F368090
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 258 | 145 | 254 | 396 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10025400|Ga0157380_100254003 |
| Length | 387 |
| Sequence | MSYSTQTKLIHAIPVDPLTGSISVPIYQTSTYVQEAPGVNKGYDYARSNNPTRAVLENLIAQLENGSTGIAFGSGLAAIDAVLKLLKSGDEIIAVDDIYGGAFRLFTHVYEKFGVSVRYVDTTNVENVFNAITPQTKLIWIETPTNPTLKISDCLLCVDNTFASPALQQPLSLGADIVVHSATKYLGGHSDLIAGLVVTKEKEWGDRIKFIQNASGAILGPFDSWLVIRGIETLHLRVQQHCSNAMLIAQFLDEHPLVNKVYYPGLKDHPNYEIARRQSKGFGGIVSFTLKPDTEQAAHDFVTNTKLFKLAESLGGVKSLLCHPAQMTHKSIPAETRRAAGVIDSLIRLSVGLEDAADLIADLQQAFEAKLIVKKAHTDFFTRERNV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 3 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 4 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 105 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 106 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 107 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 108 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 109 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 110 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 111 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 112 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 116 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 128 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 129 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 131 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 143 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 144 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 145 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.45 |
| Metatranscriptomes | 0 |
| Isolates | 1.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.94 |
| Nodule | 0 |
| Rhizoplane | 1.55 |
| Rhizosphere | 90.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1759593 | 2162886007 | Bacteria | 266684 |
| 2 | rootH2_10074050 | 3300003320 | Bacteria | 7919 |
| 3 | rootH2_10100645 | 3300003320 | Bacteria | 10994 |
| 4 | Ga0065165_1009290 | 3300005262 | Unclassified | 4431 |
| 5 | Ga0065704_10070133 | 3300005289 | Bacteria | 1266035 |
| 6 | Ga0070658_10001887 | 3300005327 | Bacteria | 17678 |
| 7 | Ga0070676_10004661 | 3300005328 | Bacteria | 7243 |
| 8 | Ga0070670_100314943 | 3300005331 | Bacteria | 1370 |
| 9 | Ga0070666_10000138 | 3300005335 | Bacteria | 50719 |
| 10 | Ga0070666_10014435 | 3300005335 | Bacteria | 5030 |
| 11 | Ga0070666_10030778 | 3300005335 | Bacteria | 3538 |
| 12 | Ga0068868_100003136 | 3300005338 | Bacteria | 11506 |
| 13 | Ga0070661_100126844 | 3300005344 | Bacteria | 1915 |
| 14 | Ga0070668_100001278 | 3300005347 | Bacteria | 17995 |
| 15 | Ga0070668_100061445 | 3300005347 | Bacteria | 2910 |
| 16 | Ga0070671_100015254 | 3300005355 | Bacteria | 6205 |
| 17 | Ga0070671_100076696 | 3300005355 | Bacteria | 2793 |
| 18 | Ga0070674_100025246 | 3300005356 | Bacteria | 3867 |
| 19 | Ga0070673_100034796 | 3300005364 | Bacteria | 3816 |
| 20 | Ga0070673_100052793 | 3300005364 | Bacteria | 3190 |
| 21 | Ga0070659_100010931 | 3300005366 | Bacteria | 6699 |
| 22 | Ga0070659_100026196 | 3300005366 | Bacteria | 4485 |
| 23 | Ga0070667_100012604 | 3300005367 | Bacteria | 6992 |
| 24 | Ga0070667_100032121 | 3300005367 | Bacteria | 4378 |
| 25 | Ga0070667_100042450 | 3300005367 | Bacteria | 3816 |
| 26 | Ga0070700_100177072 | 3300005441 | Bacteria | 1481 |
| 27 | Ga0070662_100004967 | 3300005457 | Bacteria | 8451 |
| 28 | Ga0070662_100089432 | 3300005457 | Bacteria | 2310 |
| 29 | Ga0070681_10012225 | 3300005458 | Bacteria | 8511 |
| 30 | Ga0068867_100028131 | 3300005459 | Bacteria | 4045 |
| 31 | Ga0068867_100037244 | 3300005459 | Bacteria | 3535 |
| 32 | Ga0068853_100022502 | 3300005539 | Bacteria | 5265 |
| 33 | Ga0068853_100093387 | 3300005539 | Bacteria | 2649 |
| 34 | Ga0068853_100095557 | 3300005539 | Bacteria | 2621 |
| 35 | Ga0070672_100001603 | 3300005543 | Bacteria | 14052 |
| 36 | Ga0070672_100029229 | 3300005543 | Bacteria | 4132 |
| 37 | Ga0070665_100000008 | 3300005548 | Bacteria | 606341 |
| 38 | Ga0070665_100000717 | 3300005548 | Bacteria | 44083 |
| 39 | Ga0070665_100003504 | 3300005548 | Bacteria | 16699 |
| 40 | Ga0070665_100041382 | 3300005548 | Bacteria | 4631 |
| 41 | Ga0068855_100056698 | 3300005563 | Bacteria | 4595 |
| 42 | Ga0068855_100217005 | 3300005563 | Bacteria | 2147 |
| 43 | Ga0068857_100004830 | 3300005577 | Bacteria | 11421 |
| 44 | Ga0068856_100107548 | 3300005614 | Bacteria | 2784 |
| 45 | Ga0068852_100002535 | 3300005616 | Bacteria | 12580 |
| 46 | Ga0068852_100024969 | 3300005616 | Bacteria | 4836 |
| 47 | Ga0068852_100118247 | 3300005616 | Unclassified | 2422 |
| 48 | Ga0068852_100299518 | 3300005616 | Bacteria | 1556 |
| 49 | Ga0068852_100330709 | 3300005616 | Bacteria | 1482 |
| 50 | Ga0068859_100046984 | 3300005617 | Bacteria | 4336 |
| 51 | Ga0068864_100079613 | 3300005618 | Bacteria | 2869 |
| 52 | Ga0068864_100082818 | 3300005618 | Bacteria | 2816 |
| 53 | Ga0068861_100059398 | 3300005719 | Bacteria | 2928 |
| 54 | Ga0068851_10002822 | 3300005834 | Bacteria | 7654 |
| 55 | Ga0068851_10076041 | 3300005834 | Bacteria | 1746 |
| 56 | Ga0068863_100056574 | 3300005841 | Bacteria | 3713 |
| 57 | Ga0068863_100092836 | 3300005841 | Bacteria | 2864 |
| 58 | Ga0068863_100195573 | 3300005841 | Bacteria | 1944 |
| 59 | Ga0068858_100098905 | 3300005842 | Bacteria | 2720 |
| 60 | Ga0068860_100000059 | 3300005843 | Bacteria | 196400 |
| 61 | Ga0068860_100003174 | 3300005843 | Bacteria | 16956 |
| 62 | Ga0068860_100013541 | 3300005843 | Bacteria | 7996 |
| 63 | Ga0068862_100186971 | 3300005844 | Bacteria | 1862 |
| 64 | Ga0097621_100000487 | 3300006237 | Bacteria | 27766 |
| 65 | Ga0097621_100103603 | 3300006237 | Bacteria | 2397 |
| 66 | Ga0068871_100000598 | 3300006358 | Bacteria | 24790 |
| 67 | Ga0068871_100024719 | 3300006358 | Unclassified | 4662 |
| 68 | Ga0068871_100114248 | 3300006358 | Bacteria | 2274 |
| 69 | Ga0068865_100008569 | 3300006881 | Bacteria | 6321 |
| 70 | Ga0068865_100184147 | 3300006881 | Unclassified | 1610 |
| 71 | Ga0068865_100221996 | 3300006881 | Bacteria | 1478 |
| 72 | Ga0097620_100046985 | 3300006931 | Bacteria | 4336 |
| 73 | Ga0105240_10000767 | 3300009093 | Bacteria | 58332 |
| 74 | Ga0105240_10009560 | 3300009093 | Bacteria | 13726 |
| 75 | Ga0105240_10049859 | 3300009093 | Bacteria | 5281 |
| 76 | Ga0105240_10253523 | 3300009093 | Bacteria | 2034 |
| 77 | Ga0105240_10446523 | 3300009093 | Bacteria | 1448 |
| 78 | Ga0105243_10099703 | 3300009148 | Bacteria | 2408 |
| 79 | Ga0105241_10106996 | 3300009174 | Bacteria | 2233 |
| 80 | Ga0105242_10032993 | 3300009176 | Bacteria | 4143 |
| 81 | Ga0105242_10035959 | 3300009176 | Bacteria | 3971 |
| 82 | Ga0105242_10156331 | 3300009176 | Unclassified | 1992 |
| 83 | Ga0105237_10000128 | 3300009545 | Bacteria | 106338 |
| 84 | Ga0105237_10007857 | 3300009545 | Bacteria | 11628 |
| 85 | Ga0105237_10027387 | 3300009545 | Bacteria | 5819 |
| 86 | Ga0105237_10041295 | 3300009545 | Bacteria | 4652 |
| 87 | Ga0105238_10013311 | 3300009551 | Bacteria | 8299 |
| 88 | Ga0105238_10053188 | 3300009551 | Bacteria | 4069 |
| 89 | Ga0105249_10006818 | 3300009553 | Bacteria | 9961 |
| 90 | Ga0105249_10015507 | 3300009553 | Bacteria | 6745 |
| 91 | Ga0105249_10029285 | 3300009553 | Bacteria | 4972 |
| 92 | Ga0105239_10025164 | 3300010375 | Bacteria | 6556 |
| 93 | Ga0105239_10048918 | 3300010375 | Bacteria | 4635 |
| 94 | Ga0105239_10055950 | 3300010375 | Bacteria | 4328 |
| 95 | Ga0105239_10060044 | 3300010375 | Bacteria | 4173 |
| 96 | Ga0105239_10192858 | 3300010375 | Bacteria | 2281 |
| 97 | Ga0105246_10007561 | 3300011119 | Bacteria | 6667 |
| 98 | Ga0157370_10005319 | 3300013104 | Bacteria | 14456 |
| 99 | Ga0157370_10232438 | 3300013104 | Bacteria | 1706 |
| 100 | Ga0157369_10024325 | 3300013105 | Bacteria | 6740 |
| 101 | Ga0157374_10017972 | 3300013296 | Bacteria | 6234 |
| 102 | Ga0157374_10141936 | 3300013296 | Bacteria | 2332 |
| 103 | Ga0157374_10401458 | 3300013296 | Unclassified | 1367 |
| 104 | Ga0157378_10002981 | 3300013297 | Bacteria | 15034 |
| 105 | Ga0157378_10004726 | 3300013297 | Bacteria | 11942 |
| 106 | Ga0157378_10011873 | 3300013297 | Bacteria | 7627 |
| 107 | Ga0157378_10025187 | 3300013297 | Bacteria | 5242 |
| 108 | Ga0157378_10044912 | 3300013297 | Bacteria | 3924 |
| 109 | Ga0157378_10131141 | 3300013297 | Bacteria | 2320 |
| 110 | Ga0163162_10000164 | 3300013306 | Bacteria | 60866 |
| 111 | Ga0163162_10000697 | 3300013306 | Bacteria | 31013 |
| 112 | Ga0163162_10000856 | 3300013306 | Bacteria | 28341 |
| 113 | Ga0163162_10003500 | 3300013306 | Bacteria | 15011 |
| 114 | Ga0163162_10029383 | 3300013306 | Bacteria | 5439 |
| 115 | Ga0163162_10086252 | 3300013306 | Bacteria | 3217 |
| 116 | Ga0163162_10145266 | 3300013306 | Bacteria | 2488 |
| 117 | Ga0157372_10000676 | 3300013307 | Bacteria | 37536 |
| 118 | Ga0157372_10058445 | 3300013307 | Bacteria | 4311 |
| 119 | Ga0157372_10435319 | 3300013307 | Unclassified | 1529 |
| 120 | Ga0157375_10000383 | 3300013308 | Bacteria | 40397 |
| 121 | Ga0157375_10027280 | 3300013308 | Bacteria | 5337 |
| 122 | Ga0157375_10063288 | 3300013308 | Bacteria | 3680 |
| 123 | Ga0163163_10000560 | 3300014325 | Bacteria | 32679 |
| 124 | Ga0163163_10002603 | 3300014325 | Bacteria | 15288 |
| 125 | Ga0163163_10144523 | 3300014325 | Bacteria | 2422 |
| 126 | Ga0157380_10025400 | 3300014326 | Bacteria | 4492 |
| 127 | Ga0157379_10001099 | 3300014968 | Bacteria | 22094 |
| 128 | Ga0157379_10016875 | 3300014968 | Bacteria | 6426 |
| 129 | Ga0157379_10036890 | 3300014968 | Bacteria | 4359 |
| 130 | Ga0157379_10127555 | 3300014968 | Bacteria | 2289 |
| 131 | Ga0157379_10164388 | 3300014968 | Bacteria | 2003 |
| 132 | Ga0157379_10259959 | 3300014968 | Unclassified | 1577 |
| 133 | Ga0157376_10001028 | 3300014969 | Bacteria | 18245 |
| 134 | Ga0157376_10085506 | 3300014969 | Bacteria | 2718 |
| 135 | Ga0157376_10252106 | 3300014969 | Bacteria | 1649 |
| 136 | Ga0163161_10001190 | 3300017792 | Bacteria | 19553 |
| 137 | Ga0163161_10042807 | 3300017792 | Bacteria | 3258 |
| 138 | Ga0209436_102339 | 3300025208 | Bacteria | 5793 |
| 139 | Ga0207656_10056661 | 3300025321 | Bacteria | 1709 |
| 140 | Ga0207682_10045453 | 3300025893 | Bacteria | 1802 |
| 141 | Ga0207680_10001900 | 3300025903 | Bacteria | 9802 |
| 142 | Ga0207680_10023116 | 3300025903 | Bacteria | 3390 |
| 143 | Ga0207680_10171810 | 3300025903 | Bacteria | 1460 |
| 144 | Ga0207647_10000139 | 3300025904 | Bacteria | 57477 |
| 145 | Ga0207647_10000485 | 3300025904 | Bacteria | 31915 |
| 146 | Ga0207647_10033688 | 3300025904 | Bacteria | 3277 |
| 147 | Ga0207645_10000093 | 3300025907 | Bacteria | 64854 |
| 148 | Ga0207645_10055526 | 3300025907 | Bacteria | 2528 |
| 149 | Ga0207705_10036720 | 3300025909 | Bacteria | 3505 |
| 150 | Ga0207695_10000425 | 3300025913 | Bacteria | 93523 |
| 151 | Ga0207695_10011272 | 3300025913 | Bacteria | 10839 |
| 152 | Ga0207695_10013688 | 3300025913 | Bacteria | 9656 |
| 153 | Ga0207671_10001329 | 3300025914 | Bacteria | 28904 |
| 154 | Ga0207671_10003963 | 3300025914 | Bacteria | 14397 |
| 155 | Ga0207671_10008487 | 3300025914 | Bacteria | 8706 |
| 156 | Ga0207671_10010890 | 3300025914 | Bacteria | 7455 |
| 157 | Ga0207671_10215160 | 3300025914 | Bacteria | 1504 |
| 158 | Ga0207649_10068070 | 3300025920 | Bacteria | 2263 |
| 159 | Ga0207681_10037939 | 3300025923 | Bacteria | 3188 |
| 160 | Ga0207650_10064753 | 3300025925 | Unclassified | 2737 |
| 161 | Ga0207644_10024181 | 3300025931 | Unclassified | 4168 |
| 162 | Ga0207690_10014341 | 3300025932 | Bacteria | 4788 |
| 163 | Ga0207690_10101108 | 3300025932 | Bacteria | 2059 |
| 164 | Ga0207706_10040539 | 3300025933 | Bacteria | 4127 |
| 165 | Ga0207669_10043696 | 3300025937 | Bacteria | 2626 |
| 166 | Ga0207704_10198823 | 3300025938 | Bacteria | 1465 |
| 167 | Ga0207691_10000426 | 3300025940 | Bacteria | 41840 |
| 168 | Ga0207689_10009549 | 3300025942 | Bacteria | 8367 |
| 169 | Ga0207689_10012253 | 3300025942 | Bacteria | 7334 |
| 170 | Ga0207689_10018897 | 3300025942 | Bacteria | 5812 |
| 171 | Ga0207667_10001491 | 3300025949 | Bacteria | 29391 |
| 172 | Ga0207651_10018216 | 3300025960 | Bacteria | 4172 |
| 173 | Ga0207651_10049821 | 3300025960 | Bacteria | 2840 |
| 174 | Ga0207712_10210321 | 3300025961 | Bacteria | 1549 |
| 175 | Ga0207712_10332838 | 3300025961 | Bacteria | 1257 |
| 176 | Ga0207668_10001372 | 3300025972 | Bacteria | 14346 |
| 177 | Ga0207668_10054362 | 3300025972 | Bacteria | 2779 |
| 178 | Ga0207640_10043866 | 3300025981 | Bacteria | 2861 |
| 179 | Ga0207658_10022335 | 3300025986 | Unclassified | 4405 |
| 180 | Ga0207658_10029780 | 3300025986 | Bacteria | 3859 |
| 181 | Ga0207658_10041310 | 3300025986 | Bacteria | 3339 |
| 182 | Ga0207677_10011128 | 3300026023 | Bacteria | 5116 |
| 183 | Ga0207703_10058923 | 3300026035 | Bacteria | 3136 |
| 184 | Ga0207639_10089567 | 3300026041 | Bacteria | 2459 |
| 185 | Ga0207639_10107229 | 3300026041 | Bacteria | 2269 |
| 186 | Ga0207708_10213164 | 3300026075 | Bacteria | 1544 |
| 187 | Ga0207641_10048790 | 3300026088 | Unclassified | 3575 |
| 188 | Ga0207641_10050662 | 3300026088 | Bacteria | 3513 |
| 189 | Ga0207641_10052869 | 3300026088 | Bacteria | 3441 |
| 190 | Ga0207648_10010083 | 3300026089 | Bacteria | 8982 |
| 191 | Ga0207648_10025344 | 3300026089 | Bacteria | 5285 |
| 192 | Ga0207648_10039677 | 3300026089 | Bacteria | 4139 |
| 193 | Ga0207676_10247931 | 3300026095 | Bacteria | 1601 |
| 194 | Ga0207674_10004594 | 3300026116 | Bacteria | 16575 |
| 195 | Ga0207675_100022077 | 3300026118 | Bacteria | 5925 |
| 196 | Ga0207675_100114338 | 3300026118 | Bacteria | 2549 |
| 197 | Ga0207683_10011150 | 3300026121 | Bacteria | 7662 |
| 198 | Ga0207698_10014449 | 3300026142 | Bacteria | 5249 |
| 199 | Ga0268266_10000016 | 3300028379 | Bacteria | 629101 |
| 200 | Ga0268266_10007816 | 3300028379 | Bacteria | 9585 |
| 201 | Ga0268266_10055674 | 3300028379 | Bacteria | 3400 |
| 202 | Ga0268266_10078286 | 3300028379 | Bacteria | 2876 |
| 203 | Ga0268264_10000015 | 3300028381 | Bacteria | 508501 |
| 204 | Ga0268264_10003762 | 3300028381 | Bacteria | 13023 |
| 205 | Ga0268264_10035110 | 3300028381 | Bacteria | 4128 |
| 206 | Ga0265336_10026936 | 3300028666 | Bacteria | 1804 |
| 207 | Ga0265338_10079195 | 3300028800 | Bacteria | 2766 |
| 208 | Ga0307511_10001282 | 3300030521 | Bacteria | 26655 |
| 209 | Ga0265327_10000006 | 3300031251 | Bacteria | 693716 |
| 210 | Ga0307513_10087836 | 3300031456 | Bacteria | 3180 |
| 211 | Ga0307509_10097133 | 3300031507 | Bacteria | 2995 |
| 212 | Ga0307509_10102308 | 3300031507 | Bacteria | 2897 |
| 213 | Ga0307508_10001247 | 3300031616 | Bacteria | 29056 |
| 214 | Ga0307516_10089476 | 3300031730 | Bacteria | 2909 |
| 215 | Ga0307510_10000042 | 3300033180 | Bacteria | 100951 |
| 216 | Ga0373935_0203328 | 3300035692 | Bacteria | 1370 |
| 217 | Ga0373937_0158210 | 3300036401 | Bacteria | 2124 |
| 218 | Ga0395905_0126040 | 3300037471 | Bacteria | 2408 |
| 219 | Ga0395901_0122417 | 3300038443 | Bacteria | 2734 |
| 220 | Ga0453684_0041437 | 3300044712 | Bacteria | 6228 |
| 221 | Ga0495638_0028055 | 3300046460 | Bacteria | 3638 |
| 222 | Ga0495638_0049972 | 3300046460 | Bacteria | 2613 |
| 223 | Ga0495648_0002775 | 3300046524 | Bacteria | 15798 |
| 224 | Ga0495668_0000268 | 3300046616 | Bacteria | 73486 |
| 225 | Ga0495668_0002233 | 3300046616 | Bacteria | 16405 |
| 226 | Ga0495611_0000086 | 3300046648 | Bacteria | 66762 |
| 227 | Ga0495625_0219421 | 3300046660 | Bacteria | 1247 |
| 228 | Ga0495636_0000082 | 3300047318 | Bacteria | 40011 |
| 229 | Ga0495687_000004 | 3300047443 | Bacteria | 779298 |
| 230 | Ga0495686_0000128 | 3300047472 | Bacteria | 156223 |
| 231 | Ga0495686_0002851 | 3300047472 | Bacteria | 15578 |
| 232 | Ga0496100_0084961 | 3300048903 | Unclassified | 2147 |
| 233 | Ga0496101_0012235 | 3300048904 | Bacteria | 5721 |
| 234 | Ga0496109_0210371 | 3300048912 | Bacteria | 1829 |
| 235 | Ga0496115_0037645 | 3300048918 | Bacteria | 3835 |
| 236 | Ga0496124_0042038 | 3300048927 | Bacteria | 3938 |
| 237 | Ga0496124_0098174 | 3300048927 | Bacteria | 2377 |
| 238 | Ga0501034_0006168 | 3300049571 | Bacteria | 12923 |
| 239 | Ga0501036_0001149 | 3300049572 | Bacteria | 20161 |
| 240 | Ga0501038_0013075 | 3300049574 | Bacteria | 7571 |
| 241 | Ga0501043_0013354 | 3300049579 | Bacteria | 6422 |
| 242 | Ga0501047_0003691 | 3300049581 | Bacteria | 14416 |
| 243 | Ga0501067_0019484 | 3300049583 | Bacteria | 3758 |
| 244 | Ga0501068_0195284 | 3300049584 | Bacteria | 1283 |
| 245 | Ga0501070_0006716 | 3300049586 | Bacteria | 9798 |
| 246 | Ga0501073_0002127 | 3300049589 | Bacteria | 14843 |
| 247 | Ga0501074_0000268 | 3300049590 | Bacteria | 29703 |
| 248 | Ga0501083_0002364 | 3300049744 | Bacteria | 12916 |
| 249 | Ga0501035_0006540 | 3300049822 | Bacteria | 10934 |
| 250 | Ga0501044_0008384 | 3300049823 | Bacteria | 11335 |
| 251 | Ga0500583_0005181 | 3300053092 | Bacteria | 4340 |
| 252 | Ga0500588_0001353 | 3300053146 | Bacteria | 4631 |
| 253 | Ga0500622_0003314 | 3300053156 | Bacteria | 10885 |
| 254 | Ga0501084_0040748 | 3300054114 | Bacteria | 3886 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046660 | Ga0495625_0219421 | Ga0495625_0219421_92_1219 | 370 |
| 2 | 3300009093 | Ga0105240_10049859 | Ga0105240_100498592 | 371 |
| 3 | 3300005548 | Ga0070665_100000008 | Ga0070665_100000008459 | 372 |
| 4 | 3300005843 | Ga0068860_100000059 | Ga0068860_10000005963 | 372 |
| 5 | 3300005844 | Ga0068862_100186971 | Ga0068862_1001869712 | 372 |
| 6 | 3300009093 | Ga0105240_10446523 | Ga0105240_104465231 | 372 |
| 7 | 3300010375 | Ga0105239_10055950 | Ga0105239_100559503 | 372 |
| 8 | 3300013297 | Ga0157378_10131141 | Ga0157378_101311412 | 372 |
| 9 | 3300013306 | Ga0163162_10000164 | Ga0163162_1000016424 | 372 |
| 10 | 3300028379 | Ga0268266_10000016 | Ga0268266_10000016457 | 372 |
| 11 | 3300028381 | Ga0268264_10000015 | Ga0268264_10000015410 | 372 |
| 12 | 3300031730 | Ga0307516_10089476 | Ga0307516_100894762 | 372 |
| 13 | 3300046460 | Ga0495638_0028055 | Ga0495638_0028055_2256_3533 | 372 |
| 14 | 3300046524 | Ga0495648_0002775 | Ga0495648_0002775_14096_15373 | 372 |
| 15 | 3300047443 | Ga0495687_000004 | Ga0495687_000004_616087_617364 | 372 |
| 16 | 3300053092 | Ga0500583_0005181 | Ga0500583_0005181_967_2244 | 372 |
| 17 | 3300053156 | Ga0500622_0003314 | Ga0500622_0003314_5196_6473 | 372 |
| 18 | 3300009545 | Ga0105237_10007857 | Ga0105237_1000785712 | 373 |
| 19 | 3300025914 | Ga0207671_10008487 | Ga0207671_100084876 | 373 |
| 20 | 3300046460 | Ga0495638_0049972 | Ga0495638_0049972_1158_2381 | 373 |
| 21 | iso_pu_bacteria | 2818991444 | 2819585719 | 374 |
| 22 | 3300025961 | Ga0207712_10210321 | Ga0207712_102103211 | 378 |
| 23 | 3300048927 | Ga0496124_0042038 | Ga0496124_0042038_2291_3430 | 378 |
| 24 | 3300010375 | Ga0105239_10060044 | Ga0105239_100600441 | 379 |
| 25 | 3300009545 | Ga0105237_10027387 | Ga0105237_100273875 | 380 |
| 26 | 3300025914 | Ga0207671_10010890 | Ga0207671_100108905 | 380 |
| 27 | 3300048927 | Ga0496124_0098174 | Ga0496124_0098174_906_2093 | 380 |
| 28 | 3300014326 | Ga0157380_10025400 | Ga0157380_100254003 | 381 |
| 29 | iso_pu_bacteria | 2821136567 | 2821142396 | 382 |
| 30 | iso_pu_bacteria | 2904467357 | 2904470437 | 382 |
| 31 | 3300031507 | Ga0307509_10097133 | Ga0307509_100971331 | 384 |
| 32 | iso_pu_bacteria | 2818991444 | 2819587879 | 385 |
| 33 | 3300003320 | rootH2_10100645 | rootH2_101006454 | 386 |
| 34 | 3300005262 | Ga0065165_1009290 | Ga0065165_10092905 | 386 |
| 35 | 3300025208 | Ga0209436_102339 | Ga0209436_1023393 | 386 |
| 36 | 3300037471 | Ga0395905_0126040 | Ga0395905_0126040_1005_2183 | 386 |
| 37 | 3300046648 | Ga0495611_0000086 | Ga0495611_0000086_19044_20279 | 386 |
| 38 | 3300030521 | Ga0307511_10001282 | Ga0307511_1000128219 | 387 |
| 39 | 3300005355 | Ga0070671_100015254 | Ga0070671_1000152543 | 388 |
| 40 | 3300005366 | Ga0070659_100010931 | Ga0070659_1000109314 | 388 |
| 41 | 3300005367 | Ga0070667_100042450 | Ga0070667_1000424503 | 388 |
| 42 | 3300005459 | Ga0068867_100028131 | Ga0068867_1000281313 | 388 |
| 43 | 3300005616 | Ga0068852_100118247 | Ga0068852_1001182472 | 388 |
| 44 | 3300005616 | Ga0068852_100330709 | Ga0068852_1003307092 | 388 |
| 45 | 3300005841 | Ga0068863_100195573 | Ga0068863_1001955732 | 388 |
| 46 | 3300006237 | Ga0097621_100000487 | Ga0097621_1000004872 | 388 |
| 47 | 3300006358 | Ga0068871_100000598 | Ga0068871_1000005984 | 388 |
| 48 | 3300006881 | Ga0068865_100184147 | Ga0068865_1001841472 | 388 |
| 49 | 3300009553 | Ga0105249_10029285 | Ga0105249_100292851 | 388 |
| 50 | 3300013296 | Ga0157374_10401458 | Ga0157374_104014582 | 388 |
| 51 | 3300013297 | Ga0157378_10004726 | Ga0157378_100047262 | 388 |
| 52 | 3300013306 | Ga0163162_10000697 | Ga0163162_1000069711 | 388 |
| 53 | 3300013306 | Ga0163162_10000856 | Ga0163162_100008568 | 388 |
| 54 | 3300013306 | Ga0163162_10029383 | Ga0163162_100293832 | 388 |
| 55 | 3300013307 | Ga0157372_10058445 | Ga0157372_100584452 | 388 |
| 56 | 3300013308 | Ga0157375_10000383 | Ga0157375_1000038311 | 388 |
| 57 | 3300014325 | Ga0163163_10000560 | Ga0163163_100005605 | 388 |
| 58 | 3300014968 | Ga0157379_10036890 | Ga0157379_100368902 | 388 |
| 59 | 3300014968 | Ga0157379_10127555 | Ga0157379_101275551 | 388 |
| 60 | 3300017792 | Ga0163161_10001190 | Ga0163161_100011907 | 388 |
| 61 | 3300025904 | Ga0207647_10000485 | Ga0207647_100004859 | 388 |
| 62 | 3300025931 | Ga0207644_10024181 | Ga0207644_100241812 | 388 |
| 63 | 3300025932 | Ga0207690_10014341 | Ga0207690_100143414 | 388 |
| 64 | 3300025961 | Ga0207712_10332838 | Ga0207712_103328381 | 388 |
| 65 | 3300025986 | Ga0207658_10022335 | Ga0207658_100223352 | 388 |
| 66 | 3300026088 | Ga0207641_10048790 | Ga0207641_100487902 | 388 |
| 67 | 3300028800 | Ga0265338_10079195 | Ga0265338_100791951 | 388 |
| 68 | 3300048903 | Ga0496100_0084961 | Ga0496100_0084961_684_1859 | 388 |
| 69 | 3300048904 | Ga0496101_0012235 | Ga0496101_0012235_3011_4186 | 388 |
| 70 | 3300005335 | Ga0070666_10014435 | Ga0070666_100144352 | 389 |
| 71 | 3300005539 | Ga0068853_100093387 | Ga0068853_1000933871 | 389 |
| 72 | 3300009093 | Ga0105240_10000767 | Ga0105240_100007673 | 389 |
| 73 | 3300009551 | Ga0105238_10013311 | Ga0105238_100133113 | 389 |
| 74 | 3300025913 | Ga0207695_10000425 | Ga0207695_1000042569 | 389 |
| 75 | 3300026142 | Ga0207698_10014449 | Ga0207698_100144492 | 389 |
| 76 | 3300005366 | Ga0070659_100026196 | Ga0070659_1000261963 | 390 |
| 77 | 3300005539 | Ga0068853_100022502 | Ga0068853_1000225022 | 390 |
| 78 | 3300005548 | Ga0070665_100003504 | Ga0070665_1000035046 | 390 |
| 79 | 3300005563 | Ga0068855_100056698 | Ga0068855_1000566984 | 390 |
| 80 | 3300005563 | Ga0068855_100217005 | Ga0068855_1002170051 | 390 |
| 81 | 3300005577 | Ga0068857_100004830 | Ga0068857_1000048302 | 390 |
| 82 | 3300005614 | Ga0068856_100107548 | Ga0068856_1001075482 | 390 |
| 83 | 3300005616 | Ga0068852_100024969 | Ga0068852_1000249693 | 390 |
| 84 | 3300009093 | Ga0105240_10253523 | Ga0105240_102535231 | 390 |
| 85 | 3300009551 | Ga0105238_10053188 | Ga0105238_100531883 | 390 |
| 86 | 3300013104 | Ga0157370_10005319 | Ga0157370_1000531910 | 390 |
| 87 | 3300013105 | Ga0157369_10024325 | Ga0157369_100243254 | 390 |
| 88 | 3300013307 | Ga0157372_10000676 | Ga0157372_1000067640 | 390 |
| 89 | 3300025904 | Ga0207647_10000139 | Ga0207647_100001396 | 390 |
| 90 | 3300025904 | Ga0207647_10033688 | Ga0207647_100336882 | 390 |
| 91 | 3300025913 | Ga0207695_10013688 | Ga0207695_100136886 | 390 |
| 92 | 3300025914 | Ga0207671_10215160 | Ga0207671_102151601 | 390 |
| 93 | 3300025932 | Ga0207690_10101108 | Ga0207690_101011081 | 390 |
| 94 | 3300025949 | Ga0207667_10001491 | Ga0207667_100014915 | 390 |
| 95 | 3300025981 | Ga0207640_10043866 | Ga0207640_100438661 | 390 |
| 96 | 3300026041 | Ga0207639_10089567 | Ga0207639_100895672 | 390 |
| 97 | 3300026116 | Ga0207674_10004594 | Ga0207674_100045942 | 390 |
| 98 | 3300028379 | Ga0268266_10007816 | Ga0268266_100078165 | 390 |
| 99 | 3300031456 | Ga0307513_10087836 | Ga0307513_100878363 | 390 |
| 100 | 3300033180 | Ga0307510_10000042 | Ga0307510_1000004269 | 390 |
| 101 | 3300047472 | Ga0495686_0000128 | Ga0495686_0000128_15905_17107 | 390 |
| 102 | 3300049571 | Ga0501034_0006168 | Ga0501034_0006168_11654_12844 | 390 |
| 103 | 3300049572 | Ga0501036_0001149 | Ga0501036_0001149_14611_15801 | 390 |
| 104 | 3300049574 | Ga0501038_0013075 | Ga0501038_0013075_5182_6372 | 390 |
| 105 | 3300049579 | Ga0501043_0013354 | Ga0501043_0013354_4320_5510 | 390 |
| 106 | 3300049581 | Ga0501047_0003691 | Ga0501047_0003691_7937_9127 | 390 |
| 107 | 3300049583 | Ga0501067_0019484 | Ga0501067_0019484_1555_2745 | 390 |
| 108 | 3300049584 | Ga0501068_0195284 | Ga0501068_0195284_81_1271 | 390 |
| 109 | 3300049586 | Ga0501070_0006716 | Ga0501070_0006716_2310_3500 | 390 |
| 110 | 3300049589 | Ga0501073_0002127 | Ga0501073_0002127_8232_9422 | 390 |
| 111 | 3300049590 | Ga0501074_0000268 | Ga0501074_0000268_10458_11648 | 390 |
| 112 | 3300049744 | Ga0501083_0002364 | Ga0501083_0002364_4615_5805 | 390 |
| 113 | 3300049822 | Ga0501035_0006540 | Ga0501035_0006540_690_1880 | 390 |
| 114 | 3300049823 | Ga0501044_0008384 | Ga0501044_0008384_17_1207 | 390 |
| 115 | 3300054114 | Ga0501084_0040748 | Ga0501084_0040748_871_2061 | 390 |
| 116 | 3300005347 | Ga0070668_100061445 | Ga0070668_1000614452 | 391 |
| 117 | 3300005356 | Ga0070674_100025246 | Ga0070674_1000252463 | 391 |
| 118 | 3300009176 | Ga0105242_10032993 | Ga0105242_100329933 | 391 |
| 119 | 3300010375 | Ga0105239_10048918 | Ga0105239_100489181 | 391 |
| 120 | 3300013307 | Ga0157372_10435319 | Ga0157372_104353192 | 391 |
| 121 | 3300025942 | Ga0207689_10018897 | Ga0207689_100188975 | 391 |
| 122 | 3300025972 | Ga0207668_10054362 | Ga0207668_100543622 | 391 |
| 123 | 3300026118 | Ga0207675_100022077 | Ga0207675_1000220774 | 391 |
| 124 | 3300031251 | Ga0265327_10000006 | Ga0265327_10000006101 | 391 |
| 125 | 3300046616 | Ga0495668_0002233 | Ga0495668_0002233_13082_14257 | 391 |
| 126 | 3300047472 | Ga0495686_0002851 | Ga0495686_0002851_1235_2410 | 391 |
| 127 | 3300003320 | rootH2_10074050 | rootH2_100740504 | 392 |
| 128 | 3300005327 | Ga0070658_10001887 | Ga0070658_1000188715 | 392 |
| 129 | 3300005328 | Ga0070676_10004661 | Ga0070676_100046615 | 392 |
| 130 | 3300005331 | Ga0070670_100314943 | Ga0070670_1003149431 | 392 |
| 131 | 3300005335 | Ga0070666_10000138 | Ga0070666_1000013839 | 392 |
| 132 | 3300005335 | Ga0070666_10030778 | Ga0070666_100307783 | 392 |
| 133 | 3300005338 | Ga0068868_100003136 | Ga0068868_1000031362 | 392 |
| 134 | 3300005344 | Ga0070661_100126844 | Ga0070661_1001268441 | 392 |
| 135 | 3300005347 | Ga0070668_100001278 | Ga0070668_1000012782 | 392 |
| 136 | 3300005364 | Ga0070673_100034796 | Ga0070673_1000347963 | 392 |
| 137 | 3300005364 | Ga0070673_100052793 | Ga0070673_1000527932 | 392 |
| 138 | 3300005367 | Ga0070667_100012604 | Ga0070667_1000126042 | 392 |
| 139 | 3300005367 | Ga0070667_100032121 | Ga0070667_1000321211 | 392 |
| 140 | 3300005441 | Ga0070700_100177072 | Ga0070700_1001770722 | 392 |
| 141 | 3300005457 | Ga0070662_100004967 | Ga0070662_1000049675 | 392 |
| 142 | 3300005457 | Ga0070662_100089432 | Ga0070662_1000894321 | 392 |
| 143 | 3300005458 | Ga0070681_10012225 | Ga0070681_100122257 | 392 |
| 144 | 3300005459 | Ga0068867_100037244 | Ga0068867_1000372442 | 392 |
| 145 | 3300005539 | Ga0068853_100095557 | Ga0068853_1000955572 | 392 |
| 146 | 3300005543 | Ga0070672_100001603 | Ga0070672_10000160311 | 392 |
| 147 | 3300005543 | Ga0070672_100029229 | Ga0070672_1000292292 | 392 |
| 148 | 3300005548 | Ga0070665_100000717 | Ga0070665_1000007172 | 392 |
| 149 | 3300005548 | Ga0070665_100041382 | Ga0070665_1000413823 | 392 |
| 150 | 3300005616 | Ga0068852_100002535 | Ga0068852_1000025357 | 392 |
| 151 | 3300005616 | Ga0068852_100299518 | Ga0068852_1002995181 | 392 |
| 152 | 3300005617 | Ga0068859_100046984 | Ga0068859_1000469842 | 392 |
| 153 | 3300005618 | Ga0068864_100079613 | Ga0068864_1000796132 | 392 |
| 154 | 3300005618 | Ga0068864_100082818 | Ga0068864_1000828183 | 392 |
| 155 | 3300005719 | Ga0068861_100059398 | Ga0068861_1000593982 | 392 |
| 156 | 3300005834 | Ga0068851_10002822 | Ga0068851_100028225 | 392 |
| 157 | 3300005834 | Ga0068851_10076041 | Ga0068851_100760413 | 392 |
| 158 | 3300005841 | Ga0068863_100092836 | Ga0068863_1000928362 | 392 |
| 159 | 3300005842 | Ga0068858_100098905 | Ga0068858_1000989052 | 392 |
| 160 | 3300005843 | Ga0068860_100003174 | Ga0068860_1000031742 | 392 |
| 161 | 3300005843 | Ga0068860_100013541 | Ga0068860_1000135415 | 392 |
| 162 | 3300006237 | Ga0097621_100103603 | Ga0097621_1001036031 | 392 |
| 163 | 3300006358 | Ga0068871_100114248 | Ga0068871_1001142482 | 392 |
| 164 | 3300006881 | Ga0068865_100008569 | Ga0068865_1000085693 | 392 |
| 165 | 3300006881 | Ga0068865_100221996 | Ga0068865_1002219962 | 392 |
| 166 | 3300006931 | Ga0097620_100046985 | Ga0097620_1000469852 | 392 |
| 167 | 3300009093 | Ga0105240_10009560 | Ga0105240_100095604 | 392 |
| 168 | 3300009148 | Ga0105243_10099703 | Ga0105243_100997031 | 392 |
| 169 | 3300009174 | Ga0105241_10106996 | Ga0105241_101069961 | 392 |
| 170 | 3300009176 | Ga0105242_10035959 | Ga0105242_100359593 | 392 |
| 171 | 3300009176 | Ga0105242_10156331 | Ga0105242_101563312 | 392 |
| 172 | 3300009545 | Ga0105237_10000128 | Ga0105237_1000012845 | 392 |
| 173 | 3300009545 | Ga0105237_10041295 | Ga0105237_100412955 | 392 |
| 174 | 3300009553 | Ga0105249_10006818 | Ga0105249_100068187 | 392 |
| 175 | 3300009553 | Ga0105249_10015507 | Ga0105249_100155076 | 392 |
| 176 | 3300010375 | Ga0105239_10025164 | Ga0105239_100251643 | 392 |
| 177 | 3300010375 | Ga0105239_10192858 | Ga0105239_101928582 | 392 |
| 178 | 3300011119 | Ga0105246_10007561 | Ga0105246_100075613 | 392 |
| 179 | 3300013104 | Ga0157370_10232438 | Ga0157370_102324381 | 392 |
| 180 | 3300013296 | Ga0157374_10017972 | Ga0157374_100179722 | 392 |
| 181 | 3300013296 | Ga0157374_10141936 | Ga0157374_101419361 | 392 |
| 182 | 3300013297 | Ga0157378_10044912 | Ga0157378_100449121 | 392 |
| 183 | 3300013306 | Ga0163162_10003500 | Ga0163162_1000350017 | 392 |
| 184 | 3300013306 | Ga0163162_10086252 | Ga0163162_100862522 | 392 |
| 185 | 3300013306 | Ga0163162_10145266 | Ga0163162_101452661 | 392 |
| 186 | 3300013308 | Ga0157375_10027280 | Ga0157375_100272803 | 392 |
| 187 | 3300013308 | Ga0157375_10063288 | Ga0157375_100632882 | 392 |
| 188 | 3300014325 | Ga0163163_10002603 | Ga0163163_1000260311 | 392 |
| 189 | 3300014325 | Ga0163163_10144523 | Ga0163163_101445232 | 392 |
| 190 | 3300014968 | Ga0157379_10001099 | Ga0157379_100010992 | 392 |
| 191 | 3300014968 | Ga0157379_10016875 | Ga0157379_100168753 | 392 |
| 192 | 3300014968 | Ga0157379_10259959 | Ga0157379_102599592 | 392 |
| 193 | 3300014969 | Ga0157376_10001028 | Ga0157376_1000102815 | 392 |
| 194 | 3300014969 | Ga0157376_10085506 | Ga0157376_100855062 | 392 |
| 195 | 3300014969 | Ga0157376_10252106 | Ga0157376_102521061 | 392 |
| 196 | 3300025321 | Ga0207656_10056661 | Ga0207656_100566611 | 392 |
| 197 | 3300025893 | Ga0207682_10045453 | Ga0207682_100454532 | 392 |
| 198 | 3300025903 | Ga0207680_10001900 | Ga0207680_100019003 | 392 |
| 199 | 3300025903 | Ga0207680_10023116 | Ga0207680_100231162 | 392 |
| 200 | 3300025903 | Ga0207680_10171810 | Ga0207680_101718102 | 392 |
| 201 | 3300025907 | Ga0207645_10000093 | Ga0207645_100000937 | 392 |
| 202 | 3300025907 | Ga0207645_10055526 | Ga0207645_100555262 | 392 |
| 203 | 3300025909 | Ga0207705_10036720 | Ga0207705_100367202 | 392 |
| 204 | 3300025913 | Ga0207695_10011272 | Ga0207695_100112722 | 392 |
| 205 | 3300025914 | Ga0207671_10001329 | Ga0207671_1000132915 | 392 |
| 206 | 3300025914 | Ga0207671_10003963 | Ga0207671_100039634 | 392 |
| 207 | 3300025920 | Ga0207649_10068070 | Ga0207649_100680702 | 392 |
| 208 | 3300025923 | Ga0207681_10037939 | Ga0207681_100379393 | 392 |
| 209 | 3300025933 | Ga0207706_10040539 | Ga0207706_100405392 | 392 |
| 210 | 3300025937 | Ga0207669_10043696 | Ga0207669_100436963 | 392 |
| 211 | 3300025938 | Ga0207704_10198823 | Ga0207704_101988232 | 392 |
| 212 | 3300025940 | Ga0207691_10000426 | Ga0207691_100004267 | 392 |
| 213 | 3300025942 | Ga0207689_10009549 | Ga0207689_100095492 | 392 |
| 214 | 3300025942 | Ga0207689_10012253 | Ga0207689_100122533 | 392 |
| 215 | 3300025960 | Ga0207651_10018216 | Ga0207651_100182162 | 392 |
| 216 | 3300025972 | Ga0207668_10001372 | Ga0207668_1000137211 | 392 |
| 217 | 3300025986 | Ga0207658_10029780 | Ga0207658_100297802 | 392 |
| 218 | 3300025986 | Ga0207658_10041310 | Ga0207658_100413102 | 392 |
| 219 | 3300026023 | Ga0207677_10011128 | Ga0207677_100111282 | 392 |
| 220 | 3300026035 | Ga0207703_10058923 | Ga0207703_100589232 | 392 |
| 221 | 3300026041 | Ga0207639_10107229 | Ga0207639_101072292 | 392 |
| 222 | 3300026075 | Ga0207708_10213164 | Ga0207708_102131641 | 392 |
| 223 | 3300026088 | Ga0207641_10050662 | Ga0207641_100506622 | 392 |
| 224 | 3300026089 | Ga0207648_10010083 | Ga0207648_100100838 | 392 |
| 225 | 3300026089 | Ga0207648_10025344 | Ga0207648_100253444 | 392 |
| 226 | 3300026089 | Ga0207648_10039677 | Ga0207648_100396772 | 392 |
| 227 | 3300026095 | Ga0207676_10247931 | Ga0207676_102479311 | 392 |
| 228 | 3300026118 | Ga0207675_100114338 | Ga0207675_1001143382 | 392 |
| 229 | 3300026121 | Ga0207683_10011150 | Ga0207683_100111503 | 392 |
| 230 | 3300028379 | Ga0268266_10055674 | Ga0268266_100556742 | 392 |
| 231 | 3300028379 | Ga0268266_10078286 | Ga0268266_100782861 | 392 |
| 232 | 3300028381 | Ga0268264_10003762 | Ga0268264_100037628 | 392 |
| 233 | 3300028381 | Ga0268264_10035110 | Ga0268264_100351102 | 392 |
| 234 | 3300028666 | Ga0265336_10026936 | Ga0265336_100269362 | 392 |
| 235 | 3300031507 | Ga0307509_10102308 | Ga0307509_101023083 | 392 |
| 236 | 3300031616 | Ga0307508_10001247 | Ga0307508_1000124725 | 392 |
| 237 | 3300035692 | Ga0373935_0203328 | Ga0373935_0203328_69_1268 | 392 |
| 238 | 3300036401 | Ga0373937_0158210 | Ga0373937_0158210_623_1822 | 392 |
| 239 | 3300038443 | Ga0395901_0122417 | Ga0395901_0122417_135_1328 | 392 |
| 240 | 3300044712 | Ga0453684_0041437 | Ga0453684_0041437_2345_3535 | 392 |
| 241 | 3300046616 | Ga0495668_0000268 | Ga0495668_0000268_31387_32574 | 392 |
| 242 | 3300047318 | Ga0495636_0000082 | Ga0495636_0000082_22692_23885 | 392 |
| 243 | 3300048912 | Ga0496109_0210371 | Ga0496109_0210371_505_1689 | 392 |
| 244 | 3300048918 | Ga0496115_0037645 | Ga0496115_0037645_2538_3725 | 392 |
| 245 | 3300053146 | Ga0500588_0001353 | Ga0500588_0001353_2028_3227 | 392 |
| 246 | 3300005355 | Ga0070671_100076696 | Ga0070671_1000766962 | 393 |
| 247 | 3300005841 | Ga0068863_100056574 | Ga0068863_1000565746 | 393 |
| 248 | 3300006358 | Ga0068871_100024719 | Ga0068871_1000247193 | 393 |
| 249 | 3300013297 | Ga0157378_10002981 | Ga0157378_1000298118 | 393 |
| 250 | 3300013297 | Ga0157378_10011873 | Ga0157378_1001187310 | 393 |
| 251 | 3300013297 | Ga0157378_10025187 | Ga0157378_100251872 | 393 |
| 252 | 3300014968 | Ga0157379_10164388 | Ga0157379_101643882 | 393 |
| 253 | 3300017792 | Ga0163161_10042807 | Ga0163161_100428072 | 393 |
| 254 | 3300025925 | Ga0207650_10064753 | Ga0207650_100647532 | 393 |
| 255 | 3300025960 | Ga0207651_10049821 | Ga0207651_100498212 | 393 |
| 256 | 3300026088 | Ga0207641_10052869 | Ga0207641_100528694 | 393 |
| 257 | 2162886007 | SwRhRL2b_contig_1759593 | SwRhRL2b_0521.00009930 | 397 |
| 258 | 3300005289 | Ga0065704_10070133 | Ga0065704_10070133210 | 397 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nmp-assembly1.cif.gz_A | crystal structure of human cystathionine gamma lyase | 0.9674 | 53 | 385 |
| 3e6g-assembly1.cif.gz_B | crystal structure of xometc, a cystathionine c-lyase-like protein from xanthomonas oryzae pv.oryzae | 0.9511 | 52 | 379 |
| 3e6g-assembly1.cif.gz_D | crystal structure of xometc, a cystathionine c-lyase-like protein from xanthomonas oryzae pv.oryzae | 0.951 | 52 | 379 |
| 1pff-assembly1.cif.gz_A | crystal structure of homocysteine alpha-, gamma-lyase at 1.8 angstroms | 0.938 | 59 | 385 |
| 5x2y-assembly1.cif.gz_C | crystal structure of pseudomonas putida methionine gamma-lyase c116h mutant without sulfate ion | 0.9304 | 46 | 385 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P32929_263_402_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9817 | 250 | 385 | 3.90.1150.10 |
| af_Q2G0V3_247_380_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9723 | 251 | 384 | 3.90.1150.10 |
| 2nmpB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9626 | 250 | 385 | 3.90.1150.10 |
| af_A0A1D6P7H0_376_509_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9614 | 250 | 384 | 3.90.1150.10 |
| 1n8pD02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9589 | 250 | 386 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1RXG6-F1-model_v4 | PLP-dependent transferase | 0.9862 | 213 | 385 |
GO:0003962
GO:0004123 GO:0005737 GO:0019343 GO:0019346 GO:0030170 |
| AF-A0A0F9C274-F1-model_v4 | Cystathionine gamma-synthase | 0.982 | 278 | 383 |
GO:0005737
GO:0016846 GO:0019346 GO:0030170 |
| AF-A0A2V9KT86-F1-model_v4 | Cystathionine gamma-synthase | 0.9798 | 251 | 384 |
GO:0005737
GO:0016846 GO:0019346 GO:0030170 |
| AF-A0A1W1DVP1-F1-model_v4 | O-acetylhomoserine sulfhydrylase / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48, EC 2.5.1.49) | 0.9796 | 213 | 381 |
GO:0003961
GO:0003962 GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-A0A7V2W9G7-F1-model_v4 | O-succinylhomoserine sulfhydrylase | 0.9781 | 231 | 382 |
GO:0005737
GO:0016846 GO:0019346 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar