F368191

General Info

Members Datasets Scaffolds Average Seq Length
258 163 253 239

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10000350|Ga0316576_1000035010
Length 237
Sequence VLYWMFKYILLGPWLRLLYRPQVEGLENIPDEGPAILASNHLSFSDSIFLPLVCKRHITFLAKAEYFTGKGIKGWLTKAFMKGVGQVPIDRSGGADAALNTALRVLGEDELLGIYPEGTRSPDGRLYRGKTGVARMALEAGVPVIPVAMIGTREIQPAGQKIPNVRRVGIKIGQPLDFSRYEGMENDRFVLRSMADEIMYELMELSGQEYVDLYASRAKEVIAEGESVQAAATAQVV

Samples

Sample ID Description Type Environment
1 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
2 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
3 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
106 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
107 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
122 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
162 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
163 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.41
Metatranscriptomes 4.65
Isolates 1.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 2.71
Rhizosphere 93.8
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11765523 3300004799 Bacteria 1037
2 Ga0070658_10003585 3300005327 Bacteria 12729
3 Ga0070658_10029743 3300005327 Bacteria 4389
4 Ga0070683_100009974 3300005329 Bacteria 8145
5 Ga0070683_100109595 3300005329 Bacteria 2604
6 Ga0070690_100043266 3300005330 Bacteria 2856
7 Ga0070670_100349245 3300005331 Bacteria 1299
8 Ga0068869_100208489 3300005334 Bacteria 1544
9 Ga0068869_100546018 3300005334 Bacteria 973
10 Ga0070680_100000052 3300005336 Bacteria 59665
11 Ga0070680_100018572 3300005336 Bacteria 5496
12 Ga0070682_100018082 3300005337 Bacteria 4115
13 Ga0068868_100041701 3300005338 Bacteria 3577
14 Ga0070660_100013862 3300005339 Bacteria 5799
15 Ga0070660_100222343 3300005339 Bacteria 1535
16 Ga0070689_100122465 3300005340 Bacteria 2078
17 Ga0070661_100219305 3300005344 Bacteria 1459
18 Ga0070692_10158078 3300005345 Bacteria 1296
19 Ga0070659_100000197 3300005366 Bacteria 46446
20 Ga0070659_100206045 3300005366 Bacteria 1620
21 Ga0070659_100459900 3300005366 Bacteria 1080
22 Ga0070709_10189253 3300005434 Bacteria 1451
23 Ga0070714_100946514 3300005435 Bacteria 837
24 Ga0070713_100036596 3300005436 Bacteria 3962
25 Ga0070678_100218048 3300005456 Bacteria 1585
26 Ga0070681_10000004 3300005458 Bacteria 205157
27 Ga0070681_10029718 3300005458 Bacteria 5487
28 Ga0070679_100031072 3300005530 Bacteria 5275
29 Ga0070679_100032574 3300005530 Bacteria 5157
30 Ga0070679_100209259 3300005530 Bacteria 1915
31 Ga0070679_100232589 3300005530 Bacteria 1802
32 Ga0070684_100012695 3300005535 Bacteria 6760
33 Ga0070664_100054518 3300005564 Bacteria 3392
34 Ga0070664_100122223 3300005564 Bacteria 2281
35 Ga0068857_100332270 3300005577 Bacteria 1405
36 Ga0068858_100555015 3300005842 Bacteria 1112
37 Ga0081540_1002639 3300005983 Bacteria 14576
38 Ga0081540_1119865 3300005983 Bacteria 1094
39 Ga0070717_10178505 3300006028 Bacteria 1850
40 Ga0070717_10231791 3300006028 Bacteria 1626
41 Ga0075365_10068545 3300006038 Bacteria 2383
42 Ga0068871_100639124 3300006358 Bacteria 971
43 Ga0075428_100000347 3300006844 Bacteria 45930
44 Ga0075428_100000841 3300006844 Bacteria 32161
45 Ga0075428_100058646 3300006844 Bacteria 4214
46 Ga0075428_100166729 3300006844 Bacteria 2389
47 Ga0075428_100430396 3300006844 Bacteria 1414
48 Ga0075428_100496029 3300006844 Bacteria 1307
49 Ga0075428_100668101 3300006844 Bacteria 1107
50 Ga0075430_100002555 3300006846 Bacteria 15186
51 Ga0075430_100007931 3300006846 Bacteria 8976
52 Ga0075430_100074115 3300006846 Bacteria 2854
53 Ga0075431_100006394 3300006847 Bacteria 11693
54 Ga0075431_100019728 3300006847 Bacteria 6881
55 Ga0075431_100024136 3300006847 Bacteria 6226
56 Ga0075431_100047933 3300006847 Bacteria 4406
57 Ga0075431_100089448 3300006847 Bacteria 3178
58 Ga0075431_100655365 3300006847 Bacteria 1030
59 Ga0075429_100007102 3300006880 Bacteria 9722
60 Ga0075429_100009846 3300006880 Bacteria 8287
61 Ga0075429_100122400 3300006880 Bacteria 2274
62 Ga0075429_100206755 3300006880 Bacteria 1720
63 Ga0114129_10000004 3300009147 Bacteria 160944
64 Ga0114129_10000050 3300009147 Bacteria 102066
65 Ga0114129_10029119 3300009147 Bacteria 7822
66 Ga0114129_10097601 3300009147 Bacteria 4067
67 Ga0114129_10250565 3300009147 Bacteria 2377
68 Ga0114129_10322858 3300009147 Bacteria 2052
69 Ga0114129_10426648 3300009147 Bacteria 1743
70 Ga0114129_10811390 3300009147 Bacteria 1193
71 Ga0105243_10296589 3300009148 Bacteria 1463
72 Ga0105249_10882337 3300009553 Bacteria 961
73 Ga0105239_10583508 3300010375 Bacteria 1274
74 Ga0157371_10009080 3300013102 Bacteria 7857
75 Ga0157369_10001205 3300013105 Bacteria 32229
76 Ga0157369_10010017 3300013105 Bacteria 10827
77 Ga0157369_10026100 3300013105 Bacteria 6481
78 Ga0157369_10034948 3300013105 Bacteria 5512
79 Ga0157374_10486661 3300013296 Bacteria 1237
80 Ga0157372_10080581 3300013307 Bacteria 3684
81 Ga0163163_10518411 3300014325 Bacteria 1254
82 Ga0206356_11681511 3300020070 Bacteria 1311
83 Ga0206351_10213804 3300020077 Bacteria 862
84 Ga0206351_10691225 3300020077 Bacteria 872
85 Ga0206354_10062880 3300020081 Bacteria 1702
86 Ga0206354_10204240 3300020081 Bacteria 1299
87 Ga0206354_11719496 3300020081 Bacteria 852
88 Ga0206353_11769543 3300020082 Bacteria 1578
89 Ga0154015_1418370 3300020610 Bacteria 1376
90 Ga0154015_1459263 3300020610 Bacteria 1196
91 Ga0224712_10004574 3300022467 Bacteria 3745
92 Ga0224712_10163091 3300022467 Bacteria 995
93 Ga0207688_10091837 3300025901 Bacteria 1744
94 Ga0207705_10009486 3300025909 Bacteria 7079
95 Ga0207705_10017741 3300025909 Bacteria 5091
96 Ga0207705_10051983 3300025909 Bacteria 2949
97 Ga0207707_10000264 3300025912 Bacteria 56589
98 Ga0207707_10020182 3300025912 Bacteria 5817
99 Ga0207707_10316729 3300025912 Bacteria 1347
100 Ga0207695_10279123 3300025913 Bacteria 1564
101 Ga0207660_10000139 3300025917 Bacteria 43716
102 Ga0207660_10061886 3300025917 Bacteria 2695
103 Ga0207660_10176519 3300025917 Bacteria 1657
104 Ga0207657_10077522 3300025919 Bacteria 2800
105 Ga0207657_10212545 3300025919 Bacteria 1552
106 Ga0207657_10228531 3300025919 Bacteria 1489
107 Ga0207649_10027940 3300025920 Bacteria 3317
108 Ga0207652_10080862 3300025921 Bacteria 2842
109 Ga0207652_10248271 3300025921 Bacteria 1605
110 Ga0207650_10063779 3300025925 Bacteria 2756
111 Ga0207659_10006498 3300025926 Bacteria 7165
112 Ga0207700_10021883 3300025928 Bacteria 4376
113 Ga0207664_10711837 3300025929 Bacteria 903
114 Ga0207690_10000114 3300025932 Bacteria 66039
115 Ga0207690_10015737 3300025932 Bacteria 4589
116 Ga0207690_10040932 3300025932 Bacteria 3033
117 Ga0207690_10199756 3300025932 Bacteria 1518
118 Ga0207706_10031074 3300025933 Bacteria 4759
119 Ga0207686_10217376 3300025934 Bacteria 1378
120 Ga0207709_10321125 3300025935 Bacteria 1159
121 Ga0207704_10035208 3300025938 Bacteria 2867
122 Ga0207689_10007601 3300025942 Bacteria 9494
123 Ga0207661_10033246 3300025944 Bacteria 4001
124 Ga0207661_10163714 3300025944 Bacteria 1931
125 Ga0207661_10221464 3300025944 Bacteria 1672
126 Ga0207679_10062081 3300025945 Bacteria 2783
127 Ga0207679_10064124 3300025945 Bacteria 2745
128 Ga0207679_10169735 3300025945 Bacteria 1795
129 Ga0207667_10092219 3300025949 Bacteria 3129
130 Ga0207712_10470905 3300025961 Bacteria 1069
131 Ga0207677_10013479 3300026023 Bacteria 4740
132 Ga0207677_10039451 3300026023 Bacteria 3105
133 Ga0207703_10178276 3300026035 Bacteria 1874
134 Ga0207703_10409647 3300026035 Bacteria 1259
135 Ga0207678_10017274 3300026067 Bacteria 6334
136 Ga0207708_10002097 3300026075 Bacteria 14671
137 Ga0207676_10087077 3300026095 Bacteria 2554
138 Ga0207674_10004379 3300026116 Bacteria 17021
139 Ga0207674_10184559 3300026116 Bacteria 2036
140 Ga0207674_10501909 3300026116 Bacteria 1172
141 Ga0207675_100033025 3300026118 Bacteria 4822
142 Ga0207698_10098633 3300026142 Bacteria 2415
143 Ga0207428_10014920 3300027907 Bacteria 6731
144 Ga0268265_11021229 3300028380 Bacteria 818
145 Ga0316177_1180807 3300030731 Bacteria 1798
146 Ga0265340_10001696 3300031247 Bacteria 12650
147 Ga0307513_10000001 3300031456 Bacteria 1660464
148 Ga0307408_100490787 3300031548 Bacteria 1073
149 Ga0307508_10064754 3300031616 Bacteria 3222
150 Ga0316575_10000262 3300031665 Bacteria 14418
151 Ga0316576_10000350 3300031727 Bacteria 20732
152 Ga0307405_10096420 3300031731 Bacteria 1972
153 Ga0316577_10124327 3300031733 Bacteria 1450
154 Ga0307410_10072901 3300031852 Bacteria 2386
155 Ga0307406_10037964 3300031901 Bacteria 2979
156 Ga0307406_10063697 3300031901 Bacteria 2389
157 Ga0307407_10015874 3300031903 Bacteria 3736
158 Ga0307412_10349107 3300031911 Bacteria 1187
159 Ga0307409_100001554 3300031995 Bacteria 11402
160 Ga0307416_100001919 3300032002 Bacteria 11605
161 Ga0307415_100000113 3300032126 Bacteria 34898
162 Ga0307415_100001663 3300032126 Bacteria 10793
163 Ga0307415_100074126 3300032126 Bacteria 2404
164 Ga0307415_100143054 3300032126 Bacteria 1830
165 Ga0307415_100244467 3300032126 Bacteria 1454
166 Ga0316585_10044794 3300032137 Bacteria 1414
167 Ga0373946_0114648 3300035171 Bacteria 1224
168 Ga0316584_0010630 3300036712 Bacteria 6441
169 Ga0395899_0281541 3300037312 Bacteria 1131
170 Ga0395900_0019557 3300037418 Bacteria 6904
171 Ga0395901_0064209 3300038443 Bacteria 3822
172 Ga0439439_0060841 3300041406 Bacteria 1002
173 Ga0439466_0025154 3300041411 Bacteria 2080
174 Ga0439433_0014584 3300041999 Bacteria 1731
175 Ga0466972_0161600 3300044658 Bacteria 1052
176 Ga0466966_0047654 3300044684 Bacteria 2732
177 Ga0466961_0001181 3300044693 Bacteria 16097
178 Ga0466961_0020141 3300044693 Bacteria 4294
179 Ga0466961_0063872 3300044693 Bacteria 2340
180 Ga0466961_0112291 3300044693 Bacteria 1714
181 Ga0466970_0173237 3300044765 Bacteria 1196
182 Ga0466957_0147303 3300044842 Bacteria 1520
183 Ga0466959_0276860 3300045049 Bacteria 1152
184 Ga0466958_0013114 3300045836 Bacteria 4712
185 Ga0466967_0039426 3300045976 Bacteria 4061
186 Ga0466967_0390336 3300045976 Bacteria 1353
187 Ga0495608_0172080 3300046511 Bacteria 1373
188 Ga0495668_0000644 3300046616 Bacteria 41961
189 Ga0495625_0000908 3300046660 Bacteria 39902
190 Ga0495657_0209878 3300046675 Bacteria 1184
191 Ga0495604_0406546 3300047317 Bacteria 896
192 Ga0495683_0039783 3300047323 Bacteria 2376
193 Ga0495626_0000689 3300048091 Bacteria 32325
194 Ga0496104_0333150 3300048907 Bacteria 1431
195 Ga0496108_0537754 3300048911 Bacteria 1020
196 Ga0496109_0165281 3300048912 Bacteria 2074
197 Ga0496110_0030447 3300048913 Bacteria 4653
198 Ga0496112_0514404 3300048915 Bacteria 1132
199 Ga0496114_0118811 3300048917 Bacteria 2272
200 Ga0496114_0345225 3300048917 Bacteria 1316
201 Ga0496126_0510725 3300048929 Bacteria 959
202 Ga0501032_0090574 3300049569 Bacteria 2030
203 Ga0501036_0078208 3300049572 Bacteria 2798
204 Ga0501038_0155627 3300049574 Bacteria 1861
205 Ga0501040_0088125 3300049576 Bacteria 2155
206 Ga0501040_0158236 3300049576 Bacteria 1600
207 Ga0501042_0078501 3300049578 Bacteria 2364
208 Ga0501043_0311665 3300049579 Bacteria 1201
209 Ga0501048_0071400 3300049582 Bacteria 2451
210 Ga0501067_0045944 3300049583 Bacteria 2423
211 Ga0501069_0009109 3300049585 Bacteria 5238
212 Ga0501070_0347479 3300049586 Bacteria 1204
213 Ga0501072_0349867 3300049588 Bacteria 1173
214 Ga0501072_0510149 3300049588 Bacteria 951
215 Ga0501073_0245803 3300049589 Bacteria 1235
216 Ga0501074_0120054 3300049590 Bacteria 1880
217 Ga0501075_0051238 3300049591 Bacteria 3104
218 Ga0501076_0069944 3300049592 Bacteria 2805
219 Ga0501077_0084721 3300049593 Bacteria 2009
220 Ga0501079_0314101 3300049741 Bacteria 1226
221 Ga0501080_0171635 3300049742 Bacteria 2000
222 Ga0501081_0123565 3300049743 Bacteria 1846
223 Ga0501083_0213768 3300049744 Bacteria 1257
224 Ga0501035_0214677 3300049822 Bacteria 1645
225 Ga0501044_0177325 3300049823 Bacteria 2100
226 nmdc:mga04h51_169607_c1 3300050495 Bacteria 844
227 nmdc:mga05p37_130461_c1 3300050507 Bacteria 3084
228 nmdc:mga05p37_180826_c1 3300050507 Bacteria 2565
229 nmdc:mga05p37_221944_c1 3300050507 Bacteria 2280
230 nmdc:mga05p37_240_c1 3300050507 Bacteria 56075
231 nmdc:mga05p37_39687_c1 3300050507 Bacteria 5780
232 nmdc:mga09592_14_c1 3300050508 Bacteria 66825
233 nmdc:mga09592_312988_c1 3300050508 Bacteria 1360
234 nmdc:mga09592_323611_c1 3300050508 Bacteria 1336
235 nmdc:mga09592_396688_c1 3300050508 Bacteria 1193
236 nmdc:mga09592_54993_c1 3300050508 Bacteria 3363
237 nmdc:mga0qj67_102110_c1 3300050509 Bacteria 2312
238 nmdc:mga0qj67_25762_c1 3300050509 Bacteria 4548
239 nmdc:mga0qj67_305725_c1 3300050509 Bacteria 1288
240 nmdc:mga0qj67_54_c3 3300050509 Bacteria 38260
241 nmdc:mga06r32_10383_c1 3300050510 Bacteria 8401
242 nmdc:mga06r32_18_c3 3300050510 Bacteria 53938
243 nmdc:mga06r32_2440_c1 3300050510 Bacteria 16631
244 nmdc:mga06r32_608565_c1 3300050510 Bacteria 1063
245 nmdc:mga06r32_83457_c1 3300050510 Bacteria 3113
246 nmdc:mga08y16_29532_c1 3300050511 Bacteria 5775
247 Ga0500559_0000286 3300053136 Bacteria 39086
248 Ga0500559_0042172 3300053136 Unclassified 1990
249 Ga0501084_0298968 3300054114 Bacteria 1359
250 Ga0501082_0204460 3300060353 Bacteria 1718
251 Ga0530510_0045662 3300061734 Bacteria 3165
252 Ga0530510_0165727 3300061734 Bacteria 1635
253 Ga0530510_0529705 3300061734 Bacteria 894

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0173237 Ga0466970_0173237_24_761 216
2 3300025917 Ga0207660_10176519 Ga0207660_101765192 219
3 3300025919 Ga0207657_10077522 Ga0207657_100775222 219
4 3300025920 Ga0207649_10027940 Ga0207649_100279402 219
5 3300025925 Ga0207650_10063779 Ga0207650_100637792 219
6 3300025926 Ga0207659_10006498 Ga0207659_100064984 219
7 3300025932 Ga0207690_10040932 Ga0207690_100409324 219
8 3300025933 Ga0207706_10031074 Ga0207706_100310744 219
9 3300025938 Ga0207704_10035208 Ga0207704_100352082 219
10 3300025942 Ga0207689_10007601 Ga0207689_100076015 219
11 3300025944 Ga0207661_10163714 Ga0207661_101637142 219
12 3300025945 Ga0207679_10062081 Ga0207679_100620813 219
13 3300026023 Ga0207677_10013479 Ga0207677_100134792 219
14 3300026035 Ga0207703_10178276 Ga0207703_101782761 219
15 3300026067 Ga0207678_10017274 Ga0207678_100172742 219
16 3300026075 Ga0207708_10002097 Ga0207708_100020978 219
17 3300026116 Ga0207674_10004379 Ga0207674_1000437913 219
18 3300026118 Ga0207675_100033025 Ga0207675_1000330255 219
19 3300026142 Ga0207698_10098633 Ga0207698_100986333 219
20 3300027907 Ga0207428_10014920 Ga0207428_100149205 219
21 3300050511 nmdc:mga08y16_29532_c1 nmdc:mga08y16_29532_c1_1510_2226 219
22 iso_pu_bacteria 8056054917 8056054990 219
23 3300006028 Ga0070717_10178505 Ga0070717_101785052 220
24 3300006844 Ga0075428_100496029 Ga0075428_1004960292 220
25 3300009147 Ga0114129_10322858 Ga0114129_103228582 222
26 3300031731 Ga0307405_10096420 Ga0307405_100964202 222
27 3300032126 Ga0307415_100001663 Ga0307415_1000016638 222
28 3300050495 nmdc:mga04h51_169607_c1 nmdc:mga04h51_169607_c1_61_828 222
29 3300050508 nmdc:mga09592_312988_c1 nmdc:mga09592_312988_c1_480_1196 222
30 3300030731 Ga0316177_1180807 Ga0316177_11808072 223
31 3300031456 Ga0307513_10000001 Ga0307513_100000011252 223
32 3300041411 Ga0439466_0025154 Ga0439466_0025154_479_1183 223
33 3300005340 Ga0070689_100122465 Ga0070689_1001224652 224
34 3300005564 Ga0070664_100122223 Ga0070664_1001222232 224
35 3300025945 Ga0207679_10169735 Ga0207679_101697352 224
36 3300031616 Ga0307508_10064754 Ga0307508_100647544 226
37 3300036712 Ga0316584_0010630 Ga0316584_0010630_910_1611 226
38 3300045976 Ga0466967_0039426 Ga0466967_0039426_3232_3921 226
39 3300005331 Ga0070670_100349245 Ga0070670_1003492452 227
40 3300005577 Ga0068857_100332270 Ga0068857_1003322702 227
41 3300009147 Ga0114129_10000004 Ga0114129_10000004132 227
42 3300009147 Ga0114129_10250565 Ga0114129_102505652 227
43 3300046616 Ga0495668_0000644 Ga0495668_0000644_35730_36491 227
44 3300046660 Ga0495625_0000908 Ga0495625_0000908_15461_16222 227
45 3300047323 Ga0495683_0039783 Ga0495683_0039783_701_1462 227
46 3300048091 Ga0495626_0000689 Ga0495626_0000689_15865_16626 227
47 3300048911 Ga0496108_0537754 Ga0496108_0537754_297_983 227
48 3300050507 nmdc:mga05p37_39687_c1 nmdc:mga05p37_39687_c1_4887_5573 227
49 iso_pu_bacteria 2887478801 2887481084 227
50 3300006880 Ga0075429_100007102 Ga0075429_1000071024 228
51 3300009147 Ga0114129_10097601 Ga0114129_100976014 228
52 3300025961 Ga0207712_10470905 Ga0207712_104709052 228
53 3300048915 Ga0496112_0514404 Ga0496112_0514404_324_1010 228
54 3300049569 Ga0501032_0090574 Ga0501032_0090574_1057_1830 228
55 3300049572 Ga0501036_0078208 Ga0501036_0078208_1353_2126 228
56 3300049574 Ga0501038_0155627 Ga0501038_0155627_606_1379 228
57 3300049576 Ga0501040_0158236 Ga0501040_0158236_208_981 228
58 3300049578 Ga0501042_0078501 Ga0501042_0078501_1467_2240 228
59 3300049579 Ga0501043_0311665 Ga0501043_0311665_318_1091 228
60 3300049582 Ga0501048_0071400 Ga0501048_0071400_1057_1830 228
61 3300049583 Ga0501067_0045944 Ga0501067_0045944_439_1203 228
62 3300049585 Ga0501069_0009109 Ga0501069_0009109_558_1322 228
63 3300049586 Ga0501070_0347479 Ga0501070_0347479_340_1113 228
64 3300049588 Ga0501072_0349867 Ga0501072_0349867_235_1008 228
65 3300049589 Ga0501073_0245803 Ga0501073_0245803_321_1094 228
66 3300049590 Ga0501074_0120054 Ga0501074_0120054_363_1136 228
67 3300049591 Ga0501075_0051238 Ga0501075_0051238_883_1656 228
68 3300049592 Ga0501076_0069944 Ga0501076_0069944_1150_1923 228
69 3300049593 Ga0501077_0084721 Ga0501077_0084721_916_1689 228
70 3300049741 Ga0501079_0314101 Ga0501079_0314101_39_812 228
71 3300049742 Ga0501080_0171635 Ga0501080_0171635_998_1771 228
72 3300049743 Ga0501081_0123565 Ga0501081_0123565_503_1276 228
73 3300049744 Ga0501083_0213768 Ga0501083_0213768_352_1125 228
74 3300049822 Ga0501035_0214677 Ga0501035_0214677_667_1440 228
75 3300050507 nmdc:mga05p37_130461_c1 nmdc:mga05p37_130461_c1_2219_2911 228
76 3300050508 nmdc:mga09592_54993_c1 nmdc:mga09592_54993_c1_766_1458 228
77 3300054114 Ga0501084_0298968 Ga0501084_0298968_189_962 228
78 3300060353 Ga0501082_0204460 Ga0501082_0204460_395_1168 228
79 3300061734 Ga0530510_0045662 Ga0530510_0045662_2191_2955 228
80 3300006038 Ga0075365_10068545 Ga0075365_100685452 229
81 3300009147 Ga0114129_10811390 Ga0114129_108113901 229
82 3300009148 Ga0105243_10296589 Ga0105243_102965892 229
83 3300009553 Ga0105249_10882337 Ga0105249_108823371 229
84 3300044658 Ga0466972_0161600 Ga0466972_0161600_135_911 229
85 3300044842 Ga0466957_0147303 Ga0466957_0147303_676_1452 229
86 3300049576 Ga0501040_0088125 Ga0501040_0088125_575_1276 229
87 3300053136 Ga0500559_0000286 Ga0500559_0000286_30482_31189 229
88 3300061734 Ga0530510_0165727 Ga0530510_0165727_449_1150 229
89 3300005983 Ga0081540_1002639 Ga0081540_10026394 230
90 3300005983 Ga0081540_1119865 Ga0081540_11198652 230
91 3300026095 Ga0207676_10087077 Ga0207676_100870773 230
92 3300031727 Ga0316576_10000350 Ga0316576_1000035010 230
93 3300031733 Ga0316577_10124327 Ga0316577_101243272 230
94 3300032137 Ga0316585_10044794 Ga0316585_100447941 230
95 3300053136 Ga0500559_0042172 Ga0500559_0042172_1201_1974 230
96 iso_pu_bacteria 2675903059 2676483486 230
97 iso_pu_bacteria 8003856774 8003861249 230
98 3300005329 Ga0070683_100009974 Ga0070683_1000099745 231
99 3300005535 Ga0070684_100012695 Ga0070684_1000126954 231
100 3300005564 Ga0070664_100054518 Ga0070664_1000545182 231
101 3300009147 Ga0114129_10029119 Ga0114129_100291196 231
102 3300025944 Ga0207661_10033246 Ga0207661_100332463 231
103 3300025945 Ga0207679_10064124 Ga0207679_100641242 231
104 3300032126 Ga0307415_100143054 Ga0307415_1001430542 231
105 3300050508 nmdc:mga09592_323611_c1 nmdc:mga09592_323611_c1_383_1093 231
106 3300031665 Ga0316575_10000262 Ga0316575_100002623 232
107 3300032126 Ga0307415_100244467 Ga0307415_1002444671 232
108 3300048929 Ga0496126_0510725 Ga0496126_0510725_148_867 232
109 3300049588 Ga0501072_0510149 Ga0501072_0510149_99_878 232
110 3300049823 Ga0501044_0177325 Ga0501044_0177325_242_952 232
111 3300005327 Ga0070658_10003585 Ga0070658_100035858 233
112 3300005329 Ga0070683_100109595 Ga0070683_1001095953 233
113 3300005337 Ga0070682_100018082 Ga0070682_1000180823 233
114 3300005339 Ga0070660_100013862 Ga0070660_1000138625 233
115 3300005344 Ga0070661_100219305 Ga0070661_1002193052 233
116 3300005345 Ga0070692_10158078 Ga0070692_101580782 233
117 3300005366 Ga0070659_100206045 Ga0070659_1002060452 233
118 3300005434 Ga0070709_10189253 Ga0070709_101892531 233
119 3300005436 Ga0070713_100036596 Ga0070713_1000365962 233
120 3300005530 Ga0070679_100232589 Ga0070679_1002325892 233
121 3300006028 Ga0070717_10231791 Ga0070717_102317912 233
122 3300006844 Ga0075428_100000347 Ga0075428_10000034725 233
123 3300006847 Ga0075431_100019728 Ga0075431_1000197284 233
124 3300010375 Ga0105239_10583508 Ga0105239_105835082 233
125 3300013105 Ga0157369_10026100 Ga0157369_100261002 233
126 3300014325 Ga0163163_10518411 Ga0163163_105184112 233
127 3300020081 Ga0206354_10062880 Ga0206354_100628802 233
128 3300025909 Ga0207705_10009486 Ga0207705_100094862 233
129 3300025912 Ga0207707_10316729 Ga0207707_103167292 233
130 3300025928 Ga0207700_10021883 Ga0207700_100218833 233
131 3300025932 Ga0207690_10199756 Ga0207690_101997562 233
132 3300025944 Ga0207661_10221464 Ga0207661_102214642 233
133 3300026116 Ga0207674_10184559 Ga0207674_101845593 233
134 3300026116 Ga0207674_10501909 Ga0207674_105019092 233
135 3300035171 Ga0373946_0114648 Ga0373946_0114648_296_1030 233
136 3300046675 Ga0495657_0209878 Ga0495657_0209878_254_988 233
137 3300048907 Ga0496104_0333150 Ga0496104_0333150_461_1177 233
138 3300048917 Ga0496114_0345225 Ga0496114_0345225_206_970 233
139 3300050509 nmdc:mga0qj67_305725_c1 nmdc:mga0qj67_305725_c1_120_836 233
140 3300050510 nmdc:mga06r32_10383_c1 nmdc:mga06r32_10383_c1_3368_4084 233
141 3300050510 nmdc:mga06r32_608565_c1 nmdc:mga06r32_608565_c1_24_749 233
142 3300005334 Ga0068869_100208489 Ga0068869_1002084892 234
143 3300005334 Ga0068869_100546018 Ga0068869_1005460181 234
144 3300005435 Ga0070714_100946514 Ga0070714_1009465141 234
145 3300005842 Ga0068858_100555015 Ga0068858_1005550151 234
146 3300006844 Ga0075428_100000841 Ga0075428_10000084132 234
147 3300006846 Ga0075430_100002555 Ga0075430_10000255512 234
148 3300006847 Ga0075431_100006394 Ga0075431_1000063946 234
149 3300006847 Ga0075431_100655365 Ga0075431_1006553652 234
150 3300006880 Ga0075429_100009846 Ga0075429_1000098467 234
151 3300009147 Ga0114129_10000050 Ga0114129_1000005086 234
152 3300025929 Ga0207664_10711837 Ga0207664_107118371 234
153 3300025935 Ga0207709_10321125 Ga0207709_103211251 234
154 3300026035 Ga0207703_10409647 Ga0207703_104096471 234
155 3300028380 Ga0268265_11021229 Ga0268265_110212291 234
156 3300050507 nmdc:mga05p37_240_c1 nmdc:mga05p37_240_c1_3142_3873 234
157 3300050508 nmdc:mga09592_14_c1 nmdc:mga09592_14_c1_48207_48938 234
158 3300050509 nmdc:mga0qj67_54_c3 nmdc:mga0qj67_54_c3_5127_5858 234
159 3300050510 nmdc:mga06r32_18_c3 nmdc:mga06r32_18_c3_5127_5858 234
160 3300005456 Ga0070678_100218048 Ga0070678_1002180482 235
161 3300006844 Ga0075428_100058646 Ga0075428_1000586462 235
162 3300006844 Ga0075428_100166729 Ga0075428_1001667293 235
163 3300006846 Ga0075430_100007931 Ga0075430_1000079315 235
164 3300006846 Ga0075430_100074115 Ga0075430_1000741154 235
165 3300006847 Ga0075431_100047933 Ga0075431_1000479334 235
166 3300006847 Ga0075431_100089448 Ga0075431_1000894482 235
167 3300006880 Ga0075429_100122400 Ga0075429_1001224002 235
168 3300009147 Ga0114129_10426648 Ga0114129_104266482 235
169 3300031548 Ga0307408_100490787 Ga0307408_1004907872 235
170 3300031852 Ga0307410_10072901 Ga0307410_100729012 235
171 3300031901 Ga0307406_10037964 Ga0307406_100379642 235
172 3300031901 Ga0307406_10063697 Ga0307406_100636972 235
173 3300031903 Ga0307407_10015874 Ga0307407_100158742 235
174 3300031911 Ga0307412_10349107 Ga0307412_103491072 235
175 3300031995 Ga0307409_100001554 Ga0307409_1000015545 235
176 3300032002 Ga0307416_100001919 Ga0307416_1000019192 235
177 3300032126 Ga0307415_100000113 Ga0307415_10000011329 235
178 3300047317 Ga0495604_0406546 Ga0495604_0406546_104_880 235
179 3300050507 nmdc:mga05p37_221944_c1 nmdc:mga05p37_221944_c1_143_865 235
180 3300050508 nmdc:mga09592_396688_c1 nmdc:mga09592_396688_c1_326_1060 235
181 3300050509 nmdc:mga0qj67_25762_c1 nmdc:mga0qj67_25762_c1_532_1266 235
182 3300050510 nmdc:mga06r32_83457_c1 nmdc:mga06r32_83457_c1_1276_2013 235
183 3300006844 Ga0075428_100430396 Ga0075428_1004303962 236
184 3300006844 Ga0075428_100668101 Ga0075428_1006681011 236
185 3300006847 Ga0075431_100024136 Ga0075431_1000241366 236
186 3300006880 Ga0075429_100206755 Ga0075429_1002067552 236
187 3300041406 Ga0439439_0060841 Ga0439439_0060841_163_960 236
188 3300041999 Ga0439433_0014584 Ga0439433_0014584_318_1115 236
189 3300048913 Ga0496110_0030447 Ga0496110_0030447_1901_2665 236
190 3300050507 nmdc:mga05p37_180826_c1 nmdc:mga05p37_180826_c1_1570_2307 236
191 3300050509 nmdc:mga0qj67_102110_c1 nmdc:mga0qj67_102110_c1_31_768 236
192 3300050510 nmdc:mga06r32_2440_c1 nmdc:mga06r32_2440_c1_4377_5114 236
193 3300020081 Ga0206354_10204240 Ga0206354_102042402 237
194 3300020610 Ga0154015_1418370 Ga0154015_14183701 237
195 3300032126 Ga0307415_100074126 Ga0307415_1000741262 237
196 3300045976 Ga0466967_0390336 Ga0466967_0390336_445_1167 237
197 3300061734 Ga0530510_0529705 Ga0530510_0529705_138_881 237
198 3300046511 Ga0495608_0172080 Ga0495608_0172080_579_1322 238
199 3300048917 Ga0496114_0118811 Ga0496114_0118811_288_1031 238
200 iso_pu_bacteria 3001889506 3001891266 239
201 3300044693 Ga0466961_0063872 Ga0466961_0063872_769_1512 241
202 3300031247 Ga0265340_10001696 Ga0265340_1000169613 242
203 3300048912 Ga0496109_0165281 Ga0496109_0165281_90_839 243
204 3300005366 Ga0070659_100459900 Ga0070659_1004599002 247
205 3300013102 Ga0157371_10009080 Ga0157371_100090802 247
206 3300025901 Ga0207688_10091837 Ga0207688_100918372 247
207 3300025932 Ga0207690_10015737 Ga0207690_100157372 247
208 3300044693 Ga0466961_0020141 Ga0466961_0020141_3344_4090 247
209 3300005330 Ga0070690_100043266 Ga0070690_1000432664 248
210 3300005338 Ga0068868_100041701 Ga0068868_1000417014 248
211 3300005366 Ga0070659_100000197 Ga0070659_10000019712 248
212 3300013105 Ga0157369_10001205 Ga0157369_1000120516 248
213 3300013105 Ga0157369_10034948 Ga0157369_100349483 248
214 3300020081 Ga0206354_11719496 Ga0206354_117194961 248
215 3300022467 Ga0224712_10004574 Ga0224712_100045743 248
216 3300025919 Ga0207657_10228531 Ga0207657_102285312 248
217 3300025932 Ga0207690_10000114 Ga0207690_1000011428 248
218 3300025934 Ga0207686_10217376 Ga0207686_102173762 248
219 3300026023 Ga0207677_10039451 Ga0207677_100394512 248
220 3300004799 Ga0058863_11765523 Ga0058863_117655231 249
221 3300005327 Ga0070658_10029743 Ga0070658_100297434 249
222 3300005336 Ga0070680_100000052 Ga0070680_10000005221 249
223 3300005336 Ga0070680_100018572 Ga0070680_1000185724 249
224 3300005339 Ga0070660_100222343 Ga0070660_1002223432 249
225 3300005458 Ga0070681_10000004 Ga0070681_1000000431 249
226 3300005458 Ga0070681_10029718 Ga0070681_100297181 249
227 3300005530 Ga0070679_100031072 Ga0070679_1000310724 249
228 3300005530 Ga0070679_100032574 Ga0070679_1000325741 249
229 3300005530 Ga0070679_100209259 Ga0070679_1002092592 249
230 3300006358 Ga0068871_100639124 Ga0068871_1006391241 249
231 3300013105 Ga0157369_10010017 Ga0157369_100100171 249
232 3300013296 Ga0157374_10486661 Ga0157374_104866611 249
233 3300013307 Ga0157372_10080581 Ga0157372_100805812 249
234 3300020070 Ga0206356_11681511 Ga0206356_116815111 249
235 3300020077 Ga0206351_10213804 Ga0206351_102138041 249
236 3300020077 Ga0206351_10691225 Ga0206351_106912251 249
237 3300020082 Ga0206353_11769543 Ga0206353_117695432 249
238 3300020610 Ga0154015_1459263 Ga0154015_14592632 249
239 3300022467 Ga0224712_10163091 Ga0224712_101630911 249
240 3300025909 Ga0207705_10017741 Ga0207705_100177415 249
241 3300025909 Ga0207705_10051983 Ga0207705_100519834 249
242 3300025912 Ga0207707_10000264 Ga0207707_1000026430 249
243 3300025912 Ga0207707_10020182 Ga0207707_100201826 249
244 3300025913 Ga0207695_10279123 Ga0207695_102791231 249
245 3300025917 Ga0207660_10000139 Ga0207660_1000013917 249
246 3300025917 Ga0207660_10061886 Ga0207660_100618863 249
247 3300025919 Ga0207657_10212545 Ga0207657_102125452 249
248 3300025921 Ga0207652_10080862 Ga0207652_100808622 249
249 3300025921 Ga0207652_10248271 Ga0207652_102482711 249
250 3300025949 Ga0207667_10092219 Ga0207667_100922192 249
251 3300037312 Ga0395899_0281541 Ga0395899_0281541_363_1115 249
252 3300037418 Ga0395900_0019557 Ga0395900_0019557_3658_4410 249
253 3300038443 Ga0395901_0064209 Ga0395901_0064209_2279_3031 249
254 3300044684 Ga0466966_0047654 Ga0466966_0047654_1432_2184 249
255 3300044693 Ga0466961_0001181 Ga0466961_0001181_14689_15441 249
256 3300044693 Ga0466961_0112291 Ga0466961_0112291_347_1099 249
257 3300045049 Ga0466959_0276860 Ga0466959_0276860_201_953 249
258 3300045836 Ga0466958_0013114 Ga0466958_0013114_2550_3302 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

20

150

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6855 2 204
1iuq-assembly1.cif.gz_A the 1.55 a crystal structure of glycerol-3-phosphate acyltransferase 0.66 2 207
1k30-assembly1.cif.gz_A crystal structure analysis of squash (cucurbita moschata) glycerol-3-phosphate (1)-acyltransferase 0.6542 2 206
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.6523 2 202
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6515 2 204
ID Description Score Start End Superfamily
af_O53516_20_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9587 20 150 3.40.50.2000
af_O53516_20_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9379 20 150 3.40.50.2000
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8236 24 150 3.40.50.2000
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8182 22 150 3.40.50.2000
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7999 24 150 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A1C6VPK0-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9724 1 221 GO:0003841
GO:0005886
GO:0006654
AF-A0A6J7NWP6-F1-model_v4 Unannotated protein 0.9723 2 231 GO:0003841
GO:0005886
GO:0006654
AF-A0A2T0XX56-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9723 1 227 GO:0003841
GO:0005886
GO:0006654
AF-A0A5C7P7K2-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9717 1 223 GO:0003841
GO:0005886
GO:0006654
AF-A0A839RRA9-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51) 0.9703 1 234 GO:0003841
GO:0005886
GO:0006654

Feature Viewer

pLDDT pTM Quality
83.91 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map