F368194

General Info

Members Datasets Scaffolds Average Seq Length
258 166 516 287

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10000305|Ga0307516_1000030554
Length 329
Sequence MHRAMVRRVPNEARHRSRSRRRGKFEMNRAANHSRDSETHSRDDVVPPRLKGFMFDLDGTLLLSDRSLGGYDILPGAVDLLAELERRAVPFVVLTNGSAYPPAEQAAKLRRLGLAVRDDRMLTPSSIAADLMIRHGVQRALVLGSPGVGHALRDAGVETVHTGEHGERDVQAVYVGWYPECTMTAIEAACHAIWAGAKLYVASDVPFFASKQGRTMGYSYAIVGAVRRVTRAPMILTGKPSLDALRFVARKLGLRRGDVGVVGDDPSVEIIMARRGGAKAFAVTTGVTSREEWQCQTGLRRPDRVLTRLDDLLDCVAAPPVPAAVSSPP

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
158 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
159 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
160 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
161 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
162 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
163 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.1
Nodule 0
Rhizoplane 5.04
Rhizosphere 81.78
Stem 0
Stem Tuber 0
Unclassified 16.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10000305 3300031730 Bacteria 63768
2 JGI25406J46586_10002155 3300003203 Bacteria 9312
3 rootH1_10125340 3300003323 Bacteria 6459
4 Ga0065704_10101226 3300005289 Unclassified 2245
5 Ga0065707_10083061 3300005295 Bacteria 10641
6 Ga0065707_10084107 3300005295 Bacteria 7681
7 Ga0070683_100050477 3300005329 Bacteria 3851
8 Ga0070690_100012448 3300005330 Bacteria 5005
9 Ga0070690_100167658 3300005330 Bacteria 1509
10 Ga0070670_100054264 3300005331 Bacteria 3440
11 Ga0068869_100097714 3300005334 Unclassified 2218
12 Ga0070666_10083479 3300005335 Unclassified 2185
13 Ga0070680_100009310 3300005336 Bacteria 7542
14 Ga0070680_100011867 3300005336 Bacteria 6758
15 Ga0070660_100244451 3300005339 Bacteria 1462
16 Ga0070674_100036861 3300005356 Bacteria 3286
17 Ga0070667_100108640 3300005367 Bacteria 2403
18 Ga0070709_10204865 3300005434 Unclassified 1399
19 Ga0070701_10082811 3300005438 Unclassified 1741
20 Ga0070711_100021844 3300005439 Bacteria 4143
21 Ga0070705_100035913 3300005440 Bacteria 2781
22 Ga0070700_100146707 3300005441 Unclassified 1609
23 Ga0070681_10006506 3300005458 Bacteria 11372
24 Ga0070681_10009287 3300005458 Bacteria 9671
25 Ga0070681_10026967 3300005458 Bacteria 5776
26 Ga0070679_100000605 3300005530 Bacteria 30538
27 Ga0070679_100056543 3300005530 Bacteria 3909
28 Ga0068853_100266810 3300005539 Bacteria 1575
29 Ga0070686_100025249 3300005544 Bacteria 3574
30 Ga0070665_100003052 3300005548 Bacteria 18032
31 Ga0070665_100004966 3300005548 Bacteria 13790
32 Ga0070665_100040990 3300005548 Bacteria 4654
33 Ga0070665_100042062 3300005548 Bacteria 4592
34 Ga0070665_100053966 3300005548 Bacteria 4031
35 Ga0070665_100214027 3300005548 Unclassified 1928
36 Ga0068855_100004606 3300005563 Bacteria 16832
37 Ga0068855_100006506 3300005563 Bacteria 14207
38 Ga0070664_100247776 3300005564 Bacteria 1601
39 Ga0070664_100608147 3300005564 Bacteria 1014
40 Ga0070702_100293981 3300005615 Bacteria 1121
41 Ga0068859_100039163 3300005617 Bacteria 4755
42 Ga0068859_100063342 3300005617 Bacteria 3729
43 Ga0068859_100180791 3300005617 Unclassified 2192
44 Ga0068864_100031713 3300005618 Bacteria 4485
45 Ga0068861_100042715 3300005719 Bacteria 3398
46 Ga0068861_100050755 3300005719 Bacteria 3146
47 Ga0068861_100331778 3300005719 Bacteria 1328
48 Ga0068870_10110347 3300005840 Unclassified 1570
49 Ga0068863_100009831 3300005841 Bacteria 9319
50 Ga0068863_100027623 3300005841 Bacteria 5414
51 Ga0068858_100169774 3300005842 Unclassified 2056
52 Ga0068858_100191228 3300005842 Unclassified 1934
53 Ga0068860_100000475 3300005843 Bacteria 49893
54 Ga0068860_100031952 3300005843 Bacteria 5060
55 Ga0068860_100067335 3300005843 Bacteria 3403
56 Ga0068862_100017197 3300005844 Bacteria 6018
57 Ga0068862_100054852 3300005844 Unclassified 3413
58 Ga0068862_100213505 3300005844 Bacteria 1744
59 Ga0068862_100292202 3300005844 Bacteria 1497
60 Ga0068862_100493805 3300005844 Unclassified 1161
61 Ga0081455_10000579 3300005937 Bacteria 47717
62 Ga0081539_10000028 3300005985 Bacteria 328182
63 Ga0097621_100049394 3300006237 Bacteria 3417
64 Ga0097621_100119057 3300006237 Bacteria 2238
65 Ga0068871_100025540 3300006358 Bacteria 4598
66 Ga0068865_100019304 3300006881 Bacteria 4411
67 Ga0097620_100039163 3300006931 Bacteria 4755
68 Ga0097620_100063342 3300006931 Bacteria 3729
69 Ga0097620_100180786 3300006931 Unclassified 2192
70 Ga0097620_100484933 3300006931 Bacteria 1332
71 Ga0099794_10063987 3300007265 Unclassified 1791
72 Ga0105250_10000014 3300009092 Bacteria 268458
73 Ga0105240_10007240 3300009093 Bacteria 16152
74 Ga0105240_10025594 3300009093 Bacteria 7750
75 Ga0105240_10036134 3300009093 Bacteria 6358
76 Ga0105240_10172582 3300009093 Bacteria 2559
77 Ga0105240_10400949 3300009093 Bacteria 1545
78 Ga0111539_10406591 3300009094 Bacteria 1585
79 Ga0105245_10388643 3300009098 Unclassified 1391
80 Ga0105247_10201689 3300009101 Unclassified 1337
81 Ga0105242_10175357 3300009176 Unclassified 1887
82 Ga0105248_10006277 3300009177 Bacteria 13037
83 Ga0105237_10114372 3300009545 Bacteria 2691
84 Ga0105238_10006833 3300009551 Bacteria 11390
85 Ga0105238_10085288 3300009551 Bacteria 3146
86 Ga0105238_10116117 3300009551 Bacteria 2656
87 Ga0105238_10116269 3300009551 Bacteria 2654
88 Ga0105238_10116755 3300009551 Unclassified 2648
89 Ga0105238_10223184 3300009551 Bacteria 1861
90 Ga0105249_10054694 3300009553 Bacteria 3650
91 Ga0105249_10237613 3300009553 Bacteria 1800
92 Ga0105239_10085272 3300010375 Bacteria 3480
93 Ga0157370_10002168 3300013104 Bacteria 23945
94 Ga0157370_10038038 3300013104 Bacteria 4658
95 Ga0157369_10035747 3300013105 Bacteria 5446
96 Ga0157369_10106368 3300013105 Bacteria 2986
97 Ga0157374_10049342 3300013296 Unclassified 3910
98 Ga0157378_10128726 3300013297 Bacteria 2341
99 Ga0163162_10142927 3300013306 Bacteria 2507
100 Ga0157372_10564319 3300013307 Unclassified 1327
101 Ga0157375_10067313 3300013308 Bacteria 3578
102 Ga0157375_10204180 3300013308 Bacteria 2132
103 Ga0157375_10375803 3300013308 Bacteria 1588
104 Ga0163163_10008759 3300014325 Bacteria 9004
105 Ga0163163_10057581 3300014325 Bacteria 3843
106 Ga0163163_10447813 3300014325 Unclassified 1351
107 Ga0157380_10008495 3300014326 Bacteria 7336
108 Ga0157380_10116468 3300014326 Unclassified 2255
109 Ga0157379_10000278 3300014968 Bacteria 40420
110 Ga0157379_10003934 3300014968 Bacteria 12661
111 Ga0157376_10331790 3300014969 Unclassified 1450
112 Ga0207696_1000087 3300025711 Bacteria 194367
113 Ga0207680_10023381 3300025903 Bacteria 3374
114 Ga0207643_10136037 3300025908 Bacteria 1465
115 Ga0207707_10000052 3300025912 Bacteria 117200
116 Ga0207707_10006638 3300025912 Bacteria 10098
117 Ga0207707_10010553 3300025912 Bacteria 8020
118 Ga0207707_10236715 3300025912 Bacteria 1588
119 Ga0207695_10004526 3300025913 Bacteria 18921
120 Ga0207695_10049025 3300025913 Bacteria 4455
121 Ga0207695_10139214 3300025913 Bacteria 2377
122 Ga0207695_10423298 3300025913 Bacteria 1216
123 Ga0207660_10003561 3300025917 Bacteria 10142
124 Ga0207660_10425896 3300025917 Bacteria 1071
125 Ga0207652_10001360 3300025921 Bacteria 21746
126 Ga0207652_10085157 3300025921 Bacteria 2770
127 Ga0207652_10374838 3300025921 Bacteria 1284
128 Ga0207694_10016711 3300025924 Bacteria 5547
129 Ga0207694_10103473 3300025924 Bacteria 2258
130 Ga0207694_10331135 3300025924 Unclassified 1258
131 Ga0207650_10060932 3300025925 Bacteria 2816
132 Ga0207687_10019709 3300025927 Bacteria 4471
133 Ga0207700_10101850 3300025928 Bacteria 2292
134 Ga0207644_10104572 3300025931 Bacteria 2132
135 Ga0207706_10000606 3300025933 Bacteria 38141
136 Ga0207704_10006916 3300025938 Bacteria 5322
137 Ga0207704_10386365 3300025938 Unclassified 1100
138 Ga0207691_10042403 3300025940 Bacteria 4195
139 Ga0207711_10051600 3300025941 Bacteria 3523
140 Ga0207661_10588472 3300025944 Unclassified 1021
141 Ga0207667_10001737 3300025949 Bacteria 27400
142 Ga0207667_10002121 3300025949 Bacteria 24834
143 Ga0207712_10042551 3300025961 Bacteria 3128
144 Ga0207658_10094020 3300025986 Bacteria 2332
145 Ga0207703_10003208 3300026035 Bacteria 13760
146 Ga0207703_10006054 3300026035 Bacteria 9674
147 Ga0207639_10086093 3300026041 Bacteria 2501
148 Ga0207639_10314332 3300026041 Unclassified 1389
149 Ga0207678_10017710 3300026067 Bacteria 6256
150 Ga0207708_10187115 3300026075 Unclassified 1646
151 Ga0207702_10156930 3300026078 Unclassified 2075
152 Ga0207641_10001145 3300026088 Bacteria 26648
153 Ga0207641_10180244 3300026088 Bacteria 1934
154 Ga0207648_10048412 3300026089 Bacteria 3721
155 Ga0207648_10070742 3300026089 Bacteria 3041
156 Ga0207676_10104901 3300026095 Bacteria 2352
157 Ga0207675_100003306 3300026118 Bacteria 15775
158 Ga0207675_100020410 3300026118 Bacteria 6175
159 Ga0207675_100066687 3300026118 Bacteria 3364
160 Ga0207675_100077163 3300026118 Bacteria 3121
161 Ga0268266_10001861 3300028379 Bacteria 23842
162 Ga0268266_10017864 3300028379 Bacteria 6044
163 Ga0268266_10021869 3300028379 Bacteria 5449
164 Ga0268266_10041232 3300028379 Bacteria 3938
165 Ga0268266_10050769 3300028379 Bacteria 3558
166 Ga0268265_10076375 3300028380 Bacteria 2628
167 Ga0268265_10475941 3300028380 Unclassified 1172
168 Ga0268264_10000452 3300028381 Bacteria 56001
169 Ga0268264_10025131 3300028381 Bacteria 4866
170 Ga0265319_1063185 3300028563 Bacteria 1198
171 Ga0265334_10063252 3300028573 Bacteria 1391
172 Ga0307511_10060152 3300030521 Bacteria 2911
173 Ga0265762_1015014 3300030760 Unclassified 1401
174 Ga0265760_10056807 3300031090 Bacteria 1185
175 Ga0265340_10023345 3300031247 Bacteria 3155
176 Ga0265331_10007793 3300031250 Bacteria 6148
177 Ga0307513_10026955 3300031456 Bacteria 6610
178 Ga0307513_10470769 3300031456 Unclassified 978
179 Ga0307509_10000030 3300031507 Bacteria 206541
180 Ga0316575_10082263 3300031665 Bacteria 1299
181 Ga0307405_10002344 3300031731 Bacteria 8327
182 Ga0307405_10244454 3300031731 Unclassified 1331
183 Ga0307413_10010758 3300031824 Bacteria 4457
184 Ga0307410_10005061 3300031852 Bacteria 6928
185 Ga0307406_10003484 3300031901 Bacteria 8561
186 Ga0307407_10000940 3300031903 Bacteria 9892
187 Ga0307409_100009552 3300031995 Bacteria 5968
188 Ga0307416_100038579 3300032002 Bacteria 3687
189 Ga0307411_10001579 3300032005 Bacteria 9445
190 Ga0307415_100028796 3300032126 Bacteria 3540
191 Ga0307415_100136746 3300032126 Bacteria 1865
192 Ga0307510_10000001 3300033180 Bacteria 1172244
193 Ga0307510_10115505 3300033180 Bacteria 2409
194 Ga0373936_0003657 3300035113 Bacteria 5771
195 Ga0373936_0019820 3300035113 Bacteria 2609
196 Ga0373957_0140343 3300035120 Bacteria 988
197 Ga0373927_0055965 3300035695 Bacteria 2550
198 Ga0373937_0067646 3300036401 Bacteria 3292
199 Ga0373937_0490627 3300036401 Unclassified 1167
200 Ga0316584_0027127 3300036712 Bacteria 4214
201 Ga0466966_0006857 3300044684 Bacteria 7544
202 Ga0466961_0005657 3300044693 Bacteria 7899
203 Ga0466964_0002595 3300044706 Bacteria 6451
204 Ga0466971_0002282 3300044719 Bacteria 8127
205 Ga0466970_0002605 3300044765 Bacteria 8697
206 Ga0466957_0026730 3300044842 Bacteria 3425
207 Ga0466959_0001567 3300045049 Bacteria 14086
208 Ga0466958_0052030 3300045836 Unclassified 2481
209 Ga0495590_0007662 3300046457 Bacteria 4147
210 Ga0495580_0377513 3300046472 Bacteria 958
211 Ga0495662_0116363 3300046476 Bacteria 1311
212 Ga0495585_0090262 3300046492 Bacteria 1651
213 Ga0495668_0030728 3300046616 Bacteria 3031
214 Ga0495647_0012780 3300046681 Bacteria 2896
215 Ga0495604_0302534 3300047317 Unclassified 1074
216 Ga0495687_076521 3300047443 Unclassified 1324
217 Ga0495675_0037505 3300047444 Bacteria 3087
218 Ga0496102_0003221 3300048905 Bacteria 13851
219 Ga0496104_0008673 3300048907 Bacteria 9042
220 Ga0496104_0041486 3300048907 Bacteria 4315
221 Ga0496104_0424192 3300048907 Bacteria 1242
222 Ga0496105_0003391 3300048908 Bacteria 11779
223 Ga0496108_0004690 3300048911 Bacteria 11020
224 Ga0496109_0003527 3300048912 Bacteria 13056
225 Ga0496110_0002282 3300048913 Bacteria 14322
226 Ga0496111_0043128 3300048914 Bacteria 3241
227 Ga0496114_0007651 3300048917 Bacteria 8543
228 Ga0496114_0354395 3300048917 Bacteria 1298
229 Ga0496115_0004092 3300048918 Bacteria 10529
230 Ga0496115_0445801 3300048918 Bacteria 1046
231 Ga0496116_0115906 3300048919 Bacteria 1562
232 Ga0496117_0000102 3300048920 Bacteria 189959
233 Ga0496118_0000038 3300048921 Bacteria 315464
234 Ga0496118_0115596 3300048921 Bacteria 1765
235 Ga0496119_0003022 3300048922 Bacteria 17808
236 Ga0496119_0014861 3300048922 Bacteria 6053
237 Ga0496120_0000720 3300048923 Bacteria 48477
238 Ga0496120_0009306 3300048923 Bacteria 6986
239 Ga0496121_0033086 3300048924 Bacteria 4686
240 Ga0496121_0072649 3300048924 Unclassified 2761
241 Ga0496121_0169273 3300048924 Bacteria 1589
242 Ga0496121_0234589 3300048924 Bacteria 1283
243 Ga0496124_0045027 3300048927 Unclassified 3783
244 Ga0496125_0001517 3300048928 Bacteria 33276
245 Ga0496125_0005299 3300048928 Bacteria 14426
246 Ga0496126_0001431 3300048929 Bacteria 37495
247 Ga0496126_0015757 3300048929 Bacteria 7595
248 Ga0496126_0017352 3300048929 Bacteria 7173
249 Ga0495678_028241 3300049459 Bacteria 2371
250 Ga0500651_0130715 3300053093 Unclassified 1519
251 Ga0500641_0062442 3300053096 Bacteria 1554
252 Ga0500572_040547 3300053111 Unclassified 1348
253 Ga0500617_039692 3300053124 Bacteria 2107
254 Ga0500568_0022669 3300053139 Bacteria 2682
255 Ga0500590_114379 3300053148 Bacteria 1275
256 Ga0500616_0000011 3300053153 Bacteria 732880
257 Ga0500622_0003625 3300053156 Bacteria 10146
258 Ga0466962_0000551 3300061719 Bacteria 16543
259 Ga0307516_10000305
260 JGI25406J46586_10002155
261 rootH1_10125340
262 Ga0065704_10101226
263 Ga0065707_10083061
264 Ga0065707_10084107
265 Ga0070683_100050477
266 Ga0070690_100012448
267 Ga0070690_100167658
268 Ga0070670_100054264
269 Ga0068869_100097714
270 Ga0070666_10083479
271 Ga0070680_100009310
272 Ga0070680_100011867
273 Ga0070660_100244451
274 Ga0070674_100036861
275 Ga0070667_100108640
276 Ga0070709_10204865
277 Ga0070701_10082811
278 Ga0070711_100021844
279 Ga0070705_100035913
280 Ga0070700_100146707
281 Ga0070681_10006506
282 Ga0070681_10009287
283 Ga0070681_10026967
284 Ga0070679_100000605
285 Ga0070679_100056543
286 Ga0068853_100266810
287 Ga0070686_100025249
288 Ga0070665_100003052
289 Ga0070665_100004966
290 Ga0070665_100040990
291 Ga0070665_100042062
292 Ga0070665_100053966
293 Ga0070665_100214027
294 Ga0068855_100004606
295 Ga0068855_100006506
296 Ga0070664_100247776
297 Ga0070664_100608147
298 Ga0070702_100293981
299 Ga0068859_100039163
300 Ga0068859_100063342
301 Ga0068859_100180791
302 Ga0068864_100031713
303 Ga0068861_100042715
304 Ga0068861_100050755
305 Ga0068861_100331778
306 Ga0068870_10110347
307 Ga0068863_100009831
308 Ga0068863_100027623
309 Ga0068858_100169774
310 Ga0068858_100191228
311 Ga0068860_100000475
312 Ga0068860_100031952
313 Ga0068860_100067335
314 Ga0068862_100017197
315 Ga0068862_100054852
316 Ga0068862_100213505
317 Ga0068862_100292202
318 Ga0068862_100493805
319 Ga0081455_10000579
320 Ga0081539_10000028
321 Ga0097621_100049394
322 Ga0097621_100119057
323 Ga0068871_100025540
324 Ga0068865_100019304
325 Ga0097620_100039163
326 Ga0097620_100063342
327 Ga0097620_100180786
328 Ga0097620_100484933
329 Ga0099794_10063987
330 Ga0105250_10000014
331 Ga0105240_10007240
332 Ga0105240_10025594
333 Ga0105240_10036134
334 Ga0105240_10172582
335 Ga0105240_10400949
336 Ga0111539_10406591
337 Ga0105245_10388643
338 Ga0105247_10201689
339 Ga0105242_10175357
340 Ga0105248_10006277
341 Ga0105237_10114372
342 Ga0105238_10006833
343 Ga0105238_10085288
344 Ga0105238_10116117
345 Ga0105238_10116269
346 Ga0105238_10116755
347 Ga0105238_10223184
348 Ga0105249_10054694
349 Ga0105249_10237613
350 Ga0105239_10085272
351 Ga0157370_10002168
352 Ga0157370_10038038
353 Ga0157369_10035747
354 Ga0157369_10106368
355 Ga0157374_10049342
356 Ga0157378_10128726
357 Ga0163162_10142927
358 Ga0157372_10564319
359 Ga0157375_10067313
360 Ga0157375_10204180
361 Ga0157375_10375803
362 Ga0163163_10008759
363 Ga0163163_10057581
364 Ga0163163_10447813
365 Ga0157380_10008495
366 Ga0157380_10116468
367 Ga0157379_10000278
368 Ga0157379_10003934
369 Ga0157376_10331790
370 Ga0207696_1000087
371 Ga0207680_10023381
372 Ga0207643_10136037
373 Ga0207707_10000052
374 Ga0207707_10006638
375 Ga0207707_10010553
376 Ga0207707_10236715
377 Ga0207695_10004526
378 Ga0207695_10049025
379 Ga0207695_10139214
380 Ga0207695_10423298
381 Ga0207660_10003561
382 Ga0207660_10425896
383 Ga0207652_10001360
384 Ga0207652_10085157
385 Ga0207652_10374838
386 Ga0207694_10016711
387 Ga0207694_10103473
388 Ga0207694_10331135
389 Ga0207650_10060932
390 Ga0207687_10019709
391 Ga0207700_10101850
392 Ga0207644_10104572
393 Ga0207706_10000606
394 Ga0207704_10006916
395 Ga0207704_10386365
396 Ga0207691_10042403
397 Ga0207711_10051600
398 Ga0207661_10588472
399 Ga0207667_10001737
400 Ga0207667_10002121
401 Ga0207712_10042551
402 Ga0207658_10094020
403 Ga0207703_10003208
404 Ga0207703_10006054
405 Ga0207639_10086093
406 Ga0207639_10314332
407 Ga0207678_10017710
408 Ga0207708_10187115
409 Ga0207702_10156930
410 Ga0207641_10001145
411 Ga0207641_10180244
412 Ga0207648_10048412
413 Ga0207648_10070742
414 Ga0207676_10104901
415 Ga0207675_100003306
416 Ga0207675_100020410
417 Ga0207675_100066687
418 Ga0207675_100077163
419 Ga0268266_10001861
420 Ga0268266_10017864
421 Ga0268266_10021869
422 Ga0268266_10041232
423 Ga0268266_10050769
424 Ga0268265_10076375
425 Ga0268265_10475941
426 Ga0268264_10000452
427 Ga0268264_10025131
428 Ga0265319_1063185
429 Ga0265334_10063252
430 Ga0307511_10060152
431 Ga0265762_1015014
432 Ga0265760_10056807
433 Ga0265340_10023345
434 Ga0265331_10007793
435 Ga0307513_10026955
436 Ga0307513_10470769
437 Ga0307509_10000030
438 Ga0316575_10082263
439 Ga0307405_10002344
440 Ga0307405_10244454
441 Ga0307413_10010758
442 Ga0307410_10005061
443 Ga0307406_10003484
444 Ga0307407_10000940
445 Ga0307409_100009552
446 Ga0307416_100038579
447 Ga0307411_10001579
448 Ga0307415_100028796
449 Ga0307415_100136746
450 Ga0307510_10000001
451 Ga0307510_10115505
452 Ga0373936_0003657
453 Ga0373936_0019820
454 Ga0373957_0140343
455 Ga0373927_0055965
456 Ga0373937_0067646
457 Ga0373937_0490627
458 Ga0316584_0027127
459 Ga0466966_0006857
460 Ga0466961_0005657
461 Ga0466964_0002595
462 Ga0466971_0002282
463 Ga0466970_0002605
464 Ga0466957_0026730
465 Ga0466959_0001567
466 Ga0466958_0052030
467 Ga0495590_0007662
468 Ga0495580_0377513
469 Ga0495662_0116363
470 Ga0495585_0090262
471 Ga0495668_0030728
472 Ga0495647_0012780
473 Ga0495604_0302534
474 Ga0495687_076521
475 Ga0495675_0037505
476 Ga0496102_0003221
477 Ga0496104_0008673
478 Ga0496104_0041486
479 Ga0496104_0424192
480 Ga0496105_0003391
481 Ga0496108_0004690
482 Ga0496109_0003527
483 Ga0496110_0002282
484 Ga0496111_0043128
485 Ga0496114_0007651
486 Ga0496114_0354395
487 Ga0496115_0004092
488 Ga0496115_0445801
489 Ga0496116_0115906
490 Ga0496117_0000102
491 Ga0496118_0000038
492 Ga0496118_0115596
493 Ga0496119_0003022
494 Ga0496119_0014861
495 Ga0496120_0000720
496 Ga0496120_0009306
497 Ga0496121_0033086
498 Ga0496121_0072649
499 Ga0496121_0169273
500 Ga0496121_0234589
501 Ga0496124_0045027
502 Ga0496125_0001517
503 Ga0496125_0005299
504 Ga0496126_0001431
505 Ga0496126_0015757
506 Ga0496126_0017352
507 Ga0495678_028241
508 Ga0500651_0130715
509 Ga0500641_0062442
510 Ga0500572_040547
511 Ga0500617_039692
512 Ga0500568_0022669
513 Ga0500590_114379
514 Ga0500616_0000011
515 Ga0500622_0003625
516 Ga0466962_0000551

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13344

Hydrolase_6

Haloacid dehalogenase-like hydrolase

53

158

0.96

PF13242

Hydrolase_like

HAD-hyrolase-like

236

312

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ys9-assembly1.cif.gz_A crystal structure of phosphatase spy1043 from streptococcus pyogenes 0.9287 23 284
4kn8-assembly1.cif.gz_B crystal structure of bs-tpnppase 0.9219 21 281
1wvi-assembly1.cif.gz_D crystal structure of putative phosphatase from streptococcus mutans ua159 0.9177 23 284
1ydf-assembly1.cif.gz_A crystal structure of a had-like phosphatase from streptococcus pneumoniae 0.9175 21 284
4ig4-assembly1.cif.gz_B crystal structure of single mutant thermostable nppase (n86s) from geobacillus stearothermophilus 0.9113 21 281
ID Description Score Start End Superfamily
af_Q2FZX0_163_251_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9263 194 282 3.40.50.1000
af_P0AF24_1_250_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9218 22 284 3.40.50.1000
1wviD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9164 24 284 3.40.50.1000
af_Q2FZX0_4_251_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9135 24 282 3.40.50.1000
3hltC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9103 23 287 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A534DZB9-F1-model_v4 Haloacid dehalogenase 0.9696 8 290 GO:0005737
GO:0016791
AF-A0A534GTM8-F1-model_v4 Haloacid dehalogenase 0.965 8 292 GO:0005737
GO:0016791
AF-A0A534DZB9-F1-model_v4 Haloacid dehalogenase 0.9596 8 290 GO:0005737
GO:0016791
AF-A0A368X0S3-F1-model_v4 deleted 0.9492 17 287
AF-X1BTC5-F1-model_v4 Haloacid dehalogenase 0.9452 54 288 GO:0005737
GO:0016791

Map