10313956
390 Ga0207662_10179471
391 Ga0207652_10159315
392 Ga0207646_10005497
393 Ga0207659_10058362
394 Ga0207644_10109531
395 Ga0207644_10138956
396 Ga0207644_10167847
397 Ga0207686_10226653
398 Ga0207686_10251704
399 Ga0207709_10013594
400 Ga0207670_10121266
401 Ga0207670_10138578
402 Ga0207669_10163018
403 Ga0207691_10008541
404 Ga0207689_10373623
405 Ga0207661_10328779
406 Ga0207679_10272009
407 Ga0207667_10628880
408 Ga0207651_10234922
409 Ga0207677_10247642
410 Ga0207703_10236631
411 Ga0207703_10513684
412 Ga0207639_10225933
413 Ga0207708_10123396
414 Ga0207674_10120066
415 Ga0207698_10152647
416 Ga0209971_1054065
417 Ga0209974_10007496
418 Ga0207428_10001927
419 Ga0268265_10344608
420 Ga0265332_10036053
421 Ga0307411_10546668
422 Ga0307510_10064844
423 Ga0373948_0028295
424 Ga0373941_0044001
425 Ga0373953_0003752
426 Ga0373957_0055189
427 Ga0373943_0210836
428 Ga0373924_0034628
429 Ga0373931_0055190
430 Ga0373933_0008857
431 Ga0373933_0048979
432 Ga0373937_0002602
433 Ga0373937_0240188
434 Ga0373925_0264535
435 Ga0395899_0001978
436 Ga0395900_0044617
437 Ga0395900_0395427
438 Ga0395900_0416198
439 Ga0395898_0034987
440 Ga0436364_0287070
441 Ga0395901_0001952
442 Ga0395901_0010514
443 Ga0395901_0021996
444 Ga0395901_0175388
445 Ga0436365_1798893
446 Ga0436360_0326163
447 Ga0436360_0393926
448 Ga0436360_0484814
449 Ga0436361_0392287
450 Ga0436363_0851919
451 Ga0436363_1450707
452 Ga0436362_0068775
453 Ga0466963_0054664
454 Ga0466957_0016491
455 Ga0495592_0067912
456 Ga0495584_0074034
457 Ga0495667_0082872
458 Ga0495656_0017329
459 Ga0495656_0205964
460 Ga0495669_0042362
461 Ga0495669_0069740
462 Ga0495680_0038502
463 Ga0501034_0001685
464 Ga0501034_0039623
465 Ga0501034_0380101
466 Ga0501036_0262330
467 Ga0501038_0060238
468 Ga0501039_0267246
469 Ga0501040_0051152
470 Ga0501040_0073374
471 Ga0501042_0118844
472 Ga0501043_0017804
473 Ga0501046_0118840
474 Ga0501047_0120114
475 Ga0501072_0233219
476 Ga0501075_0025256
477 Ga0501077_0015125
478 Ga0501079_0088593
479 Ga0501079_0184368
480 Ga0501081_0054368
481 Ga0501081_0122756
482 Ga0501035_0119385
483 Ga0501044_0013328
484 Ga0501044_0154664
485 Ga0501044_0230446
486 Ga0501045_0055173
487 nmdc:mga03683_18689_c1
488 nmdc:mga03683_9871_c1
489 nmdc:mga0yw44_161570_c1
490 nmdc:mga0yw44_227260_c1
491 nmdc:mga0k408_74058_c1
492 nmdc:mga0k408_8651_c1
493 nmdc:mga06z11_333466_c1
494 nmdc:mga06z11_37919_c1
495 nmdc:mga06z11_99756_c1
496 nmdc:mga07m45_39028_c2
497 nmdc:mga07m45_44936_c1
498 nmdc:mga09592_62310_c1
499 nmdc:mga0qj67_89784_c1
500 nmdc:mga06r32_2111_c1
501 nmdc:mga06r32_95993_c1
502 nmdc:mga08y16_240307_c1
503 nmdc:mga08y16_25223_c1
504 nmdc:mga08y16_289670_c1
505 nmdc:mga08y16_97548_c1
506 nmdc:mga08x19_172764_c1
507 nmdc:mga0a205_17557_c1
508 nmdc:mga0sz30_43067_c1
509 Ga0495601_0012439
510 Ga0500641_0001585
511 Ga0500616_0001986
512 Ga0500622_0005812
513 Ga0500552_001661
514 Ga0501084_0001066
515 Ga0501084_0296281
516 Ga0501082_0326551

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02668

TauD

Taurine catabolism dioxygenase TauD, TfdA family

38

320

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bke-assembly1.cif.gz_A crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine 0.9587 8 292
5bke-assembly1.cif.gz_G crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine 0.9572 9 292
5bke-assembly1.cif.gz_F crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine 0.9569 8 292
5bke-assembly1.cif.gz_D crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine 0.9528 9 291
8evo-assembly1.cif.gz_D sulfatase from mycobacterium tuberculosis (rv3406) in complex with inhibitor fg2216 0.9507 9 289
ID Description Score Start End Superfamily
5j92B00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9431 7 287 3.60.130.10
5j92B00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9186 7 287 3.60.130.10
4y0eD00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9052 7 289 3.60.130.10
5hsxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8978 7 294 3.60.130.10
1vz4D00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8922 10 294 3.60.130.10
ID Description Score Start End GO Terms
AF-A0A7X3Y928-F1-model_v4 TauD/TfdA family dioxygenase 0.9684 108 291 GO:0046872
GO:0051213
AF-A0A7X3Y8G2-F1-model_v4 TauD/TfdA family dioxygenase 0.959 8 291 GO:0046872
GO:0051213
AF-A0A3D2VEE5-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9586 93 297 GO:0051213
AF-A0A2S6TQ25-F1-model_v4 Alpha-ketoglutarate-dependent 2,4-dichlorophenoxyacetate dioxygenase (EC 1.14.11.-) 0.9558 8 292 GO:0046872
GO:0051213
AF-A0A2E4XVH7-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9538 7 293 GO:0046872
GO:0051213

Map