F368090

General Info

Members Datasets Scaffolds Average Seq Length
258 145 254 396

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10025400|Ga0157380_100254003
Length 387
Sequence MSYSTQTKLIHAIPVDPLTGSISVPIYQTSTYVQEAPGVNKGYDYARSNNPTRAVLENLIAQLENGSTGIAFGSGLAAIDAVLKLLKSGDEIIAVDDIYGGAFRLFTHVYEKFGVSVRYVDTTNVENVFNAITPQTKLIWIETPTNPTLKISDCLLCVDNTFASPALQQPLSLGADIVVHSATKYLGGHSDLIAGLVVTKEKEWGDRIKFIQNASGAILGPFDSWLVIRGIETLHLRVQQHCSNAMLIAQFLDEHPLVNKVYYPGLKDHPNYEIARRQSKGFGGIVSFTLKPDTEQAAHDFVTNTKLFKLAESLGGVKSLLCHPAQMTHKSIPAETRRAAGVIDSLIRLSVGLEDAADLIADLQQAFEAKLIVKKAHTDFFTRERNV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
143 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
144 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 1.55
Rhizosphere 90.7
Stem 0
Stem Tuber 0
Unclassified 5.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1759593 2162886007 Bacteria 266684
2 rootH2_10074050 3300003320 Bacteria 7919
3 rootH2_10100645 3300003320 Bacteria 10994
4 Ga0065165_1009290 3300005262 Unclassified 4431
5 Ga0065704_10070133 3300005289 Bacteria 1266035
6 Ga0070658_10001887 3300005327 Bacteria 17678
7 Ga0070676_10004661 3300005328 Bacteria 7243
8 Ga0070670_100314943 3300005331 Bacteria 1370
9 Ga0070666_10000138 3300005335 Bacteria 50719
10 Ga0070666_10014435 3300005335 Bacteria 5030
11 Ga0070666_10030778 3300005335 Bacteria 3538
12 Ga0068868_100003136 3300005338 Bacteria 11506
13 Ga0070661_100126844 3300005344 Bacteria 1915
14 Ga0070668_100001278 3300005347 Bacteria 17995
15 Ga0070668_100061445 3300005347 Bacteria 2910
16 Ga0070671_100015254 3300005355 Bacteria 6205
17 Ga0070671_100076696 3300005355 Bacteria 2793
18 Ga0070674_100025246 3300005356 Bacteria 3867
19 Ga0070673_100034796 3300005364 Bacteria 3816
20 Ga0070673_100052793 3300005364 Bacteria 3190
21 Ga0070659_100010931 3300005366 Bacteria 6699
22 Ga0070659_100026196 3300005366 Bacteria 4485
23 Ga0070667_100012604 3300005367 Bacteria 6992
24 Ga0070667_100032121 3300005367 Bacteria 4378
25 Ga0070667_100042450 3300005367 Bacteria 3816
26 Ga0070700_100177072 3300005441 Bacteria 1481
27 Ga0070662_100004967 3300005457 Bacteria 8451
28 Ga0070662_100089432 3300005457 Bacteria 2310
29 Ga0070681_10012225 3300005458 Bacteria 8511
30 Ga0068867_100028131 3300005459 Bacteria 4045
31 Ga0068867_100037244 3300005459 Bacteria 3535
32 Ga0068853_100022502 3300005539 Bacteria 5265
33 Ga0068853_100093387 3300005539 Bacteria 2649
34 Ga0068853_100095557 3300005539 Bacteria 2621
35 Ga0070672_100001603 3300005543 Bacteria 14052
36 Ga0070672_100029229 3300005543 Bacteria 4132
37 Ga0070665_100000008 3300005548 Bacteria 606341
38 Ga0070665_100000717 3300005548 Bacteria 44083
39 Ga0070665_100003504 3300005548 Bacteria 16699
40 Ga0070665_100041382 3300005548 Bacteria 4631
41 Ga0068855_100056698 3300005563 Bacteria 4595
42 Ga0068855_100217005 3300005563 Bacteria 2147
43 Ga0068857_100004830 3300005577 Bacteria 11421
44 Ga0068856_100107548 3300005614 Bacteria 2784
45 Ga0068852_100002535 3300005616 Bacteria 12580
46 Ga0068852_100024969 3300005616 Bacteria 4836
47 Ga0068852_100118247 3300005616 Unclassified 2422
48 Ga0068852_100299518 3300005616 Bacteria 1556
49 Ga0068852_100330709 3300005616 Bacteria 1482
50 Ga0068859_100046984 3300005617 Bacteria 4336
51 Ga0068864_100079613 3300005618 Bacteria 2869
52 Ga0068864_100082818 3300005618 Bacteria 2816
53 Ga0068861_100059398 3300005719 Bacteria 2928
54 Ga0068851_10002822 3300005834 Bacteria 7654
55 Ga0068851_10076041 3300005834 Bacteria 1746
56 Ga0068863_100056574 3300005841 Bacteria 3713
57 Ga0068863_100092836 3300005841 Bacteria 2864
58 Ga0068863_100195573 3300005841 Bacteria 1944
59 Ga0068858_100098905 3300005842 Bacteria 2720
60 Ga0068860_100000059 3300005843 Bacteria 196400
61 Ga0068860_100003174 3300005843 Bacteria 16956
62 Ga0068860_100013541 3300005843 Bacteria 7996
63 Ga0068862_100186971 3300005844 Bacteria 1862
64 Ga0097621_100000487 3300006237 Bacteria 27766
65 Ga0097621_100103603 3300006237 Bacteria 2397
66 Ga0068871_100000598 3300006358 Bacteria 24790
67 Ga0068871_100024719 3300006358 Unclassified 4662
68 Ga0068871_100114248 3300006358 Bacteria 2274
69 Ga0068865_100008569 3300006881 Bacteria 6321
70 Ga0068865_100184147 3300006881 Unclassified 1610
71 Ga0068865_100221996 3300006881 Bacteria 1478
72 Ga0097620_100046985 3300006931 Bacteria 4336
73 Ga0105240_10000767 3300009093 Bacteria 58332
74 Ga0105240_10009560 3300009093 Bacteria 13726
75 Ga0105240_10049859 3300009093 Bacteria 5281
76 Ga0105240_10253523 3300009093 Bacteria 2034
77 Ga0105240_10446523 3300009093 Bacteria 1448
78 Ga0105243_10099703 3300009148 Bacteria 2408
79 Ga0105241_10106996 3300009174 Bacteria 2233
80 Ga0105242_10032993 3300009176 Bacteria 4143
81 Ga0105242_10035959 3300009176 Bacteria 3971
82 Ga0105242_10156331 3300009176 Unclassified 1992
83 Ga0105237_10000128 3300009545 Bacteria 106338
84 Ga0105237_10007857 3300009545 Bacteria 11628
85 Ga0105237_10027387 3300009545 Bacteria 5819
86 Ga0105237_10041295 3300009545 Bacteria 4652
87 Ga0105238_10013311 3300009551 Bacteria 8299
88 Ga0105238_10053188 3300009551 Bacteria 4069
89 Ga0105249_10006818 3300009553 Bacteria 9961
90 Ga0105249_10015507 3300009553 Bacteria 6745
91 Ga0105249_10029285 3300009553 Bacteria 4972
92 Ga0105239_10025164 3300010375 Bacteria 6556
93 Ga0105239_10048918 3300010375 Bacteria 4635
94 Ga0105239_10055950 3300010375 Bacteria 4328
95 Ga0105239_10060044 3300010375 Bacteria 4173
96 Ga0105239_10192858 3300010375 Bacteria 2281
97 Ga0105246_10007561 3300011119 Bacteria 6667
98 Ga0157370_10005319 3300013104 Bacteria 14456
99 Ga0157370_10232438 3300013104 Bacteria 1706
100 Ga0157369_10024325 3300013105 Bacteria 6740
101 Ga0157374_10017972 3300013296 Bacteria 6234
102 Ga0157374_10141936 3300013296 Bacteria 2332
103 Ga0157374_10401458 3300013296 Unclassified 1367
104 Ga0157378_10002981 3300013297 Bacteria 15034
105 Ga0157378_10004726 3300013297 Bacteria 11942
106 Ga0157378_10011873 3300013297 Bacteria 7627
107 Ga0157378_10025187 3300013297 Bacteria 5242
108 Ga0157378_10044912 3300013297 Bacteria 3924
109 Ga0157378_10131141 3300013297 Bacteria 2320
110 Ga0163162_10000164 3300013306 Bacteria 60866
111 Ga0163162_10000697 3300013306 Bacteria 31013
112 Ga0163162_10000856 3300013306 Bacteria 28341
113 Ga0163162_10003500 3300013306 Bacteria 15011
114 Ga0163162_10029383 3300013306 Bacteria 5439
115 Ga0163162_10086252 3300013306 Bacteria 3217
116 Ga0163162_10145266 3300013306 Bacteria 2488
117 Ga0157372_10000676 3300013307 Bacteria 37536
118 Ga0157372_10058445 3300013307 Bacteria 4311
119 Ga0157372_10435319 3300013307 Unclassified 1529
120 Ga0157375_10000383 3300013308 Bacteria 40397
121 Ga0157375_10027280 3300013308 Bacteria 5337
122 Ga0157375_10063288 3300013308 Bacteria 3680
123 Ga0163163_10000560 3300014325 Bacteria 32679
124 Ga0163163_10002603 3300014325 Bacteria 15288
125 Ga0163163_10144523 3300014325 Bacteria 2422
126 Ga0157380_10025400 3300014326 Bacteria 4492
127 Ga0157379_10001099 3300014968 Bacteria 22094
128 Ga0157379_10016875 3300014968 Bacteria 6426
129 Ga0157379_10036890 3300014968 Bacteria 4359
130 Ga0157379_10127555 3300014968 Bacteria 2289
131 Ga0157379_10164388 3300014968 Bacteria 2003
132 Ga0157379_10259959 3300014968 Unclassified 1577
133 Ga0157376_10001028 3300014969 Bacteria 18245
134 Ga0157376_10085506 3300014969 Bacteria 2718
135 Ga0157376_10252106 3300014969 Bacteria 1649
136 Ga0163161_10001190 3300017792 Bacteria 19553
137 Ga0163161_10042807 3300017792 Bacteria 3258
138 Ga0209436_102339 3300025208 Bacteria 5793
139 Ga0207656_10056661 3300025321 Bacteria 1709
140 Ga0207682_10045453 3300025893 Bacteria 1802
141 Ga0207680_10001900 3300025903 Bacteria 9802
142 Ga0207680_10023116 3300025903 Bacteria 3390
143 Ga0207680_10171810 3300025903 Bacteria 1460
144 Ga0207647_10000139 3300025904 Bacteria 57477
145 Ga0207647_10000485 3300025904 Bacteria 31915
146 Ga0207647_10033688 3300025904 Bacteria 3277
147 Ga0207645_10000093 3300025907 Bacteria 64854
148 Ga0207645_10055526 3300025907 Bacteria 2528
149 Ga0207705_10036720 3300025909 Bacteria 3505
150 Ga0207695_10000425 3300025913 Bacteria 93523
151 Ga0207695_10011272 3300025913 Bacteria 10839
152 Ga0207695_10013688 3300025913 Bacteria 9656
153 Ga0207671_10001329 3300025914 Bacteria 28904
154 Ga0207671_10003963 3300025914 Bacteria 14397
155 Ga0207671_10008487 3300025914 Bacteria 8706
156 Ga0207671_10010890 3300025914 Bacteria 7455
157 Ga0207671_10215160 3300025914 Bacteria 1504
158 Ga0207649_10068070 3300025920 Bacteria 2263
159 Ga0207681_10037939 3300025923 Bacteria 3188
160 Ga0207650_10064753 3300025925 Unclassified 2737
161 Ga0207644_10024181 3300025931 Unclassified 4168
162 Ga0207690_10014341 3300025932 Bacteria 4788
163 Ga0207690_10101108 3300025932 Bacteria 2059
164 Ga0207706_10040539 3300025933 Bacteria 4127
165 Ga0207669_10043696 3300025937 Bacteria 2626
166 Ga0207704_10198823 3300025938 Bacteria 1465
167 Ga0207691_10000426 3300025940 Bacteria 41840
168 Ga0207689_10009549 3300025942 Bacteria 8367
169 Ga0207689_10012253 3300025942 Bacteria 7334
170 Ga0207689_10018897 3300025942 Bacteria 5812
171 Ga0207667_10001491 3300025949 Bacteria 29391
172 Ga0207651_10018216 3300025960 Bacteria 4172
173 Ga0207651_10049821 3300025960 Bacteria 2840
174 Ga0207712_10210321 3300025961 Bacteria 1549
175 Ga0207712_10332838 3300025961 Bacteria 1257
176 Ga0207668_10001372 3300025972 Bacteria 14346
177 Ga0207668_10054362 3300025972 Bacteria 2779
178 Ga0207640_10043866 3300025981 Bacteria 2861
179 Ga0207658_10022335 3300025986 Unclassified 4405
180 Ga0207658_10029780 3300025986 Bacteria 3859
181 Ga0207658_10041310 3300025986 Bacteria 3339
182 Ga0207677_10011128 3300026023 Bacteria 5116
183 Ga0207703_10058923 3300026035 Bacteria 3136
184 Ga0207639_10089567 3300026041 Bacteria 2459
185 Ga0207639_10107229 3300026041 Bacteria 2269
186 Ga0207708_10213164 3300026075 Bacteria 1544
187 Ga0207641_10048790 3300026088 Unclassified 3575
188 Ga0207641_10050662 3300026088 Bacteria 3513
189 Ga0207641_10052869 3300026088 Bacteria 3441
190 Ga0207648_10010083 3300026089 Bacteria 8982
191 Ga0207648_10025344 3300026089 Bacteria 5285
192 Ga0207648_10039677 3300026089 Bacteria 4139
193 Ga0207676_10247931 3300026095 Bacteria 1601
194 Ga0207674_10004594 3300026116 Bacteria 16575
195 Ga0207675_100022077 3300026118 Bacteria 5925
196 Ga0207675_100114338 3300026118 Bacteria 2549
197 Ga0207683_10011150 3300026121 Bacteria 7662
198 Ga0207698_10014449 3300026142 Bacteria 5249
199 Ga0268266_10000016 3300028379 Bacteria 629101
200 Ga0268266_10007816 3300028379 Bacteria 9585
201 Ga0268266_10055674 3300028379 Bacteria 3400
202 Ga0268266_10078286 3300028379 Bacteria 2876
203 Ga0268264_10000015 3300028381 Bacteria 508501
204 Ga0268264_10003762 3300028381 Bacteria 13023
205 Ga0268264_10035110 3300028381 Bacteria 4128
206 Ga0265336_10026936 3300028666 Bacteria 1804
207 Ga0265338_10079195 3300028800 Bacteria 2766
208 Ga0307511_10001282 3300030521 Bacteria 26655
209 Ga0265327_10000006 3300031251 Bacteria 693716
210 Ga0307513_10087836 3300031456 Bacteria 3180
211 Ga0307509_10097133 3300031507 Bacteria 2995
212 Ga0307509_10102308 3300031507 Bacteria 2897
213 Ga0307508_10001247 3300031616 Bacteria 29056
214 Ga0307516_10089476 3300031730 Bacteria 2909
215 Ga0307510_10000042 3300033180 Bacteria 100951
216 Ga0373935_0203328 3300035692 Bacteria 1370
217 Ga0373937_0158210 3300036401 Bacteria 2124
218 Ga0395905_0126040 3300037471 Bacteria 2408
219 Ga0395901_0122417 3300038443 Bacteria 2734
220 Ga0453684_0041437 3300044712 Bacteria 6228
221 Ga0495638_0028055 3300046460 Bacteria 3638
222 Ga0495638_0049972 3300046460 Bacteria 2613
223 Ga0495648_0002775 3300046524 Bacteria 15798
224 Ga0495668_0000268 3300046616 Bacteria 73486
225 Ga0495668_0002233 3300046616 Bacteria 16405
226 Ga0495611_0000086 3300046648 Bacteria 66762
227 Ga0495625_0219421 3300046660 Bacteria 1247
228 Ga0495636_0000082 3300047318 Bacteria 40011
229 Ga0495687_000004 3300047443 Bacteria 779298
230 Ga0495686_0000128 3300047472 Bacteria 156223
231 Ga0495686_0002851 3300047472 Bacteria 15578
232 Ga0496100_0084961 3300048903 Unclassified 2147
233 Ga0496101_0012235 3300048904 Bacteria 5721
234 Ga0496109_0210371 3300048912 Bacteria 1829
235 Ga0496115_0037645 3300048918 Bacteria 3835
236 Ga0496124_0042038 3300048927 Bacteria 3938
237 Ga0496124_0098174 3300048927 Bacteria 2377
238 Ga0501034_0006168 3300049571 Bacteria 12923
239 Ga0501036_0001149 3300049572 Bacteria 20161
240 Ga0501038_0013075 3300049574 Bacteria 7571
241 Ga0501043_0013354 3300049579 Bacteria 6422
242 Ga0501047_0003691 3300049581 Bacteria 14416
243 Ga0501067_0019484 3300049583 Bacteria 3758
244 Ga0501068_0195284 3300049584 Bacteria 1283
245 Ga0501070_0006716 3300049586 Bacteria 9798
246 Ga0501073_0002127 3300049589 Bacteria 14843
247 Ga0501074_0000268 3300049590 Bacteria 29703
248 Ga0501083_0002364 3300049744 Bacteria 12916
249 Ga0501035_0006540 3300049822 Bacteria 10934
250 Ga0501044_0008384 3300049823 Bacteria 11335
251 Ga0500583_0005181 3300053092 Bacteria 4340
252 Ga0500588_0001353 3300053146 Bacteria 4631
253 Ga0500622_0003314 3300053156 Bacteria 10885
254 Ga0501084_0040748 3300054114 Bacteria 3886

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0219421 Ga0495625_0219421_92_1219 370
2 3300009093 Ga0105240_10049859 Ga0105240_100498592 371
3 3300005548 Ga0070665_100000008 Ga0070665_100000008459 372
4 3300005843 Ga0068860_100000059 Ga0068860_10000005963 372
5 3300005844 Ga0068862_100186971 Ga0068862_1001869712 372
6 3300009093 Ga0105240_10446523 Ga0105240_104465231 372
7 3300010375 Ga0105239_10055950 Ga0105239_100559503 372
8 3300013297 Ga0157378_10131141 Ga0157378_101311412 372
9 3300013306 Ga0163162_10000164 Ga0163162_1000016424 372
10 3300028379 Ga0268266_10000016 Ga0268266_10000016457 372
11 3300028381 Ga0268264_10000015 Ga0268264_10000015410 372
12 3300031730 Ga0307516_10089476 Ga0307516_100894762 372
13 3300046460 Ga0495638_0028055 Ga0495638_0028055_2256_3533 372
14 3300046524 Ga0495648_0002775 Ga0495648_0002775_14096_15373 372
15 3300047443 Ga0495687_000004 Ga0495687_000004_616087_617364 372
16 3300053092 Ga0500583_0005181 Ga0500583_0005181_967_2244 372
17 3300053156 Ga0500622_0003314 Ga0500622_0003314_5196_6473 372
18 3300009545 Ga0105237_10007857 Ga0105237_1000785712 373
19 3300025914 Ga0207671_10008487 Ga0207671_100084876 373
20 3300046460 Ga0495638_0049972 Ga0495638_0049972_1158_2381 373
21 iso_pu_bacteria 2818991444 2819585719 374
22 3300025961 Ga0207712_10210321 Ga0207712_102103211 378
23 3300048927 Ga0496124_0042038 Ga0496124_0042038_2291_3430 378
24 3300010375 Ga0105239_10060044 Ga0105239_100600441 379
25 3300009545 Ga0105237_10027387 Ga0105237_100273875 380
26 3300025914 Ga0207671_10010890 Ga0207671_100108905 380
27 3300048927 Ga0496124_0098174 Ga0496124_0098174_906_2093 380
28 3300014326 Ga0157380_10025400 Ga0157380_100254003 381
29 iso_pu_bacteria 2821136567 2821142396 382
30 iso_pu_bacteria 2904467357 2904470437 382
31 3300031507 Ga0307509_10097133 Ga0307509_100971331 384
32 iso_pu_bacteria 2818991444 2819587879 385
33 3300003320 rootH2_10100645 rootH2_101006454 386
34 3300005262 Ga0065165_1009290 Ga0065165_10092905 386
35 3300025208 Ga0209436_102339 Ga0209436_1023393 386
36 3300037471 Ga0395905_0126040 Ga0395905_0126040_1005_2183 386
37 3300046648 Ga0495611_0000086 Ga0495611_0000086_19044_20279 386
38 3300030521 Ga0307511_10001282 Ga0307511_1000128219 387
39 3300005355 Ga0070671_100015254 Ga0070671_1000152543 388
40 3300005366 Ga0070659_100010931 Ga0070659_1000109314 388
41 3300005367 Ga0070667_100042450 Ga0070667_1000424503 388
42 3300005459 Ga0068867_100028131 Ga0068867_1000281313 388
43 3300005616 Ga0068852_100118247 Ga0068852_1001182472 388
44 3300005616 Ga0068852_100330709 Ga0068852_1003307092 388
45 3300005841 Ga0068863_100195573 Ga0068863_1001955732 388
46 3300006237 Ga0097621_100000487 Ga0097621_1000004872 388
47 3300006358 Ga0068871_100000598 Ga0068871_1000005984 388
48 3300006881 Ga0068865_100184147 Ga0068865_1001841472 388
49 3300009553 Ga0105249_10029285 Ga0105249_100292851 388
50 3300013296 Ga0157374_10401458 Ga0157374_104014582 388
51 3300013297 Ga0157378_10004726 Ga0157378_100047262 388
52 3300013306 Ga0163162_10000697 Ga0163162_1000069711 388
53 3300013306 Ga0163162_10000856 Ga0163162_100008568 388
54 3300013306 Ga0163162_10029383 Ga0163162_100293832 388
55 3300013307 Ga0157372_10058445 Ga0157372_100584452 388
56 3300013308 Ga0157375_10000383 Ga0157375_1000038311 388
57 3300014325 Ga0163163_10000560 Ga0163163_100005605 388
58 3300014968 Ga0157379_10036890 Ga0157379_100368902 388
59 3300014968 Ga0157379_10127555 Ga0157379_101275551 388
60 3300017792 Ga0163161_10001190 Ga0163161_100011907 388
61 3300025904 Ga0207647_10000485 Ga0207647_100004859 388
62 3300025931 Ga0207644_10024181 Ga0207644_100241812 388
63 3300025932 Ga0207690_10014341 Ga0207690_100143414 388
64 3300025961 Ga0207712_10332838 Ga0207712_103328381 388
65 3300025986 Ga0207658_10022335 Ga0207658_100223352 388
66 3300026088 Ga0207641_10048790 Ga0207641_100487902 388
67 3300028800 Ga0265338_10079195 Ga0265338_100791951 388
68 3300048903 Ga0496100_0084961 Ga0496100_0084961_684_1859 388
69 3300048904 Ga0496101_0012235 Ga0496101_0012235_3011_4186 388
70 3300005335 Ga0070666_10014435 Ga0070666_100144352 389
71 3300005539 Ga0068853_100093387 Ga0068853_1000933871 389
72 3300009093 Ga0105240_10000767 Ga0105240_100007673 389
73 3300009551 Ga0105238_10013311 Ga0105238_100133113 389
74 3300025913 Ga0207695_10000425 Ga0207695_1000042569 389
75 3300026142 Ga0207698_10014449 Ga0207698_100144492 389
76 3300005366 Ga0070659_100026196 Ga0070659_1000261963 390
77 3300005539 Ga0068853_100022502 Ga0068853_1000225022 390
78 3300005548 Ga0070665_100003504 Ga0070665_1000035046 390
79 3300005563 Ga0068855_100056698 Ga0068855_1000566984 390
80 3300005563 Ga0068855_100217005 Ga0068855_1002170051 390
81 3300005577 Ga0068857_100004830 Ga0068857_1000048302 390
82 3300005614 Ga0068856_100107548 Ga0068856_1001075482 390
83 3300005616 Ga0068852_100024969 Ga0068852_1000249693 390
84 3300009093 Ga0105240_10253523 Ga0105240_102535231 390
85 3300009551 Ga0105238_10053188 Ga0105238_100531883 390
86 3300013104 Ga0157370_10005319 Ga0157370_1000531910 390
87 3300013105 Ga0157369_10024325 Ga0157369_100243254 390
88 3300013307 Ga0157372_10000676 Ga0157372_1000067640 390
89 3300025904 Ga0207647_10000139 Ga0207647_100001396 390
90 3300025904 Ga0207647_10033688 Ga0207647_100336882 390
91 3300025913 Ga0207695_10013688 Ga0207695_100136886 390
92 3300025914 Ga0207671_10215160 Ga0207671_102151601 390
93 3300025932 Ga0207690_10101108 Ga0207690_101011081 390
94 3300025949 Ga0207667_10001491 Ga0207667_100014915 390
95 3300025981 Ga0207640_10043866 Ga0207640_100438661 390
96 3300026041 Ga0207639_10089567 Ga0207639_100895672 390
97 3300026116 Ga0207674_10004594 Ga0207674_100045942 390
98 3300028379 Ga0268266_10007816 Ga0268266_100078165 390
99 3300031456 Ga0307513_10087836 Ga0307513_100878363 390
100 3300033180 Ga0307510_10000042 Ga0307510_1000004269 390
101 3300047472 Ga0495686_0000128 Ga0495686_0000128_15905_17107 390
102 3300049571 Ga0501034_0006168 Ga0501034_0006168_11654_12844 390
103 3300049572 Ga0501036_0001149 Ga0501036_0001149_14611_15801 390
104 3300049574 Ga0501038_0013075 Ga0501038_0013075_5182_6372 390
105 3300049579 Ga0501043_0013354 Ga0501043_0013354_4320_5510 390
106 3300049581 Ga0501047_0003691 Ga0501047_0003691_7937_9127 390
107 3300049583 Ga0501067_0019484 Ga0501067_0019484_1555_2745 390
108 3300049584 Ga0501068_0195284 Ga0501068_0195284_81_1271 390
109 3300049586 Ga0501070_0006716 Ga0501070_0006716_2310_3500 390
110 3300049589 Ga0501073_0002127 Ga0501073_0002127_8232_9422 390
111 3300049590 Ga0501074_0000268 Ga0501074_0000268_10458_11648 390
112 3300049744 Ga0501083_0002364 Ga0501083_0002364_4615_5805 390
113 3300049822 Ga0501035_0006540 Ga0501035_0006540_690_1880 390
114 3300049823 Ga0501044_0008384 Ga0501044_0008384_17_1207 390
115 3300054114 Ga0501084_0040748 Ga0501084_0040748_871_2061 390
116 3300005347 Ga0070668_100061445 Ga0070668_1000614452 391
117 3300005356 Ga0070674_100025246 Ga0070674_1000252463 391
118 3300009176 Ga0105242_10032993 Ga0105242_100329933 391
119 3300010375 Ga0105239_10048918 Ga0105239_100489181 391
120 3300013307 Ga0157372_10435319 Ga0157372_104353192 391
121 3300025942 Ga0207689_10018897 Ga0207689_100188975 391
122 3300025972 Ga0207668_10054362 Ga0207668_100543622 391
123 3300026118 Ga0207675_100022077 Ga0207675_1000220774 391
124 3300031251 Ga0265327_10000006 Ga0265327_10000006101 391
125 3300046616 Ga0495668_0002233 Ga0495668_0002233_13082_14257 391
126 3300047472 Ga0495686_0002851 Ga0495686_0002851_1235_2410 391
127 3300003320 rootH2_10074050 rootH2_100740504 392
128 3300005327 Ga0070658_10001887 Ga0070658_1000188715 392
129 3300005328 Ga0070676_10004661 Ga0070676_100046615 392
130 3300005331 Ga0070670_100314943 Ga0070670_1003149431 392
131 3300005335 Ga0070666_10000138 Ga0070666_1000013839 392
132 3300005335 Ga0070666_10030778 Ga0070666_100307783 392
133 3300005338 Ga0068868_100003136 Ga0068868_1000031362 392
134 3300005344 Ga0070661_100126844 Ga0070661_1001268441 392
135 3300005347 Ga0070668_100001278 Ga0070668_1000012782 392
136 3300005364 Ga0070673_100034796 Ga0070673_1000347963 392
137 3300005364 Ga0070673_100052793 Ga0070673_1000527932 392
138 3300005367 Ga0070667_100012604 Ga0070667_1000126042 392
139 3300005367 Ga0070667_100032121 Ga0070667_1000321211 392
140 3300005441 Ga0070700_100177072 Ga0070700_1001770722 392
141 3300005457 Ga0070662_100004967 Ga0070662_1000049675 392
142 3300005457 Ga0070662_100089432 Ga0070662_1000894321 392
143 3300005458 Ga0070681_10012225 Ga0070681_100122257 392
144 3300005459 Ga0068867_100037244 Ga0068867_1000372442 392
145 3300005539 Ga0068853_100095557 Ga0068853_1000955572 392
146 3300005543 Ga0070672_100001603 Ga0070672_10000160311 392
147 3300005543 Ga0070672_100029229 Ga0070672_1000292292 392
148 3300005548 Ga0070665_100000717 Ga0070665_1000007172 392
149 3300005548 Ga0070665_100041382 Ga0070665_1000413823 392
150 3300005616 Ga0068852_100002535 Ga0068852_1000025357 392
151 3300005616 Ga0068852_100299518 Ga0068852_1002995181 392
152 3300005617 Ga0068859_100046984 Ga0068859_1000469842 392
153 3300005618 Ga0068864_100079613 Ga0068864_1000796132 392
154 3300005618 Ga0068864_100082818 Ga0068864_1000828183 392
155 3300005719 Ga0068861_100059398 Ga0068861_1000593982 392
156 3300005834 Ga0068851_10002822 Ga0068851_100028225 392
157 3300005834 Ga0068851_10076041 Ga0068851_100760413 392
158 3300005841 Ga0068863_100092836 Ga0068863_1000928362 392
159 3300005842 Ga0068858_100098905 Ga0068858_1000989052 392
160 3300005843 Ga0068860_100003174 Ga0068860_1000031742 392
161 3300005843 Ga0068860_100013541 Ga0068860_1000135415 392
162 3300006237 Ga0097621_100103603 Ga0097621_1001036031 392
163 3300006358 Ga0068871_100114248 Ga0068871_1001142482 392
164 3300006881 Ga0068865_100008569 Ga0068865_1000085693 392
165 3300006881 Ga0068865_100221996 Ga0068865_1002219962 392
166 3300006931 Ga0097620_100046985 Ga0097620_1000469852 392
167 3300009093 Ga0105240_10009560 Ga0105240_100095604 392
168 3300009148 Ga0105243_10099703 Ga0105243_100997031 392
169 3300009174 Ga0105241_10106996 Ga0105241_101069961 392
170 3300009176 Ga0105242_10035959 Ga0105242_100359593 392
171 3300009176 Ga0105242_10156331 Ga0105242_101563312 392
172 3300009545 Ga0105237_10000128 Ga0105237_1000012845 392
173 3300009545 Ga0105237_10041295 Ga0105237_100412955 392
174 3300009553 Ga0105249_10006818 Ga0105249_100068187 392
175 3300009553 Ga0105249_10015507 Ga0105249_100155076 392
176 3300010375 Ga0105239_10025164 Ga0105239_100251643 392
177 3300010375 Ga0105239_10192858 Ga0105239_101928582 392
178 3300011119 Ga0105246_10007561 Ga0105246_100075613 392
179 3300013104 Ga0157370_10232438 Ga0157370_102324381 392
180 3300013296 Ga0157374_10017972 Ga0157374_100179722 392
181 3300013296 Ga0157374_10141936 Ga0157374_101419361 392
182 3300013297 Ga0157378_10044912 Ga0157378_100449121 392
183 3300013306 Ga0163162_10003500 Ga0163162_1000350017 392
184 3300013306 Ga0163162_10086252 Ga0163162_100862522 392
185 3300013306 Ga0163162_10145266 Ga0163162_101452661 392
186 3300013308 Ga0157375_10027280 Ga0157375_100272803 392
187 3300013308 Ga0157375_10063288 Ga0157375_100632882 392
188 3300014325 Ga0163163_10002603 Ga0163163_1000260311 392
189 3300014325 Ga0163163_10144523 Ga0163163_101445232 392
190 3300014968 Ga0157379_10001099 Ga0157379_100010992 392
191 3300014968 Ga0157379_10016875 Ga0157379_100168753 392
192 3300014968 Ga0157379_10259959 Ga0157379_102599592 392
193 3300014969 Ga0157376_10001028 Ga0157376_1000102815 392
194 3300014969 Ga0157376_10085506 Ga0157376_100855062 392
195 3300014969 Ga0157376_10252106 Ga0157376_102521061 392
196 3300025321 Ga0207656_10056661 Ga0207656_100566611 392
197 3300025893 Ga0207682_10045453 Ga0207682_100454532 392
198 3300025903 Ga0207680_10001900 Ga0207680_100019003 392
199 3300025903 Ga0207680_10023116 Ga0207680_100231162 392
200 3300025903 Ga0207680_10171810 Ga0207680_101718102 392
201 3300025907 Ga0207645_10000093 Ga0207645_100000937 392
202 3300025907 Ga0207645_10055526 Ga0207645_100555262 392
203 3300025909 Ga0207705_10036720 Ga0207705_100367202 392
204 3300025913 Ga0207695_10011272 Ga0207695_100112722 392
205 3300025914 Ga0207671_10001329 Ga0207671_1000132915 392
206 3300025914 Ga0207671_10003963 Ga0207671_100039634 392
207 3300025920 Ga0207649_10068070 Ga0207649_100680702 392
208 3300025923 Ga0207681_10037939 Ga0207681_100379393 392
209 3300025933 Ga0207706_10040539 Ga0207706_100405392 392
210 3300025937 Ga0207669_10043696 Ga0207669_100436963 392
211 3300025938 Ga0207704_10198823 Ga0207704_101988232 392
212 3300025940 Ga0207691_10000426 Ga0207691_100004267 392
213 3300025942 Ga0207689_10009549 Ga0207689_100095492 392
214 3300025942 Ga0207689_10012253 Ga0207689_100122533 392
215 3300025960 Ga0207651_10018216 Ga0207651_100182162 392
216 3300025972 Ga0207668_10001372 Ga0207668_1000137211 392
217 3300025986 Ga0207658_10029780 Ga0207658_100297802 392
218 3300025986 Ga0207658_10041310 Ga0207658_100413102 392
219 3300026023 Ga0207677_10011128 Ga0207677_100111282 392
220 3300026035 Ga0207703_10058923 Ga0207703_100589232 392
221 3300026041 Ga0207639_10107229 Ga0207639_101072292 392
222 3300026075 Ga0207708_10213164 Ga0207708_102131641 392
223 3300026088 Ga0207641_10050662 Ga0207641_100506622 392
224 3300026089 Ga0207648_10010083 Ga0207648_100100838 392
225 3300026089 Ga0207648_10025344 Ga0207648_100253444 392
226 3300026089 Ga0207648_10039677 Ga0207648_100396772 392
227 3300026095 Ga0207676_10247931 Ga0207676_102479311 392
228 3300026118 Ga0207675_100114338 Ga0207675_1001143382 392
229 3300026121 Ga0207683_10011150 Ga0207683_100111503 392
230 3300028379 Ga0268266_10055674 Ga0268266_100556742 392
231 3300028379 Ga0268266_10078286 Ga0268266_100782861 392
232 3300028381 Ga0268264_10003762 Ga0268264_100037628 392
233 3300028381 Ga0268264_10035110 Ga0268264_100351102 392
234 3300028666 Ga0265336_10026936 Ga0265336_100269362 392
235 3300031507 Ga0307509_10102308 Ga0307509_101023083 392
236 3300031616 Ga0307508_10001247 Ga0307508_1000124725 392
237 3300035692 Ga0373935_0203328 Ga0373935_0203328_69_1268 392
238 3300036401 Ga0373937_0158210 Ga0373937_0158210_623_1822 392
239 3300038443 Ga0395901_0122417 Ga0395901_0122417_135_1328 392
240 3300044712 Ga0453684_0041437 Ga0453684_0041437_2345_3535 392
241 3300046616 Ga0495668_0000268 Ga0495668_0000268_31387_32574 392
242 3300047318 Ga0495636_0000082 Ga0495636_0000082_22692_23885 392
243 3300048912 Ga0496109_0210371 Ga0496109_0210371_505_1689 392
244 3300048918 Ga0496115_0037645 Ga0496115_0037645_2538_3725 392
245 3300053146 Ga0500588_0001353 Ga0500588_0001353_2028_3227 392
246 3300005355 Ga0070671_100076696 Ga0070671_1000766962 393
247 3300005841 Ga0068863_100056574 Ga0068863_1000565746 393
248 3300006358 Ga0068871_100024719 Ga0068871_1000247193 393
249 3300013297 Ga0157378_10002981 Ga0157378_1000298118 393
250 3300013297 Ga0157378_10011873 Ga0157378_1001187310 393
251 3300013297 Ga0157378_10025187 Ga0157378_100251872 393
252 3300014968 Ga0157379_10164388 Ga0157379_101643882 393
253 3300017792 Ga0163161_10042807 Ga0163161_100428072 393
254 3300025925 Ga0207650_10064753 Ga0207650_100647532 393
255 3300025960 Ga0207651_10049821 Ga0207651_100498212 393
256 3300026088 Ga0207641_10052869 Ga0207641_100528694 393
257 2162886007 SwRhRL2b_contig_1759593 SwRhRL2b_0521.00009930 397
258 3300005289 Ga0065704_10070133 Ga0065704_10070133210 397

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

6

368

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nmp-assembly1.cif.gz_A crystal structure of human cystathionine gamma lyase 0.9674 53 385
3e6g-assembly1.cif.gz_B crystal structure of xometc, a cystathionine c-lyase-like protein from xanthomonas oryzae pv.oryzae 0.9511 52 379
3e6g-assembly1.cif.gz_D crystal structure of xometc, a cystathionine c-lyase-like protein from xanthomonas oryzae pv.oryzae 0.951 52 379
1pff-assembly1.cif.gz_A crystal structure of homocysteine alpha-, gamma-lyase at 1.8 angstroms 0.938 59 385
5x2y-assembly1.cif.gz_C crystal structure of pseudomonas putida methionine gamma-lyase c116h mutant without sulfate ion 0.9304 46 385
ID Description Score Start End Superfamily
af_P32929_263_402_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9817 250 385 3.90.1150.10
af_Q2G0V3_247_380_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9723 251 384 3.90.1150.10
2nmpB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9626 250 385 3.90.1150.10
af_A0A1D6P7H0_376_509_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9614 250 384 3.90.1150.10
1n8pD02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9589 250 386 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A3M1RXG6-F1-model_v4 PLP-dependent transferase 0.9862 213 385 GO:0003962
GO:0004123
GO:0005737
GO:0019343
GO:0019346
GO:0030170
AF-A0A0F9C274-F1-model_v4 Cystathionine gamma-synthase 0.982 278 383 GO:0005737
GO:0016846
GO:0019346
GO:0030170
AF-A0A2V9KT86-F1-model_v4 Cystathionine gamma-synthase 0.9798 251 384 GO:0005737
GO:0016846
GO:0019346
GO:0030170
AF-A0A1W1DVP1-F1-model_v4 O-acetylhomoserine sulfhydrylase / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48, EC 2.5.1.49) 0.9796 213 381 GO:0003961
GO:0003962
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-A0A7V2W9G7-F1-model_v4 O-succinylhomoserine sulfhydrylase 0.9781 231 382 GO:0005737
GO:0016846
GO:0019346
GO:0030170

Feature Viewer

pLDDT pTM Quality
84.7 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map