F368162

General Info

Members Datasets Scaffolds Average Seq Length
258 189 516 136

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10622469|Ga0207428_106224692
Length 150
Sequence MRLVLNIIWFVLAGLWMAIGYAFAALICFVLIITIPFGIAALRIAVFALWPFGKTVVRRPDAGIASGIGNVLWLLLCGWWLALGHLITGVLLCLTVIGIPLGLANLKLIPVSLLPLGREILSVEEARARGVASVPTIPSHPSERTALPPP

Samples

Sample ID Description Type Environment
1 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
7 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
12 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
13 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
14 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
19 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
28 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
29 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
30 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
31 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
32 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
33 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
34 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
35 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
36 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
37 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
38 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
39 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
42 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
43 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
44 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
45 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
46 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
47 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
54 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
55 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
56 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
57 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
58 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
59 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
103 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
113 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
158 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
162 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
163 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
164 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
165 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
166 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
169 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
170 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
174 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
175 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
176 2808606394 Promicromonospora sp. C35 Isolate Unclassified
177 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
178 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
179 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
180 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
181 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
182 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
183 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
184 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
185 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
186 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
187 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
188 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
189 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.02
Metatranscriptomes 0.39
Isolates 6.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.59
Nodule 0
Rhizoplane 4.65
Rhizosphere 84.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207428_10622469 3300027907 Bacteria 776
2 Ga0070714_100062806 3300005435 Bacteria 3192
3 Ga0070714_100176280 3300005435 Bacteria 1943
4 Ga0070714_100424091 3300005435 Bacteria 1260
5 Ga0070713_100020924 3300005436 Bacteria 5023
6 Ga0070713_100033620 3300005436 Bacteria 4109
7 Ga0070713_100109784 3300005436 Bacteria 2403
8 Ga0070710_10016363 3300005437 Bacteria 3772
9 Ga0070711_100012215 3300005439 Bacteria 5360
10 Ga0070684_101418797 3300005535 Bacteria 654
11 Ga0068857_100990102 3300005577 Bacteria 809
12 Ga0068856_100887375 3300005614 Bacteria 911
13 Ga0070717_10004439 3300006028 Bacteria 10132
14 Ga0070717_10116117 3300006028 Bacteria 2288
15 Ga0070717_10309137 3300006028 Bacteria 1406
16 Ga0070717_10630706 3300006028 Bacteria 973
17 Ga0075363_100056698 3300006048 Bacteria 2101
18 Ga0070716_100126381 3300006173 Bacteria 1609
19 Ga0070712_100088012 3300006175 Bacteria 2268
20 Ga0070712_100137120 3300006175 Bacteria 1862
21 Ga0075369_10111832 3300006186 Bacteria 1231
22 Ga0075434_100609175 3300006871 Bacteria 1111
23 Ga0105245_10909603 3300009098 Bacteria 922
24 Ga0105237_10004875 3300009545 Bacteria 15372
25 Ga0105239_10040665 3300010375 Bacteria 5094
26 Ga0157372_11158267 3300013307 Bacteria 894
27 Ga0209051_1000033 3300025303 Bacteria 380540
28 Ga0207692_10011567 3300025898 Bacteria 3761
29 Ga0207671_10016132 3300025914 Bacteria 5818
30 Ga0207693_10006897 3300025915 Bacteria 9380
31 Ga0207693_10222357 3300025915 Bacteria 1483
32 Ga0207663_10003685 3300025916 Bacteria 7533
33 Ga0207700_10026356 3300025928 Bacteria 4051
34 Ga0207700_10084558 3300025928 Bacteria 2487
35 Ga0207665_10136484 3300025939 Bacteria 1746
36 Ga0207674_10639756 3300026116 Bacteria 1027
37 Ga0265326_10000048 3300028558 Bacteria 74469
38 Ga0265334_10000026 3300028573 Bacteria 116448
39 Ga0265336_10038448 3300028666 Bacteria 1469
40 Ga0265338_10004055 3300028800 Bacteria 20081
41 Ga0265324_10005798 3300029957 Bacteria 5256
42 Ga0316181_1213760 3300030744 Bacteria 1132
43 Ga0265329_10192761 3300031242 Bacteria 669
44 Ga0265327_10004008 3300031251 Bacteria 13407
45 Ga0265327_10006048 3300031251 Bacteria 9818
46 Ga0265314_10191882 3300031711 Bacteria 1215
47 Ga0307413_11011268 3300031824 Bacteria 713
48 Ga0307406_10724091 3300031901 Bacteria 833
49 Ga0307406_10870254 3300031901 Bacteria 765
50 Ga0307412_10802702 3300031911 Bacteria 817
51 Ga0307409_100402557 3300031995 Bacteria 1308
52 Ga0307409_100477671 3300031995 Bacteria 1209
53 Ga0307416_100099752 3300032002 Bacteria 2523
54 Ga0307416_100654643 3300032002 Bacteria 1136
55 Ga0307415_100062700 3300032126 Bacteria 2580
56 Ga0307415_100123730 3300032126 Bacteria 1945
57 Ga0307415_100833627 3300032126 Bacteria 845
58 Ga0307415_102041312 3300032126 Bacteria 559
59 Ga0373954_0006302 3300035118 Bacteria 5172
60 Ga0373956_0010818 3300035119 Bacteria 3748
61 Ga0373955_0243718 3300035172 Bacteria 1077
62 Ga0373947_0128033 3300035725 Bacteria 1619
63 Ga0373937_0014823 3300036401 Bacteria 6884
64 Ga0373925_1441720 3300037068 Bacteria 564
65 Ga0395899_0123721 3300037312 Bacteria 1851
66 Ga0395900_0128138 3300037418 Bacteria 2602
67 Ga0395898_0003554 3300037466 Bacteria 17379
68 Ga0395898_0045128 3300037466 Bacteria 4333
69 Ga0395905_0084556 3300037471 Bacteria 2973
70 Ga0395905_0287740 3300037471 Bacteria 1530
71 Ga0395901_0197967 3300038443 Bacteria 2106
72 Ga0395901_0379026 3300038443 Bacteria 1456
73 Ga0451853_0756030 3300041512 Bacteria 7740
74 Ga0439431_0005389 3300041997 Bacteria 2825
75 Ga0439442_022573 3300042002 Bacteria 1306
76 Ga0439448_0019936 3300042005 Bacteria 2070
77 Ga0439432_007751 3300042006 Bacteria 3790
78 Ga0466969_0030506 3300044656 Bacteria 2746
79 Ga0466972_0014923 3300044658 Bacteria 3887
80 Ga0466965_0005107 3300044683 Bacteria 5891
81 Ga0466966_0001439 3300044684 Bacteria 15301
82 Ga0466966_0011827 3300044684 Bacteria 5779
83 Ga0466966_0022332 3300044684 Bacteria 4153
84 Ga0466966_0173958 3300044684 Bacteria 1308
85 Ga0466961_0002630 3300044693 Bacteria 11153
86 Ga0466961_0005296 3300044693 Bacteria 8116
87 Ga0466961_0016551 3300044693 Bacteria 4739
88 Ga0466963_0006331 3300044694 Bacteria 6999
89 Ga0466963_0863929 3300044694 Bacteria 638
90 Ga0466964_0003928 3300044706 Bacteria 5464
91 Ga0466971_0000156 3300044719 Bacteria 25560
92 Ga0466971_0000589 3300044719 Bacteria 14381
93 Ga0466968_0111797 3300044735 Bacteria 1229
94 Ga0466970_0001920 3300044765 Bacteria 10052
95 Ga0466970_0103578 3300044765 Bacteria 1551
96 Ga0466957_0000352 3300044842 Bacteria 22556
97 Ga0466957_0624453 3300044842 Bacteria 756
98 Ga0466960_0013032 3300044901 Bacteria 3523
99 Ga0466960_0160818 3300044901 Bacteria 1205
100 Ga0466960_0585647 3300044901 Bacteria 661
101 Ga0466959_0014919 3300045049 Bacteria 5660
102 Ga0466959_0019605 3300045049 Bacteria 4975
103 Ga0466959_0080935 3300045049 Bacteria 2340
104 Ga0466959_0276247 3300045049 Bacteria 1154
105 Ga0466958_0000270 3300045836 Bacteria 19976
106 Ga0466958_0147270 3300045836 Bacteria 1484
107 Ga0466967_0013431 3300045976 Bacteria 6327
108 Ga0466967_0035013 3300045976 Bacteria 4269
109 Ga0495627_024619 3300046453 Bacteria 1960
110 Ga0495592_0231110 3300046454 Bacteria 1231
111 Ga0495603_0001490 3300046455 Bacteria 13624
112 Ga0495629_0014038 3300046459 Bacteria 5772
113 Ga0495629_0083420 3300046459 Bacteria 2230
114 Ga0495651_0002913 3300046462 Bacteria 13247
115 Ga0495653_0003833 3300046463 Bacteria 12166
116 Ga0495582_0183320 3300046473 Bacteria 1193
117 Ga0495639_0003521 3300046475 Bacteria 6759
118 Ga0495662_0002940 3300046476 Bacteria 8601
119 Ga0495662_0005380 3300046476 Bacteria 6410
120 Ga0495664_0633639 3300046477 Bacteria 634
121 Ga0495594_0690182 3300046499 Bacteria 577
122 Ga0495608_0020121 3300046511 Bacteria 4588
123 Ga0495608_0365918 3300046511 Bacteria 886
124 Ga0495610_0315316 3300046512 Bacteria 599
125 Ga0495618_0015795 3300046514 Bacteria 4609
126 Ga0495628_0024621 3300046516 Bacteria 4924
127 Ga0495628_0952864 3300046516 Bacteria 593
128 Ga0495630_0076024 3300046517 Bacteria 2530
129 Ga0495652_0015512 3300046529 Bacteria 6820
130 Ga0495652_0232732 3300046529 Bacteria 1377
131 Ga0495640_0105439 3300046533 Bacteria 1846
132 Ga0495587_0098625 3300046536 Bacteria 1684
133 Ga0495609_0272751 3300046538 Bacteria 693
134 Ga0495645_0381137 3300046543 Bacteria 902
135 Ga0495667_0000218 3300046559 Bacteria 37859
136 Ga0495634_0189322 3300046642 Bacteria 1284
137 Ga0495634_0531172 3300046642 Bacteria 687
138 Ga0495635_0050751 3300046663 Bacteria 2859
139 Ga0495635_0762647 3300046663 Bacteria 625
140 Ga0495588_0203357 3300046674 Bacteria 1046
141 Ga0495657_0004919 3300046675 Bacteria 10631
142 Ga0495657_0009906 3300046675 Bacteria 7190
143 Ga0495623_0021331 3300046679 Bacteria 4184
144 Ga0495646_0001401 3300046680 Bacteria 14334
145 Ga0495646_0485067 3300046680 Bacteria 636
146 Ga0495613_0007720 3300046689 Bacteria 8001
147 Ga0495613_0046529 3300046689 Bacteria 3208
148 Ga0495613_0132041 3300046689 Bacteria 1788
149 Ga0495613_0417055 3300046689 Bacteria 914
150 Ga0495670_0724449 3300046691 Bacteria 542
151 Ga0495671_0305615 3300046692 Bacteria 765
152 Ga0495600_0025572 3300046809 Bacteria 3805
153 Ga0495600_0187806 3300046809 Bacteria 1330
154 Ga0495600_0324429 3300046809 Bacteria 968
155 Ga0495581_0038493 3300047315 Bacteria 2768
156 Ga0495604_0018620 3300047317 Bacteria 5563
157 Ga0495636_0000399 3300047318 Bacteria 16264
158 Ga0495636_0056124 3300047318 Bacteria 1658
159 Ga0495674_0026481 3300047319 Bacteria 5305
160 Ga0495680_0023107 3300047322 Bacteria 5173
161 Ga0495680_0215362 3300047322 Bacteria 1373
162 Ga0495680_0962034 3300047322 Bacteria 548
163 Ga0495687_072371 3300047443 Bacteria 1377
164 Ga0495675_0128082 3300047444 Bacteria 1579
165 Ga0495675_0394427 3300047444 Bacteria 808
166 Ga0495685_032190 3300047447 Bacteria 1802
167 Ga0495685_052148 3300047447 Bacteria 1386
168 Ga0495681_0035464 3300047470 Bacteria 2476
169 Ga0495684_0013488 3300047471 Bacteria 6287
170 Ga0495593_0309334 3300047673 Bacteria 790
171 Ga0495593_0349934 3300047673 Bacteria 738
172 Ga0495602_0029365 3300048088 Bacteria 5237
173 Ga0496100_0227182 3300048903 Bacteria 1372
174 Ga0496101_0104127 3300048904 Bacteria 2128
175 Ga0496102_1079346 3300048905 Bacteria 723
176 Ga0496104_0360294 3300048907 Bacteria 1366
177 Ga0496108_0119185 3300048911 Bacteria 2263
178 Ga0496109_0190037 3300048912 Bacteria 1930
179 Ga0496111_0850387 3300048914 Bacteria 659
180 Ga0496112_0003579 3300048915 Bacteria 12914
181 Ga0496113_0204768 3300048916 Bacteria 1569
182 Ga0496114_0126411 3300048917 Bacteria 2204
183 Ga0496114_0687920 3300048917 Bacteria 898
184 Ga0496115_0123996 3300048918 Bacteria 2127
185 Ga0496125_0091859 3300048928 Bacteria 2272
186 Ga0496126_0044613 3300048929 Bacteria 4081
187 Ga0501031_0059245 3300049568 Bacteria 2495
188 Ga0501032_0015875 3300049569 Bacteria 5306
189 Ga0501033_0003370 3300049570 Bacteria 13185
190 Ga0501033_0016012 3300049570 Bacteria 5679
191 Ga0501033_0035084 3300049570 Bacteria 3760
192 Ga0501036_0100509 3300049572 Bacteria 2446
193 Ga0501037_0056388 3300049573 Bacteria 2869
194 Ga0501038_0080506 3300049574 Bacteria 2745
195 Ga0501038_0274152 3300049574 Bacteria 1329
196 Ga0501039_0140036 3300049575 Bacteria 1900
197 Ga0501042_0118367 3300049578 Bacteria 1907
198 Ga0501043_0099290 3300049579 Bacteria 2288
199 Ga0501046_0017356 3300049580 Bacteria 6010
200 Ga0501046_0038732 3300049580 Bacteria 3823
201 Ga0501048_0017396 3300049582 Bacteria 5298
202 Ga0501067_0110116 3300049583 Bacteria 1531
203 Ga0501068_0018831 3300049584 Bacteria 4000
204 Ga0501069_0643629 3300049585 Bacteria 638
205 Ga0501070_0386347 3300049586 Bacteria 1133
206 Ga0501072_0233116 3300049588 Bacteria 1466
207 Ga0501073_0008394 3300049589 Bacteria 7663
208 Ga0501074_0110223 3300049590 Bacteria 1969
209 Ga0501076_0187623 3300049592 Bacteria 1687
210 Ga0501077_0661159 3300049593 Bacteria 671
211 Ga0501080_0024579 3300049742 Bacteria 5586
212 Ga0501083_0100772 3300049744 Bacteria 1904
213 Ga0501035_0098252 3300049822 Bacteria 2570
214 Ga0501044_0072631 3300049823 Bacteria 3498
215 Ga0501044_0262660 3300049823 Bacteria 1664
216 Ga0501044_1077867 3300049823 Bacteria 673
217 nmdc:mga06z11_121897_c1 3300050494 Bacteria 1455
218 nmdc:mga08y16_541047_c1 3300050511 Bacteria 1179
219 nmdc:mga08y16_569671_c1 3300050511 Bacteria 1144
220 nmdc:mga0n895_938682_c1 3300050512 Bacteria 849
221 nmdc:mga0sz30_25629_c1 3300050516 Bacteria 2412
222 Ga0500635_0005708 3300053080 Bacteria 3285
223 Ga0495595_0041728 3300053084 Bacteria 2100
224 Ga0495619_0007855 3300053085 Bacteria 6748
225 Ga0495619_0289856 3300053085 Bacteria 1134
226 Ga0500641_0036991 3300053096 Bacteria 1955
227 Ga0500641_0303048 3300053096 Bacteria 655
228 Ga0500556_0000328 3300053104 Bacteria 35671
229 Ga0500608_063609 3300053122 Bacteria 1761
230 Ga0500658_0347325 3300053134 Bacteria 681
231 Ga0500568_0066834 3300053139 Bacteria 1382
232 Ga0500568_0225363 3300053139 Bacteria 684
233 Ga0500600_0215415 3300053149 Bacteria 891
234 Ga0500616_0081942 3300053153 Bacteria 1619
235 Ga0500645_000025 3300053730 Bacteria 125835
236 Ga0500599_006314 3300053736 Bacteria 1510
237 Ga0587101_106662 3300059623 Bacteria 564
238 Ga0501082_0011456 3300060353 Bacteria 7633
239 Ga0466962_0000193 3300061719 Bacteria 25238
240 Ga0466962_0012715 3300061719 Bacteria 4049
241 Ga0466962_0098739 3300061719 Bacteria 1401
242 2644547693 2643221699 Bacteria 5731501
243 2739364624 2738543034 Bacteria 6084756
244 2739606709 2739367654 Bacteria 6049412
245 2809029933 2808606394 Bacteria 6248540
246 2884701309 2884693830 Bacteria 11273186
247 2891561070 2891554331 Bacteria 8812224
248 2895442800 2895442618 Bacteria 11027144
249 2904766705 2904765812 Bacteria 5369154
250 2904775283 2904770941 Bacteria 5580202
251 2908811669 2908811453 Bacteria 5478616
252 2912718500 2912715099 Bacteria 9460473
253 2912730843 2912723979 Bacteria 8557534
254 2919420859 2919420072 Bacteria 5390363
255 2919433383 2919432681 Bacteria 5390474
256 3001119384 3001119090 Bacteria 3449530
257 3006326575 3006321560 Bacteria 8247479
258 8056837693 8056829672 Bacteria 9045328
259 Ga0207428_10622469
260 Ga0070714_100062806
261 Ga0070714_100176280
262 Ga0070714_100424091
263 Ga0070713_100020924
264 Ga0070713_100033620
265 Ga0070713_100109784
266 Ga0070710_10016363
267 Ga0070711_100012215
268 Ga0070684_101418797
269 Ga0068857_100990102
270 Ga0068856_100887375
271 Ga0070717_10004439
272 Ga0070717_10116117
273 Ga0070717_10309137
274 Ga0070717_10630706
275 Ga0075363_100056698
276 Ga0070716_100126381
277 Ga0070712_100088012
278 Ga0070712_100137120
279 Ga0075369_10111832
280 Ga0075434_100609175
281 Ga0105245_10909603
282 Ga0105237_10004875
283 Ga0105239_10040665
284 Ga0157372_11158267
285 Ga0209051_1000033
286 Ga0207692_10011567
287 Ga0207671_10016132
288 Ga0207693_10006897
289 Ga0207693_10222357
290 Ga0207663_10003685
291 Ga0207700_10026356
292 Ga0207700_10084558
293 Ga0207665_10136484
294 Ga0207674_10639756
295 Ga0265326_10000048
296 Ga0265334_10000026
297 Ga0265336_10038448
298 Ga0265338_10004055
299 Ga0265324_10005798
300 Ga0316181_1213760
301 Ga0265329_10192761
302 Ga0265327_10004008
303 Ga0265327_10006048
304 Ga0265314_10191882
305 Ga0307413_11011268
306 Ga0307406_10724091
307 Ga0307406_10870254
308 Ga0307412_10802702
309 Ga0307409_100402557
310 Ga0307409_100477671
311 Ga0307416_100099752
312 Ga0307416_100654643
313 Ga0307415_100062700
314 Ga0307415_100123730
315 Ga0307415_100833627
316 Ga0307415_102041312
317 Ga0373954_0006302
318 Ga0373956_0010818
319 Ga0373955_0243718
320 Ga0373947_0128033
321 Ga0373937_0014823
322 Ga0373925_1441720
323 Ga0395899_0123721
324 Ga0395900_0128138
325 Ga0395898_0003554
326 Ga0395898_0045128
327 Ga0395905_0084556
328 Ga0395905_0287740
329 Ga0395901_0197967
330 Ga0395901_0379026
331 Ga0451853_0756030
332 Ga0439431_0005389
333 Ga0439442_022573
334 Ga0439448_0019936
335 Ga0439432_007751
336 Ga0466969_0030506
337 Ga0466972_0014923
338 Ga0466965_0005107
339 Ga0466966_0001439
340 Ga0466966_0011827
341 Ga0466966_0022332
342 Ga0466966_0173958
343 Ga0466961_0002630
344 Ga0466961_0005296
345 Ga0466961_0016551
346 Ga0466963_0006331
347 Ga0466963_0863929
348 Ga0466964_0003928
349 Ga0466971_0000156
350 Ga0466971_0000589
351 Ga0466968_0111797
352 Ga0466970_0001920
353 Ga0466970_0103578
354 Ga0466957_0000352
355 Ga0466957_0624453
356 Ga0466960_0013032
357 Ga0466960_0160818
358 Ga0466960_0585647
359 Ga0466959_0014919
360 Ga0466959_0019605
361 Ga0466959_0080935
362 Ga0466959_0276247
363 Ga0466958_0000270
364 Ga0466958_0147270
365 Ga0466967_0013431
366 Ga0466967_0035013
367 Ga0495627_024619
368 Ga0495592_0231110
369 Ga0495603_0001490
370 Ga0495629_0014038
371 Ga0495629_0083420
372 Ga0495651_0002913
373 Ga0495653_0003833
374 Ga0495582_0183320
375 Ga0495639_0003521
376 Ga0495662_0002940
377 Ga0495662_0005380
378 Ga0495664_0633639
379 Ga0495594_0690182
380 Ga0495608_0020121
381 Ga0495608_0365918
382 Ga0495610_0315316
383 Ga0495618_0015795
384 Ga0495628_0024621
385 Ga0495628_0952864
386 Ga0495630_0076024
387 Ga0495652_0015512
388 Ga0495652_0232732
389 Ga0495640_0105439
390 Ga0495587_0098625
391 Ga0495609_0272751
392 Ga0495645_0381137
393 Ga0495667_0000218
394 Ga0495634_0189322
395 Ga0495634_0531172
396 Ga0495635_0050751
397 Ga0495635_0762647
398 Ga0495588_0203357
399 Ga0495657_0004919
400 Ga0495657_0009906
401 Ga0495623_0021331
402 Ga0495646_0001401
403 Ga0495646_0485067
404 Ga0495613_0007720
405 Ga0495613_0046529
406 Ga0495613_0132041
407 Ga0495613_0417055
408 Ga0495670_0724449
409 Ga0495671_0305615
410 Ga0495600_0025572
411 Ga0495600_0187806
412 Ga0495600_0324429
413 Ga0495581_0038493
414 Ga0495604_0018620
415 Ga0495636_0000399
416 Ga0495636_0056124
417 Ga0495674_0026481
418 Ga0495680_0023107
419 Ga0495680_0215362
420 Ga0495680_0962034
421 Ga0495687_072371
422 Ga0495675_0128082
423 Ga0495675_0394427
424 Ga0495685_032190
425 Ga0495685_052148
426 Ga0495681_0035464
427 Ga0495684_0013488
428 Ga0495593_0309334
429 Ga0495593_0349934
430 Ga0495602_0029365
431 Ga0496100_0227182
432 Ga0496101_0104127
433 Ga0496102_1079346
434 Ga0496104_0360294
435 Ga0496108_0119185
436 Ga0496109_0190037
437 Ga0496111_0850387
438 Ga0496112_0003579
439 Ga0496113_0204768
440 Ga0496114_0126411
441 Ga0496114_0687920
442 Ga0496115_0123996
443 Ga0496125_0091859
444 Ga0496126_0044613
445 Ga0501031_0059245
446 Ga0501032_0015875
447 Ga0501033_0003370
448 Ga0501033_0016012
449 Ga0501033_0035084
450 Ga0501036_0100509
451 Ga0501037_0056388
452 Ga0501038_0080506
453 Ga0501038_0274152
454 Ga0501039_0140036
455 Ga0501042_0118367
456 Ga0501043_0099290
457 Ga0501046_0017356
458 Ga0501046_0038732
459 Ga0501048_0017396
460 Ga0501067_0110116
461 Ga0501068_0018831
462 Ga0501069_0643629
463 Ga0501070_0386347
464 Ga0501072_0233116
465 Ga0501073_0008394
466 Ga0501074_0110223
467 Ga0501076_0187623
468 Ga0501077_0661159
469 Ga0501080_0024579
470 Ga0501083_0100772
471 Ga0501035_0098252
472 Ga0501044_0072631
473 Ga0501044_0262660
474 Ga0501044_1077867
475 nmdc:mga06z11_121897_c1
476 nmdc:mga08y16_541047_c1
477 nmdc:mga08y16_569671_c1
478 nmdc:mga0n895_938682_c1
479 nmdc:mga0sz30_25629_c1
480 Ga0500635_0005708
481 Ga0495595_0041728
482 Ga0495619_0007855
483 Ga0495619_0289856
484 Ga0500641_0036991
485 Ga0500641_0303048
486 Ga0500556_0000328
487 Ga0500608_063609
488 Ga0500658_0347325
489 Ga0500568_0066834
490 Ga0500568_0225363
491 Ga0500600_0215415
492 Ga0500616_0081942
493 Ga0500645_000025
494 Ga0500599_006314
495 Ga0587101_106662
496 Ga0501082_0011456
497 Ga0466962_0000193
498 Ga0466962_0012715
499 Ga0466962_0098739
500 2644547693
501 2739364624
502 2739606709
503 2809029933
504 2884701309
505 2891561070
506 2895442800
507 2904766705
508 2904775283
509 2908811669
510 2912718500
511 2912730843
512 2919420859
513 2919433383
514 3001119384
515 3006326575
516 8056837693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03733

YccF

Inner membrane component domain

4

54

0.98

PF03733

YccF

Inner membrane component domain

68

118

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qyb-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h111a 0.3385 6 117
7u8g-assembly1.cif.gz_B cryo-em structure of the core human nadph oxidase nox2 0.3291 2 115
8fn1-assembly1.cif.gz_A cryoem structure of go-coupled ntsr1 0.3169 38 113
6qyb-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h111a 0.3169 6 117
5arm-assembly1.cif.gz_A apo-csp3 (copper storage protein 3) from methylosinus 0.306 6 113
ID Description Score Start End Superfamily
af_Q3UWK9_9_163_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.4473 14 112 1.20.1260.10
af_O42901_1_186_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.39 69 134 1.20.1070.10
af_Q9C587_601_707_1.20.272.10 Mainly Alpha;Up-down Bundle;Zinc Finger, Delta Prime; domain 3; 0.3815 58 122 1.20.272.10
af_I1MNJ9_19_150_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3808 13 115 1.20.140.150
af_Q5HYL7_14_174_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3792 14 113 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2X4U6U2-F1-model_v4 Inner membrane protein yccF 0.9914 1 124 GO:0005886
AF-A0A4Q7ZPR4-F1-model_v4 Uncharacterized membrane protein YccF (DUF307 family) 0.9907 2 126 GO:0005886
AF-Q0RSK8-F1-model_v4 Inner membrane component domain-containing protein 0.9892 1 124 GO:0005886
AF-A0A7I7MIX0-F1-model_v4 Uncharacterized protein 0.9891 1 124 GO:0005886
AF-A0A6V8L0Y0-F1-model_v4 Inner membrane component domain-containing protein 0.9891 2 123 GO:0005886

Map