F368191
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 258 | 163 | 253 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300031727|Ga0316576_10000350|Ga0316576_1000035010 |
| Length | 237 |
| Sequence | VLYWMFKYILLGPWLRLLYRPQVEGLENIPDEGPAILASNHLSFSDSIFLPLVCKRHITFLAKAEYFTGKGIKGWLTKAFMKGVGQVPIDRSGGADAALNTALRVLGEDELLGIYPEGTRSPDGRLYRGKTGVARMALEAGVPVIPVAMIGTREIQPAGQKIPNVRRVGIKIGQPLDFSRYEGMENDRFVLRSMADEIMYELMELSGQEYVDLYASRAKEVIAEGESVQAAATAQVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 2 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 3 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 29 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 31 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 32 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 33 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 34 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 35 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 36 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 46 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 47 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 48 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 50 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 51 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 82 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 84 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 85 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 86 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 87 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 88 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 89 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 90 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 91 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 92 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 93 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 94 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 95 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 96 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 97 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 98 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 99 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 100 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 101 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 102 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 103 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 104 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 105 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 106 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 107 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 108 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 109 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 110 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 111 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 112 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 113 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 114 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 115 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 116 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 124 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 127 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 128 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 129 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 130 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 153 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 159 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 162 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 163 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.41 |
| Metatranscriptomes | 4.65 |
| Isolates | 1.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.55 |
| Nodule | 0 |
| Rhizoplane | 2.71 |
| Rhizosphere | 93.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_11765523 | 3300004799 | Bacteria | 1037 |
| 2 | Ga0070658_10003585 | 3300005327 | Bacteria | 12729 |
| 3 | Ga0070658_10029743 | 3300005327 | Bacteria | 4389 |
| 4 | Ga0070683_100009974 | 3300005329 | Bacteria | 8145 |
| 5 | Ga0070683_100109595 | 3300005329 | Bacteria | 2604 |
| 6 | Ga0070690_100043266 | 3300005330 | Bacteria | 2856 |
| 7 | Ga0070670_100349245 | 3300005331 | Bacteria | 1299 |
| 8 | Ga0068869_100208489 | 3300005334 | Bacteria | 1544 |
| 9 | Ga0068869_100546018 | 3300005334 | Bacteria | 973 |
| 10 | Ga0070680_100000052 | 3300005336 | Bacteria | 59665 |
| 11 | Ga0070680_100018572 | 3300005336 | Bacteria | 5496 |
| 12 | Ga0070682_100018082 | 3300005337 | Bacteria | 4115 |
| 13 | Ga0068868_100041701 | 3300005338 | Bacteria | 3577 |
| 14 | Ga0070660_100013862 | 3300005339 | Bacteria | 5799 |
| 15 | Ga0070660_100222343 | 3300005339 | Bacteria | 1535 |
| 16 | Ga0070689_100122465 | 3300005340 | Bacteria | 2078 |
| 17 | Ga0070661_100219305 | 3300005344 | Bacteria | 1459 |
| 18 | Ga0070692_10158078 | 3300005345 | Bacteria | 1296 |
| 19 | Ga0070659_100000197 | 3300005366 | Bacteria | 46446 |
| 20 | Ga0070659_100206045 | 3300005366 | Bacteria | 1620 |
| 21 | Ga0070659_100459900 | 3300005366 | Bacteria | 1080 |
| 22 | Ga0070709_10189253 | 3300005434 | Bacteria | 1451 |
| 23 | Ga0070714_100946514 | 3300005435 | Bacteria | 837 |
| 24 | Ga0070713_100036596 | 3300005436 | Bacteria | 3962 |
| 25 | Ga0070678_100218048 | 3300005456 | Bacteria | 1585 |
| 26 | Ga0070681_10000004 | 3300005458 | Bacteria | 205157 |
| 27 | Ga0070681_10029718 | 3300005458 | Bacteria | 5487 |
| 28 | Ga0070679_100031072 | 3300005530 | Bacteria | 5275 |
| 29 | Ga0070679_100032574 | 3300005530 | Bacteria | 5157 |
| 30 | Ga0070679_100209259 | 3300005530 | Bacteria | 1915 |
| 31 | Ga0070679_100232589 | 3300005530 | Bacteria | 1802 |
| 32 | Ga0070684_100012695 | 3300005535 | Bacteria | 6760 |
| 33 | Ga0070664_100054518 | 3300005564 | Bacteria | 3392 |
| 34 | Ga0070664_100122223 | 3300005564 | Bacteria | 2281 |
| 35 | Ga0068857_100332270 | 3300005577 | Bacteria | 1405 |
| 36 | Ga0068858_100555015 | 3300005842 | Bacteria | 1112 |
| 37 | Ga0081540_1002639 | 3300005983 | Bacteria | 14576 |
| 38 | Ga0081540_1119865 | 3300005983 | Bacteria | 1094 |
| 39 | Ga0070717_10178505 | 3300006028 | Bacteria | 1850 |
| 40 | Ga0070717_10231791 | 3300006028 | Bacteria | 1626 |
| 41 | Ga0075365_10068545 | 3300006038 | Bacteria | 2383 |
| 42 | Ga0068871_100639124 | 3300006358 | Bacteria | 971 |
| 43 | Ga0075428_100000347 | 3300006844 | Bacteria | 45930 |
| 44 | Ga0075428_100000841 | 3300006844 | Bacteria | 32161 |
| 45 | Ga0075428_100058646 | 3300006844 | Bacteria | 4214 |
| 46 | Ga0075428_100166729 | 3300006844 | Bacteria | 2389 |
| 47 | Ga0075428_100430396 | 3300006844 | Bacteria | 1414 |
| 48 | Ga0075428_100496029 | 3300006844 | Bacteria | 1307 |
| 49 | Ga0075428_100668101 | 3300006844 | Bacteria | 1107 |
| 50 | Ga0075430_100002555 | 3300006846 | Bacteria | 15186 |
| 51 | Ga0075430_100007931 | 3300006846 | Bacteria | 8976 |
| 52 | Ga0075430_100074115 | 3300006846 | Bacteria | 2854 |
| 53 | Ga0075431_100006394 | 3300006847 | Bacteria | 11693 |
| 54 | Ga0075431_100019728 | 3300006847 | Bacteria | 6881 |
| 55 | Ga0075431_100024136 | 3300006847 | Bacteria | 6226 |
| 56 | Ga0075431_100047933 | 3300006847 | Bacteria | 4406 |
| 57 | Ga0075431_100089448 | 3300006847 | Bacteria | 3178 |
| 58 | Ga0075431_100655365 | 3300006847 | Bacteria | 1030 |
| 59 | Ga0075429_100007102 | 3300006880 | Bacteria | 9722 |
| 60 | Ga0075429_100009846 | 3300006880 | Bacteria | 8287 |
| 61 | Ga0075429_100122400 | 3300006880 | Bacteria | 2274 |
| 62 | Ga0075429_100206755 | 3300006880 | Bacteria | 1720 |
| 63 | Ga0114129_10000004 | 3300009147 | Bacteria | 160944 |
| 64 | Ga0114129_10000050 | 3300009147 | Bacteria | 102066 |
| 65 | Ga0114129_10029119 | 3300009147 | Bacteria | 7822 |
| 66 | Ga0114129_10097601 | 3300009147 | Bacteria | 4067 |
| 67 | Ga0114129_10250565 | 3300009147 | Bacteria | 2377 |
| 68 | Ga0114129_10322858 | 3300009147 | Bacteria | 2052 |
| 69 | Ga0114129_10426648 | 3300009147 | Bacteria | 1743 |
| 70 | Ga0114129_10811390 | 3300009147 | Bacteria | 1193 |
| 71 | Ga0105243_10296589 | 3300009148 | Bacteria | 1463 |
| 72 | Ga0105249_10882337 | 3300009553 | Bacteria | 961 |
| 73 | Ga0105239_10583508 | 3300010375 | Bacteria | 1274 |
| 74 | Ga0157371_10009080 | 3300013102 | Bacteria | 7857 |
| 75 | Ga0157369_10001205 | 3300013105 | Bacteria | 32229 |
| 76 | Ga0157369_10010017 | 3300013105 | Bacteria | 10827 |
| 77 | Ga0157369_10026100 | 3300013105 | Bacteria | 6481 |
| 78 | Ga0157369_10034948 | 3300013105 | Bacteria | 5512 |
| 79 | Ga0157374_10486661 | 3300013296 | Bacteria | 1237 |
| 80 | Ga0157372_10080581 | 3300013307 | Bacteria | 3684 |
| 81 | Ga0163163_10518411 | 3300014325 | Bacteria | 1254 |
| 82 | Ga0206356_11681511 | 3300020070 | Bacteria | 1311 |
| 83 | Ga0206351_10213804 | 3300020077 | Bacteria | 862 |
| 84 | Ga0206351_10691225 | 3300020077 | Bacteria | 872 |
| 85 | Ga0206354_10062880 | 3300020081 | Bacteria | 1702 |
| 86 | Ga0206354_10204240 | 3300020081 | Bacteria | 1299 |
| 87 | Ga0206354_11719496 | 3300020081 | Bacteria | 852 |
| 88 | Ga0206353_11769543 | 3300020082 | Bacteria | 1578 |
| 89 | Ga0154015_1418370 | 3300020610 | Bacteria | 1376 |
| 90 | Ga0154015_1459263 | 3300020610 | Bacteria | 1196 |
| 91 | Ga0224712_10004574 | 3300022467 | Bacteria | 3745 |
| 92 | Ga0224712_10163091 | 3300022467 | Bacteria | 995 |
| 93 | Ga0207688_10091837 | 3300025901 | Bacteria | 1744 |
| 94 | Ga0207705_10009486 | 3300025909 | Bacteria | 7079 |
| 95 | Ga0207705_10017741 | 3300025909 | Bacteria | 5091 |
| 96 | Ga0207705_10051983 | 3300025909 | Bacteria | 2949 |
| 97 | Ga0207707_10000264 | 3300025912 | Bacteria | 56589 |
| 98 | Ga0207707_10020182 | 3300025912 | Bacteria | 5817 |
| 99 | Ga0207707_10316729 | 3300025912 | Bacteria | 1347 |
| 100 | Ga0207695_10279123 | 3300025913 | Bacteria | 1564 |
| 101 | Ga0207660_10000139 | 3300025917 | Bacteria | 43716 |
| 102 | Ga0207660_10061886 | 3300025917 | Bacteria | 2695 |
| 103 | Ga0207660_10176519 | 3300025917 | Bacteria | 1657 |
| 104 | Ga0207657_10077522 | 3300025919 | Bacteria | 2800 |
| 105 | Ga0207657_10212545 | 3300025919 | Bacteria | 1552 |
| 106 | Ga0207657_10228531 | 3300025919 | Bacteria | 1489 |
| 107 | Ga0207649_10027940 | 3300025920 | Bacteria | 3317 |
| 108 | Ga0207652_10080862 | 3300025921 | Bacteria | 2842 |
| 109 | Ga0207652_10248271 | 3300025921 | Bacteria | 1605 |
| 110 | Ga0207650_10063779 | 3300025925 | Bacteria | 2756 |
| 111 | Ga0207659_10006498 | 3300025926 | Bacteria | 7165 |
| 112 | Ga0207700_10021883 | 3300025928 | Bacteria | 4376 |
| 113 | Ga0207664_10711837 | 3300025929 | Bacteria | 903 |
| 114 | Ga0207690_10000114 | 3300025932 | Bacteria | 66039 |
| 115 | Ga0207690_10015737 | 3300025932 | Bacteria | 4589 |
| 116 | Ga0207690_10040932 | 3300025932 | Bacteria | 3033 |
| 117 | Ga0207690_10199756 | 3300025932 | Bacteria | 1518 |
| 118 | Ga0207706_10031074 | 3300025933 | Bacteria | 4759 |
| 119 | Ga0207686_10217376 | 3300025934 | Bacteria | 1378 |
| 120 | Ga0207709_10321125 | 3300025935 | Bacteria | 1159 |
| 121 | Ga0207704_10035208 | 3300025938 | Bacteria | 2867 |
| 122 | Ga0207689_10007601 | 3300025942 | Bacteria | 9494 |
| 123 | Ga0207661_10033246 | 3300025944 | Bacteria | 4001 |
| 124 | Ga0207661_10163714 | 3300025944 | Bacteria | 1931 |
| 125 | Ga0207661_10221464 | 3300025944 | Bacteria | 1672 |
| 126 | Ga0207679_10062081 | 3300025945 | Bacteria | 2783 |
| 127 | Ga0207679_10064124 | 3300025945 | Bacteria | 2745 |
| 128 | Ga0207679_10169735 | 3300025945 | Bacteria | 1795 |
| 129 | Ga0207667_10092219 | 3300025949 | Bacteria | 3129 |
| 130 | Ga0207712_10470905 | 3300025961 | Bacteria | 1069 |
| 131 | Ga0207677_10013479 | 3300026023 | Bacteria | 4740 |
| 132 | Ga0207677_10039451 | 3300026023 | Bacteria | 3105 |
| 133 | Ga0207703_10178276 | 3300026035 | Bacteria | 1874 |
| 134 | Ga0207703_10409647 | 3300026035 | Bacteria | 1259 |
| 135 | Ga0207678_10017274 | 3300026067 | Bacteria | 6334 |
| 136 | Ga0207708_10002097 | 3300026075 | Bacteria | 14671 |
| 137 | Ga0207676_10087077 | 3300026095 | Bacteria | 2554 |
| 138 | Ga0207674_10004379 | 3300026116 | Bacteria | 17021 |
| 139 | Ga0207674_10184559 | 3300026116 | Bacteria | 2036 |
| 140 | Ga0207674_10501909 | 3300026116 | Bacteria | 1172 |
| 141 | Ga0207675_100033025 | 3300026118 | Bacteria | 4822 |
| 142 | Ga0207698_10098633 | 3300026142 | Bacteria | 2415 |
| 143 | Ga0207428_10014920 | 3300027907 | Bacteria | 6731 |
| 144 | Ga0268265_11021229 | 3300028380 | Bacteria | 818 |
| 145 | Ga0316177_1180807 | 3300030731 | Bacteria | 1798 |
| 146 | Ga0265340_10001696 | 3300031247 | Bacteria | 12650 |
| 147 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 148 | Ga0307408_100490787 | 3300031548 | Bacteria | 1073 |
| 149 | Ga0307508_10064754 | 3300031616 | Bacteria | 3222 |
| 150 | Ga0316575_10000262 | 3300031665 | Bacteria | 14418 |
| 151 | Ga0316576_10000350 | 3300031727 | Bacteria | 20732 |
| 152 | Ga0307405_10096420 | 3300031731 | Bacteria | 1972 |
| 153 | Ga0316577_10124327 | 3300031733 | Bacteria | 1450 |
| 154 | Ga0307410_10072901 | 3300031852 | Bacteria | 2386 |
| 155 | Ga0307406_10037964 | 3300031901 | Bacteria | 2979 |
| 156 | Ga0307406_10063697 | 3300031901 | Bacteria | 2389 |
| 157 | Ga0307407_10015874 | 3300031903 | Bacteria | 3736 |
| 158 | Ga0307412_10349107 | 3300031911 | Bacteria | 1187 |
| 159 | Ga0307409_100001554 | 3300031995 | Bacteria | 11402 |
| 160 | Ga0307416_100001919 | 3300032002 | Bacteria | 11605 |
| 161 | Ga0307415_100000113 | 3300032126 | Bacteria | 34898 |
| 162 | Ga0307415_100001663 | 3300032126 | Bacteria | 10793 |
| 163 | Ga0307415_100074126 | 3300032126 | Bacteria | 2404 |
| 164 | Ga0307415_100143054 | 3300032126 | Bacteria | 1830 |
| 165 | Ga0307415_100244467 | 3300032126 | Bacteria | 1454 |
| 166 | Ga0316585_10044794 | 3300032137 | Bacteria | 1414 |
| 167 | Ga0373946_0114648 | 3300035171 | Bacteria | 1224 |
| 168 | Ga0316584_0010630 | 3300036712 | Bacteria | 6441 |
| 169 | Ga0395899_0281541 | 3300037312 | Bacteria | 1131 |
| 170 | Ga0395900_0019557 | 3300037418 | Bacteria | 6904 |
| 171 | Ga0395901_0064209 | 3300038443 | Bacteria | 3822 |
| 172 | Ga0439439_0060841 | 3300041406 | Bacteria | 1002 |
| 173 | Ga0439466_0025154 | 3300041411 | Bacteria | 2080 |
| 174 | Ga0439433_0014584 | 3300041999 | Bacteria | 1731 |
| 175 | Ga0466972_0161600 | 3300044658 | Bacteria | 1052 |
| 176 | Ga0466966_0047654 | 3300044684 | Bacteria | 2732 |
| 177 | Ga0466961_0001181 | 3300044693 | Bacteria | 16097 |
| 178 | Ga0466961_0020141 | 3300044693 | Bacteria | 4294 |
| 179 | Ga0466961_0063872 | 3300044693 | Bacteria | 2340 |
| 180 | Ga0466961_0112291 | 3300044693 | Bacteria | 1714 |
| 181 | Ga0466970_0173237 | 3300044765 | Bacteria | 1196 |
| 182 | Ga0466957_0147303 | 3300044842 | Bacteria | 1520 |
| 183 | Ga0466959_0276860 | 3300045049 | Bacteria | 1152 |
| 184 | Ga0466958_0013114 | 3300045836 | Bacteria | 4712 |
| 185 | Ga0466967_0039426 | 3300045976 | Bacteria | 4061 |
| 186 | Ga0466967_0390336 | 3300045976 | Bacteria | 1353 |
| 187 | Ga0495608_0172080 | 3300046511 | Bacteria | 1373 |
| 188 | Ga0495668_0000644 | 3300046616 | Bacteria | 41961 |
| 189 | Ga0495625_0000908 | 3300046660 | Bacteria | 39902 |
| 190 | Ga0495657_0209878 | 3300046675 | Bacteria | 1184 |
| 191 | Ga0495604_0406546 | 3300047317 | Bacteria | 896 |
| 192 | Ga0495683_0039783 | 3300047323 | Bacteria | 2376 |
| 193 | Ga0495626_0000689 | 3300048091 | Bacteria | 32325 |
| 194 | Ga0496104_0333150 | 3300048907 | Bacteria | 1431 |
| 195 | Ga0496108_0537754 | 3300048911 | Bacteria | 1020 |
| 196 | Ga0496109_0165281 | 3300048912 | Bacteria | 2074 |
| 197 | Ga0496110_0030447 | 3300048913 | Bacteria | 4653 |
| 198 | Ga0496112_0514404 | 3300048915 | Bacteria | 1132 |
| 199 | Ga0496114_0118811 | 3300048917 | Bacteria | 2272 |
| 200 | Ga0496114_0345225 | 3300048917 | Bacteria | 1316 |
| 201 | Ga0496126_0510725 | 3300048929 | Bacteria | 959 |
| 202 | Ga0501032_0090574 | 3300049569 | Bacteria | 2030 |
| 203 | Ga0501036_0078208 | 3300049572 | Bacteria | 2798 |
| 204 | Ga0501038_0155627 | 3300049574 | Bacteria | 1861 |
| 205 | Ga0501040_0088125 | 3300049576 | Bacteria | 2155 |
| 206 | Ga0501040_0158236 | 3300049576 | Bacteria | 1600 |
| 207 | Ga0501042_0078501 | 3300049578 | Bacteria | 2364 |
| 208 | Ga0501043_0311665 | 3300049579 | Bacteria | 1201 |
| 209 | Ga0501048_0071400 | 3300049582 | Bacteria | 2451 |
| 210 | Ga0501067_0045944 | 3300049583 | Bacteria | 2423 |
| 211 | Ga0501069_0009109 | 3300049585 | Bacteria | 5238 |
| 212 | Ga0501070_0347479 | 3300049586 | Bacteria | 1204 |
| 213 | Ga0501072_0349867 | 3300049588 | Bacteria | 1173 |
| 214 | Ga0501072_0510149 | 3300049588 | Bacteria | 951 |
| 215 | Ga0501073_0245803 | 3300049589 | Bacteria | 1235 |
| 216 | Ga0501074_0120054 | 3300049590 | Bacteria | 1880 |
| 217 | Ga0501075_0051238 | 3300049591 | Bacteria | 3104 |
| 218 | Ga0501076_0069944 | 3300049592 | Bacteria | 2805 |
| 219 | Ga0501077_0084721 | 3300049593 | Bacteria | 2009 |
| 220 | Ga0501079_0314101 | 3300049741 | Bacteria | 1226 |
| 221 | Ga0501080_0171635 | 3300049742 | Bacteria | 2000 |
| 222 | Ga0501081_0123565 | 3300049743 | Bacteria | 1846 |
| 223 | Ga0501083_0213768 | 3300049744 | Bacteria | 1257 |
| 224 | Ga0501035_0214677 | 3300049822 | Bacteria | 1645 |
| 225 | Ga0501044_0177325 | 3300049823 | Bacteria | 2100 |
| 226 | nmdc:mga04h51_169607_c1 | 3300050495 | Bacteria | 844 |
| 227 | nmdc:mga05p37_130461_c1 | 3300050507 | Bacteria | 3084 |
| 228 | nmdc:mga05p37_180826_c1 | 3300050507 | Bacteria | 2565 |
| 229 | nmdc:mga05p37_221944_c1 | 3300050507 | Bacteria | 2280 |
| 230 | nmdc:mga05p37_240_c1 | 3300050507 | Bacteria | 56075 |
| 231 | nmdc:mga05p37_39687_c1 | 3300050507 | Bacteria | 5780 |
| 232 | nmdc:mga09592_14_c1 | 3300050508 | Bacteria | 66825 |
| 233 | nmdc:mga09592_312988_c1 | 3300050508 | Bacteria | 1360 |
| 234 | nmdc:mga09592_323611_c1 | 3300050508 | Bacteria | 1336 |
| 235 | nmdc:mga09592_396688_c1 | 3300050508 | Bacteria | 1193 |
| 236 | nmdc:mga09592_54993_c1 | 3300050508 | Bacteria | 3363 |
| 237 | nmdc:mga0qj67_102110_c1 | 3300050509 | Bacteria | 2312 |
| 238 | nmdc:mga0qj67_25762_c1 | 3300050509 | Bacteria | 4548 |
| 239 | nmdc:mga0qj67_305725_c1 | 3300050509 | Bacteria | 1288 |
| 240 | nmdc:mga0qj67_54_c3 | 3300050509 | Bacteria | 38260 |
| 241 | nmdc:mga06r32_10383_c1 | 3300050510 | Bacteria | 8401 |
| 242 | nmdc:mga06r32_18_c3 | 3300050510 | Bacteria | 53938 |
| 243 | nmdc:mga06r32_2440_c1 | 3300050510 | Bacteria | 16631 |
| 244 | nmdc:mga06r32_608565_c1 | 3300050510 | Bacteria | 1063 |
| 245 | nmdc:mga06r32_83457_c1 | 3300050510 | Bacteria | 3113 |
| 246 | nmdc:mga08y16_29532_c1 | 3300050511 | Bacteria | 5775 |
| 247 | Ga0500559_0000286 | 3300053136 | Bacteria | 39086 |
| 248 | Ga0500559_0042172 | 3300053136 | Unclassified | 1990 |
| 249 | Ga0501084_0298968 | 3300054114 | Bacteria | 1359 |
| 250 | Ga0501082_0204460 | 3300060353 | Bacteria | 1718 |
| 251 | Ga0530510_0045662 | 3300061734 | Bacteria | 3165 |
| 252 | Ga0530510_0165727 | 3300061734 | Bacteria | 1635 |
| 253 | Ga0530510_0529705 | 3300061734 | Bacteria | 894 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044765 | Ga0466970_0173237 | Ga0466970_0173237_24_761 | 216 |
| 2 | 3300025917 | Ga0207660_10176519 | Ga0207660_101765192 | 219 |
| 3 | 3300025919 | Ga0207657_10077522 | Ga0207657_100775222 | 219 |
| 4 | 3300025920 | Ga0207649_10027940 | Ga0207649_100279402 | 219 |
| 5 | 3300025925 | Ga0207650_10063779 | Ga0207650_100637792 | 219 |
| 6 | 3300025926 | Ga0207659_10006498 | Ga0207659_100064984 | 219 |
| 7 | 3300025932 | Ga0207690_10040932 | Ga0207690_100409324 | 219 |
| 8 | 3300025933 | Ga0207706_10031074 | Ga0207706_100310744 | 219 |
| 9 | 3300025938 | Ga0207704_10035208 | Ga0207704_100352082 | 219 |
| 10 | 3300025942 | Ga0207689_10007601 | Ga0207689_100076015 | 219 |
| 11 | 3300025944 | Ga0207661_10163714 | Ga0207661_101637142 | 219 |
| 12 | 3300025945 | Ga0207679_10062081 | Ga0207679_100620813 | 219 |
| 13 | 3300026023 | Ga0207677_10013479 | Ga0207677_100134792 | 219 |
| 14 | 3300026035 | Ga0207703_10178276 | Ga0207703_101782761 | 219 |
| 15 | 3300026067 | Ga0207678_10017274 | Ga0207678_100172742 | 219 |
| 16 | 3300026075 | Ga0207708_10002097 | Ga0207708_100020978 | 219 |
| 17 | 3300026116 | Ga0207674_10004379 | Ga0207674_1000437913 | 219 |
| 18 | 3300026118 | Ga0207675_100033025 | Ga0207675_1000330255 | 219 |
| 19 | 3300026142 | Ga0207698_10098633 | Ga0207698_100986333 | 219 |
| 20 | 3300027907 | Ga0207428_10014920 | Ga0207428_100149205 | 219 |
| 21 | 3300050511 | nmdc:mga08y16_29532_c1 | nmdc:mga08y16_29532_c1_1510_2226 | 219 |
| 22 | iso_pu_bacteria | 8056054917 | 8056054990 | 219 |
| 23 | 3300006028 | Ga0070717_10178505 | Ga0070717_101785052 | 220 |
| 24 | 3300006844 | Ga0075428_100496029 | Ga0075428_1004960292 | 220 |
| 25 | 3300009147 | Ga0114129_10322858 | Ga0114129_103228582 | 222 |
| 26 | 3300031731 | Ga0307405_10096420 | Ga0307405_100964202 | 222 |
| 27 | 3300032126 | Ga0307415_100001663 | Ga0307415_1000016638 | 222 |
| 28 | 3300050495 | nmdc:mga04h51_169607_c1 | nmdc:mga04h51_169607_c1_61_828 | 222 |
| 29 | 3300050508 | nmdc:mga09592_312988_c1 | nmdc:mga09592_312988_c1_480_1196 | 222 |
| 30 | 3300030731 | Ga0316177_1180807 | Ga0316177_11808072 | 223 |
| 31 | 3300031456 | Ga0307513_10000001 | Ga0307513_100000011252 | 223 |
| 32 | 3300041411 | Ga0439466_0025154 | Ga0439466_0025154_479_1183 | 223 |
| 33 | 3300005340 | Ga0070689_100122465 | Ga0070689_1001224652 | 224 |
| 34 | 3300005564 | Ga0070664_100122223 | Ga0070664_1001222232 | 224 |
| 35 | 3300025945 | Ga0207679_10169735 | Ga0207679_101697352 | 224 |
| 36 | 3300031616 | Ga0307508_10064754 | Ga0307508_100647544 | 226 |
| 37 | 3300036712 | Ga0316584_0010630 | Ga0316584_0010630_910_1611 | 226 |
| 38 | 3300045976 | Ga0466967_0039426 | Ga0466967_0039426_3232_3921 | 226 |
| 39 | 3300005331 | Ga0070670_100349245 | Ga0070670_1003492452 | 227 |
| 40 | 3300005577 | Ga0068857_100332270 | Ga0068857_1003322702 | 227 |
| 41 | 3300009147 | Ga0114129_10000004 | Ga0114129_10000004132 | 227 |
| 42 | 3300009147 | Ga0114129_10250565 | Ga0114129_102505652 | 227 |
| 43 | 3300046616 | Ga0495668_0000644 | Ga0495668_0000644_35730_36491 | 227 |
| 44 | 3300046660 | Ga0495625_0000908 | Ga0495625_0000908_15461_16222 | 227 |
| 45 | 3300047323 | Ga0495683_0039783 | Ga0495683_0039783_701_1462 | 227 |
| 46 | 3300048091 | Ga0495626_0000689 | Ga0495626_0000689_15865_16626 | 227 |
| 47 | 3300048911 | Ga0496108_0537754 | Ga0496108_0537754_297_983 | 227 |
| 48 | 3300050507 | nmdc:mga05p37_39687_c1 | nmdc:mga05p37_39687_c1_4887_5573 | 227 |
| 49 | iso_pu_bacteria | 2887478801 | 2887481084 | 227 |
| 50 | 3300006880 | Ga0075429_100007102 | Ga0075429_1000071024 | 228 |
| 51 | 3300009147 | Ga0114129_10097601 | Ga0114129_100976014 | 228 |
| 52 | 3300025961 | Ga0207712_10470905 | Ga0207712_104709052 | 228 |
| 53 | 3300048915 | Ga0496112_0514404 | Ga0496112_0514404_324_1010 | 228 |
| 54 | 3300049569 | Ga0501032_0090574 | Ga0501032_0090574_1057_1830 | 228 |
| 55 | 3300049572 | Ga0501036_0078208 | Ga0501036_0078208_1353_2126 | 228 |
| 56 | 3300049574 | Ga0501038_0155627 | Ga0501038_0155627_606_1379 | 228 |
| 57 | 3300049576 | Ga0501040_0158236 | Ga0501040_0158236_208_981 | 228 |
| 58 | 3300049578 | Ga0501042_0078501 | Ga0501042_0078501_1467_2240 | 228 |
| 59 | 3300049579 | Ga0501043_0311665 | Ga0501043_0311665_318_1091 | 228 |
| 60 | 3300049582 | Ga0501048_0071400 | Ga0501048_0071400_1057_1830 | 228 |
| 61 | 3300049583 | Ga0501067_0045944 | Ga0501067_0045944_439_1203 | 228 |
| 62 | 3300049585 | Ga0501069_0009109 | Ga0501069_0009109_558_1322 | 228 |
| 63 | 3300049586 | Ga0501070_0347479 | Ga0501070_0347479_340_1113 | 228 |
| 64 | 3300049588 | Ga0501072_0349867 | Ga0501072_0349867_235_1008 | 228 |
| 65 | 3300049589 | Ga0501073_0245803 | Ga0501073_0245803_321_1094 | 228 |
| 66 | 3300049590 | Ga0501074_0120054 | Ga0501074_0120054_363_1136 | 228 |
| 67 | 3300049591 | Ga0501075_0051238 | Ga0501075_0051238_883_1656 | 228 |
| 68 | 3300049592 | Ga0501076_0069944 | Ga0501076_0069944_1150_1923 | 228 |
| 69 | 3300049593 | Ga0501077_0084721 | Ga0501077_0084721_916_1689 | 228 |
| 70 | 3300049741 | Ga0501079_0314101 | Ga0501079_0314101_39_812 | 228 |
| 71 | 3300049742 | Ga0501080_0171635 | Ga0501080_0171635_998_1771 | 228 |
| 72 | 3300049743 | Ga0501081_0123565 | Ga0501081_0123565_503_1276 | 228 |
| 73 | 3300049744 | Ga0501083_0213768 | Ga0501083_0213768_352_1125 | 228 |
| 74 | 3300049822 | Ga0501035_0214677 | Ga0501035_0214677_667_1440 | 228 |
| 75 | 3300050507 | nmdc:mga05p37_130461_c1 | nmdc:mga05p37_130461_c1_2219_2911 | 228 |
| 76 | 3300050508 | nmdc:mga09592_54993_c1 | nmdc:mga09592_54993_c1_766_1458 | 228 |
| 77 | 3300054114 | Ga0501084_0298968 | Ga0501084_0298968_189_962 | 228 |
| 78 | 3300060353 | Ga0501082_0204460 | Ga0501082_0204460_395_1168 | 228 |
| 79 | 3300061734 | Ga0530510_0045662 | Ga0530510_0045662_2191_2955 | 228 |
| 80 | 3300006038 | Ga0075365_10068545 | Ga0075365_100685452 | 229 |
| 81 | 3300009147 | Ga0114129_10811390 | Ga0114129_108113901 | 229 |
| 82 | 3300009148 | Ga0105243_10296589 | Ga0105243_102965892 | 229 |
| 83 | 3300009553 | Ga0105249_10882337 | Ga0105249_108823371 | 229 |
| 84 | 3300044658 | Ga0466972_0161600 | Ga0466972_0161600_135_911 | 229 |
| 85 | 3300044842 | Ga0466957_0147303 | Ga0466957_0147303_676_1452 | 229 |
| 86 | 3300049576 | Ga0501040_0088125 | Ga0501040_0088125_575_1276 | 229 |
| 87 | 3300053136 | Ga0500559_0000286 | Ga0500559_0000286_30482_31189 | 229 |
| 88 | 3300061734 | Ga0530510_0165727 | Ga0530510_0165727_449_1150 | 229 |
| 89 | 3300005983 | Ga0081540_1002639 | Ga0081540_10026394 | 230 |
| 90 | 3300005983 | Ga0081540_1119865 | Ga0081540_11198652 | 230 |
| 91 | 3300026095 | Ga0207676_10087077 | Ga0207676_100870773 | 230 |
| 92 | 3300031727 | Ga0316576_10000350 | Ga0316576_1000035010 | 230 |
| 93 | 3300031733 | Ga0316577_10124327 | Ga0316577_101243272 | 230 |
| 94 | 3300032137 | Ga0316585_10044794 | Ga0316585_100447941 | 230 |
| 95 | 3300053136 | Ga0500559_0042172 | Ga0500559_0042172_1201_1974 | 230 |
| 96 | iso_pu_bacteria | 2675903059 | 2676483486 | 230 |
| 97 | iso_pu_bacteria | 8003856774 | 8003861249 | 230 |
| 98 | 3300005329 | Ga0070683_100009974 | Ga0070683_1000099745 | 231 |
| 99 | 3300005535 | Ga0070684_100012695 | Ga0070684_1000126954 | 231 |
| 100 | 3300005564 | Ga0070664_100054518 | Ga0070664_1000545182 | 231 |
| 101 | 3300009147 | Ga0114129_10029119 | Ga0114129_100291196 | 231 |
| 102 | 3300025944 | Ga0207661_10033246 | Ga0207661_100332463 | 231 |
| 103 | 3300025945 | Ga0207679_10064124 | Ga0207679_100641242 | 231 |
| 104 | 3300032126 | Ga0307415_100143054 | Ga0307415_1001430542 | 231 |
| 105 | 3300050508 | nmdc:mga09592_323611_c1 | nmdc:mga09592_323611_c1_383_1093 | 231 |
| 106 | 3300031665 | Ga0316575_10000262 | Ga0316575_100002623 | 232 |
| 107 | 3300032126 | Ga0307415_100244467 | Ga0307415_1002444671 | 232 |
| 108 | 3300048929 | Ga0496126_0510725 | Ga0496126_0510725_148_867 | 232 |
| 109 | 3300049588 | Ga0501072_0510149 | Ga0501072_0510149_99_878 | 232 |
| 110 | 3300049823 | Ga0501044_0177325 | Ga0501044_0177325_242_952 | 232 |
| 111 | 3300005327 | Ga0070658_10003585 | Ga0070658_100035858 | 233 |
| 112 | 3300005329 | Ga0070683_100109595 | Ga0070683_1001095953 | 233 |
| 113 | 3300005337 | Ga0070682_100018082 | Ga0070682_1000180823 | 233 |
| 114 | 3300005339 | Ga0070660_100013862 | Ga0070660_1000138625 | 233 |
| 115 | 3300005344 | Ga0070661_100219305 | Ga0070661_1002193052 | 233 |
| 116 | 3300005345 | Ga0070692_10158078 | Ga0070692_101580782 | 233 |
| 117 | 3300005366 | Ga0070659_100206045 | Ga0070659_1002060452 | 233 |
| 118 | 3300005434 | Ga0070709_10189253 | Ga0070709_101892531 | 233 |
| 119 | 3300005436 | Ga0070713_100036596 | Ga0070713_1000365962 | 233 |
| 120 | 3300005530 | Ga0070679_100232589 | Ga0070679_1002325892 | 233 |
| 121 | 3300006028 | Ga0070717_10231791 | Ga0070717_102317912 | 233 |
| 122 | 3300006844 | Ga0075428_100000347 | Ga0075428_10000034725 | 233 |
| 123 | 3300006847 | Ga0075431_100019728 | Ga0075431_1000197284 | 233 |
| 124 | 3300010375 | Ga0105239_10583508 | Ga0105239_105835082 | 233 |
| 125 | 3300013105 | Ga0157369_10026100 | Ga0157369_100261002 | 233 |
| 126 | 3300014325 | Ga0163163_10518411 | Ga0163163_105184112 | 233 |
| 127 | 3300020081 | Ga0206354_10062880 | Ga0206354_100628802 | 233 |
| 128 | 3300025909 | Ga0207705_10009486 | Ga0207705_100094862 | 233 |
| 129 | 3300025912 | Ga0207707_10316729 | Ga0207707_103167292 | 233 |
| 130 | 3300025928 | Ga0207700_10021883 | Ga0207700_100218833 | 233 |
| 131 | 3300025932 | Ga0207690_10199756 | Ga0207690_101997562 | 233 |
| 132 | 3300025944 | Ga0207661_10221464 | Ga0207661_102214642 | 233 |
| 133 | 3300026116 | Ga0207674_10184559 | Ga0207674_101845593 | 233 |
| 134 | 3300026116 | Ga0207674_10501909 | Ga0207674_105019092 | 233 |
| 135 | 3300035171 | Ga0373946_0114648 | Ga0373946_0114648_296_1030 | 233 |
| 136 | 3300046675 | Ga0495657_0209878 | Ga0495657_0209878_254_988 | 233 |
| 137 | 3300048907 | Ga0496104_0333150 | Ga0496104_0333150_461_1177 | 233 |
| 138 | 3300048917 | Ga0496114_0345225 | Ga0496114_0345225_206_970 | 233 |
| 139 | 3300050509 | nmdc:mga0qj67_305725_c1 | nmdc:mga0qj67_305725_c1_120_836 | 233 |
| 140 | 3300050510 | nmdc:mga06r32_10383_c1 | nmdc:mga06r32_10383_c1_3368_4084 | 233 |
| 141 | 3300050510 | nmdc:mga06r32_608565_c1 | nmdc:mga06r32_608565_c1_24_749 | 233 |
| 142 | 3300005334 | Ga0068869_100208489 | Ga0068869_1002084892 | 234 |
| 143 | 3300005334 | Ga0068869_100546018 | Ga0068869_1005460181 | 234 |
| 144 | 3300005435 | Ga0070714_100946514 | Ga0070714_1009465141 | 234 |
| 145 | 3300005842 | Ga0068858_100555015 | Ga0068858_1005550151 | 234 |
| 146 | 3300006844 | Ga0075428_100000841 | Ga0075428_10000084132 | 234 |
| 147 | 3300006846 | Ga0075430_100002555 | Ga0075430_10000255512 | 234 |
| 148 | 3300006847 | Ga0075431_100006394 | Ga0075431_1000063946 | 234 |
| 149 | 3300006847 | Ga0075431_100655365 | Ga0075431_1006553652 | 234 |
| 150 | 3300006880 | Ga0075429_100009846 | Ga0075429_1000098467 | 234 |
| 151 | 3300009147 | Ga0114129_10000050 | Ga0114129_1000005086 | 234 |
| 152 | 3300025929 | Ga0207664_10711837 | Ga0207664_107118371 | 234 |
| 153 | 3300025935 | Ga0207709_10321125 | Ga0207709_103211251 | 234 |
| 154 | 3300026035 | Ga0207703_10409647 | Ga0207703_104096471 | 234 |
| 155 | 3300028380 | Ga0268265_11021229 | Ga0268265_110212291 | 234 |
| 156 | 3300050507 | nmdc:mga05p37_240_c1 | nmdc:mga05p37_240_c1_3142_3873 | 234 |
| 157 | 3300050508 | nmdc:mga09592_14_c1 | nmdc:mga09592_14_c1_48207_48938 | 234 |
| 158 | 3300050509 | nmdc:mga0qj67_54_c3 | nmdc:mga0qj67_54_c3_5127_5858 | 234 |
| 159 | 3300050510 | nmdc:mga06r32_18_c3 | nmdc:mga06r32_18_c3_5127_5858 | 234 |
| 160 | 3300005456 | Ga0070678_100218048 | Ga0070678_1002180482 | 235 |
| 161 | 3300006844 | Ga0075428_100058646 | Ga0075428_1000586462 | 235 |
| 162 | 3300006844 | Ga0075428_100166729 | Ga0075428_1001667293 | 235 |
| 163 | 3300006846 | Ga0075430_100007931 | Ga0075430_1000079315 | 235 |
| 164 | 3300006846 | Ga0075430_100074115 | Ga0075430_1000741154 | 235 |
| 165 | 3300006847 | Ga0075431_100047933 | Ga0075431_1000479334 | 235 |
| 166 | 3300006847 | Ga0075431_100089448 | Ga0075431_1000894482 | 235 |
| 167 | 3300006880 | Ga0075429_100122400 | Ga0075429_1001224002 | 235 |
| 168 | 3300009147 | Ga0114129_10426648 | Ga0114129_104266482 | 235 |
| 169 | 3300031548 | Ga0307408_100490787 | Ga0307408_1004907872 | 235 |
| 170 | 3300031852 | Ga0307410_10072901 | Ga0307410_100729012 | 235 |
| 171 | 3300031901 | Ga0307406_10037964 | Ga0307406_100379642 | 235 |
| 172 | 3300031901 | Ga0307406_10063697 | Ga0307406_100636972 | 235 |
| 173 | 3300031903 | Ga0307407_10015874 | Ga0307407_100158742 | 235 |
| 174 | 3300031911 | Ga0307412_10349107 | Ga0307412_103491072 | 235 |
| 175 | 3300031995 | Ga0307409_100001554 | Ga0307409_1000015545 | 235 |
| 176 | 3300032002 | Ga0307416_100001919 | Ga0307416_1000019192 | 235 |
| 177 | 3300032126 | Ga0307415_100000113 | Ga0307415_10000011329 | 235 |
| 178 | 3300047317 | Ga0495604_0406546 | Ga0495604_0406546_104_880 | 235 |
| 179 | 3300050507 | nmdc:mga05p37_221944_c1 | nmdc:mga05p37_221944_c1_143_865 | 235 |
| 180 | 3300050508 | nmdc:mga09592_396688_c1 | nmdc:mga09592_396688_c1_326_1060 | 235 |
| 181 | 3300050509 | nmdc:mga0qj67_25762_c1 | nmdc:mga0qj67_25762_c1_532_1266 | 235 |
| 182 | 3300050510 | nmdc:mga06r32_83457_c1 | nmdc:mga06r32_83457_c1_1276_2013 | 235 |
| 183 | 3300006844 | Ga0075428_100430396 | Ga0075428_1004303962 | 236 |
| 184 | 3300006844 | Ga0075428_100668101 | Ga0075428_1006681011 | 236 |
| 185 | 3300006847 | Ga0075431_100024136 | Ga0075431_1000241366 | 236 |
| 186 | 3300006880 | Ga0075429_100206755 | Ga0075429_1002067552 | 236 |
| 187 | 3300041406 | Ga0439439_0060841 | Ga0439439_0060841_163_960 | 236 |
| 188 | 3300041999 | Ga0439433_0014584 | Ga0439433_0014584_318_1115 | 236 |
| 189 | 3300048913 | Ga0496110_0030447 | Ga0496110_0030447_1901_2665 | 236 |
| 190 | 3300050507 | nmdc:mga05p37_180826_c1 | nmdc:mga05p37_180826_c1_1570_2307 | 236 |
| 191 | 3300050509 | nmdc:mga0qj67_102110_c1 | nmdc:mga0qj67_102110_c1_31_768 | 236 |
| 192 | 3300050510 | nmdc:mga06r32_2440_c1 | nmdc:mga06r32_2440_c1_4377_5114 | 236 |
| 193 | 3300020081 | Ga0206354_10204240 | Ga0206354_102042402 | 237 |
| 194 | 3300020610 | Ga0154015_1418370 | Ga0154015_14183701 | 237 |
| 195 | 3300032126 | Ga0307415_100074126 | Ga0307415_1000741262 | 237 |
| 196 | 3300045976 | Ga0466967_0390336 | Ga0466967_0390336_445_1167 | 237 |
| 197 | 3300061734 | Ga0530510_0529705 | Ga0530510_0529705_138_881 | 237 |
| 198 | 3300046511 | Ga0495608_0172080 | Ga0495608_0172080_579_1322 | 238 |
| 199 | 3300048917 | Ga0496114_0118811 | Ga0496114_0118811_288_1031 | 238 |
| 200 | iso_pu_bacteria | 3001889506 | 3001891266 | 239 |
| 201 | 3300044693 | Ga0466961_0063872 | Ga0466961_0063872_769_1512 | 241 |
| 202 | 3300031247 | Ga0265340_10001696 | Ga0265340_1000169613 | 242 |
| 203 | 3300048912 | Ga0496109_0165281 | Ga0496109_0165281_90_839 | 243 |
| 204 | 3300005366 | Ga0070659_100459900 | Ga0070659_1004599002 | 247 |
| 205 | 3300013102 | Ga0157371_10009080 | Ga0157371_100090802 | 247 |
| 206 | 3300025901 | Ga0207688_10091837 | Ga0207688_100918372 | 247 |
| 207 | 3300025932 | Ga0207690_10015737 | Ga0207690_100157372 | 247 |
| 208 | 3300044693 | Ga0466961_0020141 | Ga0466961_0020141_3344_4090 | 247 |
| 209 | 3300005330 | Ga0070690_100043266 | Ga0070690_1000432664 | 248 |
| 210 | 3300005338 | Ga0068868_100041701 | Ga0068868_1000417014 | 248 |
| 211 | 3300005366 | Ga0070659_100000197 | Ga0070659_10000019712 | 248 |
| 212 | 3300013105 | Ga0157369_10001205 | Ga0157369_1000120516 | 248 |
| 213 | 3300013105 | Ga0157369_10034948 | Ga0157369_100349483 | 248 |
| 214 | 3300020081 | Ga0206354_11719496 | Ga0206354_117194961 | 248 |
| 215 | 3300022467 | Ga0224712_10004574 | Ga0224712_100045743 | 248 |
| 216 | 3300025919 | Ga0207657_10228531 | Ga0207657_102285312 | 248 |
| 217 | 3300025932 | Ga0207690_10000114 | Ga0207690_1000011428 | 248 |
| 218 | 3300025934 | Ga0207686_10217376 | Ga0207686_102173762 | 248 |
| 219 | 3300026023 | Ga0207677_10039451 | Ga0207677_100394512 | 248 |
| 220 | 3300004799 | Ga0058863_11765523 | Ga0058863_117655231 | 249 |
| 221 | 3300005327 | Ga0070658_10029743 | Ga0070658_100297434 | 249 |
| 222 | 3300005336 | Ga0070680_100000052 | Ga0070680_10000005221 | 249 |
| 223 | 3300005336 | Ga0070680_100018572 | Ga0070680_1000185724 | 249 |
| 224 | 3300005339 | Ga0070660_100222343 | Ga0070660_1002223432 | 249 |
| 225 | 3300005458 | Ga0070681_10000004 | Ga0070681_1000000431 | 249 |
| 226 | 3300005458 | Ga0070681_10029718 | Ga0070681_100297181 | 249 |
| 227 | 3300005530 | Ga0070679_100031072 | Ga0070679_1000310724 | 249 |
| 228 | 3300005530 | Ga0070679_100032574 | Ga0070679_1000325741 | 249 |
| 229 | 3300005530 | Ga0070679_100209259 | Ga0070679_1002092592 | 249 |
| 230 | 3300006358 | Ga0068871_100639124 | Ga0068871_1006391241 | 249 |
| 231 | 3300013105 | Ga0157369_10010017 | Ga0157369_100100171 | 249 |
| 232 | 3300013296 | Ga0157374_10486661 | Ga0157374_104866611 | 249 |
| 233 | 3300013307 | Ga0157372_10080581 | Ga0157372_100805812 | 249 |
| 234 | 3300020070 | Ga0206356_11681511 | Ga0206356_116815111 | 249 |
| 235 | 3300020077 | Ga0206351_10213804 | Ga0206351_102138041 | 249 |
| 236 | 3300020077 | Ga0206351_10691225 | Ga0206351_106912251 | 249 |
| 237 | 3300020082 | Ga0206353_11769543 | Ga0206353_117695432 | 249 |
| 238 | 3300020610 | Ga0154015_1459263 | Ga0154015_14592632 | 249 |
| 239 | 3300022467 | Ga0224712_10163091 | Ga0224712_101630911 | 249 |
| 240 | 3300025909 | Ga0207705_10017741 | Ga0207705_100177415 | 249 |
| 241 | 3300025909 | Ga0207705_10051983 | Ga0207705_100519834 | 249 |
| 242 | 3300025912 | Ga0207707_10000264 | Ga0207707_1000026430 | 249 |
| 243 | 3300025912 | Ga0207707_10020182 | Ga0207707_100201826 | 249 |
| 244 | 3300025913 | Ga0207695_10279123 | Ga0207695_102791231 | 249 |
| 245 | 3300025917 | Ga0207660_10000139 | Ga0207660_1000013917 | 249 |
| 246 | 3300025917 | Ga0207660_10061886 | Ga0207660_100618863 | 249 |
| 247 | 3300025919 | Ga0207657_10212545 | Ga0207657_102125452 | 249 |
| 248 | 3300025921 | Ga0207652_10080862 | Ga0207652_100808622 | 249 |
| 249 | 3300025921 | Ga0207652_10248271 | Ga0207652_102482711 | 249 |
| 250 | 3300025949 | Ga0207667_10092219 | Ga0207667_100922192 | 249 |
| 251 | 3300037312 | Ga0395899_0281541 | Ga0395899_0281541_363_1115 | 249 |
| 252 | 3300037418 | Ga0395900_0019557 | Ga0395900_0019557_3658_4410 | 249 |
| 253 | 3300038443 | Ga0395901_0064209 | Ga0395901_0064209_2279_3031 | 249 |
| 254 | 3300044684 | Ga0466966_0047654 | Ga0466966_0047654_1432_2184 | 249 |
| 255 | 3300044693 | Ga0466961_0001181 | Ga0466961_0001181_14689_15441 | 249 |
| 256 | 3300044693 | Ga0466961_0112291 | Ga0466961_0112291_347_1099 | 249 |
| 257 | 3300045049 | Ga0466959_0276860 | Ga0466959_0276860_201_953 | 249 |
| 258 | 3300045836 | Ga0466958_0013114 | Ga0466958_0013114_2550_3302 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5kym-assembly1.cif.gz_A | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.6855 | 2 | 204 |
| 1iuq-assembly1.cif.gz_A | the 1.55 a crystal structure of glycerol-3-phosphate acyltransferase | 0.66 | 2 | 207 |
| 1k30-assembly1.cif.gz_A | crystal structure analysis of squash (cucurbita moschata) glycerol-3-phosphate (1)-acyltransferase | 0.6542 | 2 | 206 |
| 8e50-assembly1.cif.gz_A | cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa | 0.6523 | 2 | 202 |
| 5kym-assembly2.cif.gz_B | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.6515 | 2 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53516_20_152_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9587 | 20 | 150 | 3.40.50.2000 |
| af_O53516_20_152_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9379 | 20 | 150 | 3.40.50.2000 |
| af_O07809_23_150_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8236 | 24 | 150 | 3.40.50.2000 |
| af_Q2FXJ7_19_144_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8182 | 22 | 150 | 3.40.50.2000 |
| af_Q8GXU8_180_307_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.7999 | 24 | 150 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1C6VPK0-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9724 | 1 | 221 |
GO:0003841
GO:0005886 GO:0006654 |
| AF-A0A6J7NWP6-F1-model_v4 | Unannotated protein | 0.9723 | 2 | 231 |
GO:0003841
GO:0005886 GO:0006654 |
| AF-A0A2T0XX56-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9723 | 1 | 227 |
GO:0003841
GO:0005886 GO:0006654 |
| AF-A0A5C7P7K2-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9717 | 1 | 223 |
GO:0003841
GO:0005886 GO:0006654 |
| AF-A0A839RRA9-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51) | 0.9703 | 1 | 234 |
GO:0003841
GO:0005886 GO:0006654 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar