F367826

General Info

Members Datasets Scaffolds Average Seq Length
258 156 256 142

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10420440|Ga0070676_104204402
Length 143
Sequence MRDDLAAANVNRAYSLAATSIAIFTFVLVFLYPRFASGEANPFLFQAALVVMGVATFSFAFASFYYYGSSLGGSRIHDAVRARYSSRGDRLWLLGCTLLFLDPSVILFSVRLIVVGSAWLALWLAYLLFVIRHFPRVATSHKK

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2643221695 Lysobacter sp. Root494 Isolate Unclassified
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
103 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
104 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
105 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
106 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
107 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
108 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
112 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
118 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
131 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
132 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
133 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
134 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
135 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
136 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
137 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
138 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
139 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
140 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
145 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
146 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
147 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.02
Nodule 0
Rhizoplane 1.55
Rhizosphere 86.05
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_345482 2162886011 Bacteria 1431
2 JGI25151J46595_10046076 3300003187 Bacteria 1531
3 Ga0055526_1014153 3300003771 Bacteria 3306
4 Ga0055524_1001016 3300003775 Bacteria 17365
5 Ga0055524_1009455 3300003775 Bacteria 3960
6 Ga0055534_1017025 3300003784 Bacteria 1293
7 Ga0055528_1021639 3300003790 Bacteria 2032
8 Ga0055530_10003167 3300003791 Bacteria 9663
9 Ga0055531_10000379 3300003794 Bacteria 42856
10 Ga0055531_10000852 3300003794 Bacteria 25159
11 Ga0055531_10049496 3300003794 Bacteria 1122
12 Ga0065712_10121776 3300005290 Bacteria 1660
13 Ga0070658_10007945 3300005327 Bacteria 8541
14 Ga0070676_10420440 3300005328 Bacteria 934
15 Ga0070683_100358318 3300005329 Bacteria 1389
16 Ga0070690_100103344 3300005330 Bacteria 1892
17 Ga0070670_100050244 3300005331 Bacteria 3584
18 Ga0070677_10069869 3300005333 Bacteria 1474
19 Ga0070680_100740973 3300005336 Unclassified 846
20 Ga0070691_10253447 3300005341 Bacteria 945
21 Ga0070661_101018100 3300005344 Bacteria 688
22 Ga0070692_10540463 3300005345 Bacteria 762
23 Ga0070668_100002558 3300005347 Bacteria 13371
24 Ga0070668_100743606 3300005347 Bacteria 868
25 Ga0070671_100005920 3300005355 Bacteria 9745
26 Ga0070674_101613766 3300005356 Bacteria 585
27 Ga0070659_100817800 3300005366 Bacteria 811
28 Ga0070659_101166854 3300005366 Bacteria 680
29 Ga0070705_101310436 3300005440 Bacteria 601
30 Ga0070694_100058368 3300005444 Bacteria 2625
31 Ga0070694_100147186 3300005444 Bacteria 1717
32 Ga0070708_100134767 3300005445 Archaea 2287
33 Ga0070663_100493974 3300005455 Bacteria 1015
34 Ga0070662_100246819 3300005457 Bacteria 1434
35 Ga0070706_100147209 3300005467 Bacteria 2199
36 Ga0070706_100750070 3300005467 Unclassified 904
37 Ga0070707_100027501 3300005468 Archaea 5411
38 Ga0070707_100160727 3300005468 Archaea 2189
39 Ga0070707_100724632 3300005468 Unclassified 957
40 Ga0070698_100000606 3300005471 Bacteria 38432
41 Ga0070699_100140454 3300005518 Bacteria 2132
42 Ga0070699_100315769 3300005518 Bacteria 1403
43 Ga0070686_101060332 3300005544 Bacteria 667
44 Ga0070695_100113173 3300005545 Bacteria 1845
45 Ga0070696_100026105 3300005546 Bacteria 3973
46 Ga0070696_100070038 3300005546 Bacteria 2466
47 Ga0070696_100411793 3300005546 Bacteria 1060
48 Ga0070704_100054962 3300005549 Bacteria 2820
49 Ga0070704_100055734 3300005549 Bacteria 2804
50 Ga0070704_100446577 3300005549 Bacteria 1113
51 Ga0070664_100004035 3300005564 Bacteria 11793
52 Ga0068857_101206267 3300005577 Unclassified 733
53 Ga0068851_10121281 3300005834 Bacteria 1405
54 Ga0068862_100020546 3300005844 Bacteria 5516
55 Ga0068862_100102690 3300005844 Bacteria 2503
56 Ga0075428_101057637 3300006844 Bacteria 858
57 Ga0075431_101597312 3300006847 Unclassified 610
58 Ga0075433_10706757 3300006852 Unclassified 883
59 Ga0075434_100058456 3300006871 Bacteria 3832
60 Ga0075436_100134466 3300006914 Bacteria 1735
61 Ga0075436_100136910 3300006914 Bacteria 1720
62 Ga0097620_101037547 3300006931 Bacteria 901
63 Ga0075435_100066949 3300007076 Unclassified 2924
64 Ga0075435_100415879 3300007076 Bacteria 1158
65 Ga0105240_11087127 3300009093 Bacteria 851
66 Ga0111539_10226276 3300009094 Bacteria 2179
67 Ga0105245_13096735 3300009098 Unclassified 515
68 Ga0114129_10529826 3300009147 Bacteria 1535
69 Ga0114129_10605206 3300009147 Bacteria 1419
70 Ga0114129_11005848 3300009147 Bacteria 1050
71 Ga0105243_11444761 3300009148 Bacteria 710
72 Ga0105241_10818289 3300009174 Bacteria 859
73 Ga0105248_12272068 3300009177 Bacteria 617
74 Ga0163162_10161897 3300013306 Bacteria 2359
75 Ga0157375_10074200 3300013308 Bacteria 3422
76 Ga0157380_10017526 3300014326 Bacteria 5301
77 Ga0157380_11354554 3300014326 Bacteria 761
78 Ga0209673_1004036 3300025273 Bacteria 8127
79 Ga0209675_1013612 3300025291 Bacteria 2529
80 Ga0209676_1001542 3300025292 Bacteria 20780
81 Ga0209676_1003396 3300025292 Bacteria 9871
82 Ga0209676_1015405 3300025292 Bacteria 2815
83 Ga0209025_1001486 3300025294 Bacteria 30394
84 Ga0209025_1007827 3300025294 Bacteria 7851
85 Ga0209025_1084689 3300025294 Bacteria 1061
86 Ga0209564_1011742 3300025295 Bacteria 3892
87 Ga0209564_1052168 3300025295 Bacteria 986
88 Ga0209758_1026613 3300025297 Bacteria 2497
89 Ga0209050_1000882 3300025298 Bacteria 40150
90 Ga0209256_1002141 3300025299 Bacteria 17076
91 Ga0209256_1002531 3300025299 Bacteria 14659
92 Ga0207426_1066628 3300025302 Bacteria 1017
93 Ga0209051_1016241 3300025303 Bacteria 3382
94 Ga0209257_1000548 3300025304 Bacteria 64548
95 Ga0209257_1001915 3300025304 Bacteria 22493
96 Ga0209257_1001957 3300025304 Bacteria 22212
97 Ga0209257_1011408 3300025304 Bacteria 4283
98 Ga0207684_10155486 3300025910 Bacteria 1968
99 Ga0207684_10705387 3300025910 Unclassified 857
100 Ga0207684_10787583 3300025910 Bacteria 804
101 Ga0207660_10114693 3300025917 Bacteria 2032
102 Ga0207646_10021289 3300025922 Bacteria 5994
103 Ga0207646_10087568 3300025922 Bacteria 2787
104 Ga0207644_10021431 3300025931 Bacteria 4402
105 Ga0207644_10024278 3300025931 Bacteria 4160
106 Ga0207690_11645156 3300025932 Bacteria 536
107 Ga0207706_10195209 3300025933 Bacteria 1776
108 Ga0207670_10315690 3300025936 Bacteria 1228
109 Ga0207669_10358555 3300025937 Bacteria 1129
110 Ga0207679_11354236 3300025945 Bacteria 653
111 Ga0207668_10075353 3300025972 Bacteria 2425
112 Ga0207668_11819404 3300025972 Unclassified 549
113 Ga0207640_11794689 3300025981 Unclassified 554
114 Ga0207641_10151270 3300026088 Bacteria 2102
115 Ga0207428_10313783 3300027907 Bacteria 1159
116 Ga0268265_10006143 3300028380 Bacteria 8148
117 Ga0268265_10021412 3300028380 Bacteria 4529
118 Ga0307408_100290059 3300031548 Bacteria 1366
119 Ga0307408_100290204 3300031548 Bacteria 1366
120 Ga0307408_100579622 3300031548 Unclassified 994
121 Ga0307408_100727541 3300031548 Bacteria 894
122 Ga0307408_101128045 3300031548 Bacteria 728
123 Ga0307408_101276456 3300031548 Bacteria 687
124 Ga0307405_10061129 3300031731 Bacteria 2380
125 Ga0307405_10076572 3300031731 Bacteria 2171
126 Ga0307405_10114270 3300031731 Bacteria 1834
127 Ga0307405_10130219 3300031731 Bacteria 1737
128 Ga0307405_10880817 3300031731 Bacteria 756
129 Ga0307413_10073457 3300031824 Bacteria 2162
130 Ga0307413_10096813 3300031824 Bacteria 1938
131 Ga0307413_10101832 3300031824 Bacteria 1900
132 Ga0307413_10159401 3300031824 Bacteria 1583
133 Ga0307413_10170627 3300031824 Bacteria 1539
134 Ga0307413_10282750 3300031824 Bacteria 1249
135 Ga0307410_10004779 3300031852 Bacteria 7069
136 Ga0307410_10081709 3300031852 Bacteria 2271
137 Ga0307410_10200621 3300031852 Bacteria 1523
138 Ga0307410_10408259 3300031852 Unclassified 1099
139 Ga0307410_10872742 3300031852 Bacteria 769
140 Ga0307410_11603077 3300031852 Bacteria 575
141 Ga0307406_10015434 3300031901 Bacteria 4420
142 Ga0307406_10566285 3300031901 Bacteria 932
143 Ga0307407_10013432 3300031903 Bacteria 3975
144 Ga0307407_10075061 3300031903 Bacteria 2025
145 Ga0307407_10174294 3300031903 Bacteria 1420
146 Ga0307407_10855750 3300031903 Bacteria 695
147 Ga0307412_10027558 3300031911 Bacteria 3545
148 Ga0307412_10045084 3300031911 Bacteria 2880
149 Ga0307412_10783130 3300031911 Bacteria 826
150 Ga0307409_100059724 3300031995 Bacteria 2969
151 Ga0307409_100229144 3300031995 Bacteria 1683
152 Ga0307409_100768845 3300031995 Unclassified 968
153 Ga0307416_100027374 3300032002 Bacteria 4220
154 Ga0307416_100072105 3300032002 Bacteria 2873
155 Ga0307416_100119737 3300032002 Bacteria 2343
156 Ga0307416_100282311 3300032002 Bacteria 1638
157 Ga0307416_101622727 3300032002 Bacteria 752
158 Ga0307414_10613182 3300032004 Bacteria 977
159 Ga0307414_11665604 3300032004 Bacteria 595
160 Ga0307414_11795018 3300032004 Bacteria 572
161 Ga0307411_10005471 3300032005 Bacteria 6243
162 Ga0307411_10076941 3300032005 Bacteria 2282
163 Ga0307411_10120124 3300032005 Bacteria 1899
164 Ga0307411_10252500 3300032005 Bacteria 1387
165 Ga0307411_10701890 3300032005 Unclassified 881
166 Ga0307415_100002843 3300032126 Bacteria 8667
167 Ga0307415_100748199 3300032126 Bacteria 887
168 Ga0307415_100904220 3300032126 Bacteria 814
169 Ga0307415_101617584 3300032126 Bacteria 623
170 Ga0395899_0209820 3300037312 Bacteria 1354
171 Ga0395900_0013488 3300037418 Bacteria 8350
172 Ga0395898_0103506 3300037466 Bacteria 2732
173 Ga0395905_0000863 3300037471 Bacteria 39615
174 Ga0395901_0002181 3300038443 Bacteria 19986
175 Ga0439436_0026167 3300041404 Bacteria 1711
176 Ga0439436_0032554 3300041404 Bacteria 1512
177 Ga0439439_0025559 3300041406 Bacteria 1487
178 Ga0439445_0032893 3300042004 Bacteria 1353
179 Ga0439432_007592 3300042006 Bacteria 3833
180 Ga0439432_011347 3300042006 Bacteria 3071
181 Ga0439432_093840 3300042006 Bacteria 902
182 Ga0439449_0030509 3300042007 Bacteria 2009
183 Ga0439449_0148623 3300042007 Bacteria 873
184 Ga0439457_120542 3300042014 Bacteria 620
185 Ga0439435_0061216 3300042436 Bacteria 1097
186 Ga0453683_0526963 3300044673 Unclassified 768
187 Ga0451576_0066828 3300045051 Bacteria 3742
188 Ga0495663_0037081 3300046525 Bacteria 1469
189 Ga0495636_0000059 3300047318 Bacteria 47988
190 Ga0496106_0619911 3300048909 Bacteria 866
191 Ga0496108_0108582 3300048911 Bacteria 2370
192 Ga0496109_1573657 3300048912 Bacteria 592
193 Ga0496112_0522802 3300048915 Bacteria 1121
194 Ga0501291_058079 3300049514 Bacteria 721
195 Ga0501297_036654 3300049520 Unclassified 674
196 Ga0501033_0144067 3300049570 Bacteria 1722
197 Ga0501034_0066333 3300049571 Bacteria 3622
198 Ga0501067_0003943 3300049583 Bacteria 8193
199 Ga0501067_0314934 3300049583 Bacteria 871
200 Ga0501068_0005043 3300049584 Bacteria 7194
201 Ga0501068_0024576 3300049584 Bacteria 3539
202 Ga0501069_0004419 3300049585 Bacteria 7260
203 Ga0501069_0047999 3300049585 Bacteria 2370
204 Ga0501070_0011476 3300049586 Bacteria 7486
205 Ga0501070_0061719 3300049586 Bacteria 3105
206 Ga0501071_0003055 3300049587 Bacteria 10371
207 Ga0501071_0648149 3300049587 Bacteria 812
208 Ga0501072_0005913 3300049588 Bacteria 9320
209 Ga0501073_0415512 3300049589 Bacteria 929
210 Ga0501074_0008710 3300049590 Bacteria 7352
211 Ga0501076_0372625 3300049592 Bacteria 1173
212 Ga0501202_005978 3300049652 Bacteria 2166
213 Ga0501202_067878 3300049652 Bacteria 817
214 Ga0501202_085023 3300049652 Bacteria 749
215 Ga0501217_028473 3300049661 Bacteria 1361
216 Ga0501217_170772 3300049661 Bacteria 662
217 Ga0501217_322694 3300049661 Bacteria 514
218 Ga0501223_007887 3300049663 Bacteria 2172
219 Ga0501235_093661 3300049669 Bacteria 728
220 Ga0501235_191590 3300049669 Bacteria 550
221 Ga0501243_046392 3300049675 Bacteria 775
222 Ga0501249_049409 3300049679 Bacteria 964
223 Ga0501249_092135 3300049679 Bacteria 720
224 Ga0501250_029963 3300049680 Bacteria 751
225 Ga0501253_059887 3300049683 Bacteria 818
226 Ga0501253_107612 3300049683 Bacteria 661
227 Ga0501259_027281 3300049688 Bacteria 1057
228 Ga0501219_015667 3300049703 Bacteria 616
229 Ga0501225_0059449 3300049705 Bacteria 1074
230 Ga0501225_0103600 3300049705 Bacteria 833
231 Ga0501225_0233590 3300049705 Bacteria 598
232 Ga0501080_0012478 3300049742 Bacteria 7790
233 Ga0501080_0055361 3300049742 Bacteria 3694
234 Ga0501081_0071357 3300049743 Bacteria 2421
235 Ga0501083_0008809 3300049744 Bacteria 7121
236 Ga0501083_0025247 3300049744 Bacteria 4113
237 Ga0501262_041629 3300049759 Bacteria 688
238 Ga0501266_005969 3300049763 Bacteria 1513
239 Ga0501266_067469 3300049763 Bacteria 584
240 Ga0501268_066530 3300049765 Bacteria 722
241 Ga0501268_086935 3300049765 Unclassified 653
242 Ga0501280_016354 3300049776 Bacteria 1070
243 nmdc:mga05p37_1410886_c1 3300050507 Bacteria 701
244 nmdc:mga05p37_423330_c1 3300050507 Bacteria 1549
245 nmdc:mga05p37_809650_c1 3300050507 Bacteria 1023
246 nmdc:mga0qj67_272516_c1 3300050509 Bacteria 1372
247 nmdc:mga0n895_15663_c1 3300050512 Bacteria 6925
248 nmdc:mga0n895_283638_c1 3300050512 Bacteria 1679
249 nmdc:mga0rr50_399462_c1 3300050513 Bacteria 1161
250 nmdc:mga08x19_44219_c1 3300050514 Bacteria 2843
251 nmdc:mga0a205_19088_c1 3300050515 Bacteria 6461
252 Ga0500616_0000271 3300053153 Bacteria 77556
253 Ga0501084_0011057 3300054114 Bacteria 7473
254 Ga0501082_0010498 3300060353 Bacteria 7967
255 Ga0501082_0443879 3300060353 Bacteria 1133
256 Ga0501082_0584474 3300060353 Bacteria 977

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100750070 Ga0070706_1007500702 117
2 3300025910 Ga0207684_10705387 Ga0207684_107053872 117
3 3300005445 Ga0070708_100134767 Ga0070708_1001347671 125
4 3300005468 Ga0070707_100160727 Ga0070707_1001607271 125
5 3300009147 Ga0114129_11005848 Ga0114129_110058482 126
6 3300050507 nmdc:mga05p37_1410886_c1 nmdc:mga05p37_1410886_c1_184_615 126
7 3300031548 Ga0307408_100290059 Ga0307408_1002900592 130
8 3300031824 Ga0307413_10159401 Ga0307413_101594012 130
9 3300031852 Ga0307410_10081709 Ga0307410_100817091 130
10 3300031911 Ga0307412_10783130 Ga0307412_107831302 130
11 3300005468 Ga0070707_100724632 Ga0070707_1007246322 131
12 3300025910 Ga0207684_10155486 Ga0207684_101554861 131
13 3300025922 Ga0207646_10021289 Ga0207646_100212892 131
14 3300009098 Ga0105245_13096735 Ga0105245_130967351 132
15 3300049669 Ga0501235_093661 Ga0501235_093661_217_696 132
16 3300049688 Ga0501259_027281 Ga0501259_027281_144_623 132
17 3300049583 Ga0501067_0314934 Ga0501067_0314934_11_442 133
18 3300049587 Ga0501071_0648149 Ga0501071_0648149_187_618 133
19 3300049571 Ga0501034_0066333 Ga0501034_0066333_1459_1890 136
20 3300049584 Ga0501068_0024576 Ga0501068_0024576_2740_3171 136
21 3300049585 Ga0501069_0047999 Ga0501069_0047999_367_798 136
22 3300049586 Ga0501070_0061719 Ga0501070_0061719_328_759 136
23 3300049588 Ga0501072_0005913 Ga0501072_0005913_2287_2718 136
24 3300049589 Ga0501073_0415512 Ga0501073_0415512_139_570 136
25 3300049742 Ga0501080_0055361 Ga0501080_0055361_501_932 136
26 3300049743 Ga0501081_0071357 Ga0501081_0071357_1283_1714 136
27 3300049744 Ga0501083_0025247 Ga0501083_0025247_3620_4051 136
28 3300060353 Ga0501082_0443879 Ga0501082_0443879_343_774 136
29 iso_pu_bacteria 2643221695 2644529046 137
30 iso_pu_bacteria 2571042365 2572254099 138
31 3300003187 JGI25151J46595_10046076 JGI25151J46595_100460761 139
32 3300003771 Ga0055526_1014153 Ga0055526_10141533 139
33 3300003775 Ga0055524_1001016 Ga0055524_100101610 139
34 3300003775 Ga0055524_1009455 Ga0055524_10094553 139
35 3300003784 Ga0055534_1017025 Ga0055534_10170252 139
36 3300003790 Ga0055528_1021639 Ga0055528_10216391 139
37 3300003791 Ga0055530_10003167 Ga0055530_100031674 139
38 3300003794 Ga0055531_10000379 Ga0055531_100003799 139
39 3300003794 Ga0055531_10000852 Ga0055531_1000085213 139
40 3300003794 Ga0055531_10049496 Ga0055531_100494962 139
41 3300006852 Ga0075433_10706757 Ga0075433_107067571 139
42 3300006871 Ga0075434_100058456 Ga0075434_1000584564 139
43 3300006914 Ga0075436_100136910 Ga0075436_1001369101 139
44 3300007076 Ga0075435_100415879 Ga0075435_1004158792 139
45 3300025273 Ga0209673_1004036 Ga0209673_10040367 139
46 3300025291 Ga0209675_1013612 Ga0209675_10136122 139
47 3300025292 Ga0209676_1001542 Ga0209676_100154210 139
48 3300025292 Ga0209676_1003396 Ga0209676_10033965 139
49 3300025292 Ga0209676_1015405 Ga0209676_10154053 139
50 3300025294 Ga0209025_1001486 Ga0209025_10014862 139
51 3300025294 Ga0209025_1084689 Ga0209025_10846892 139
52 3300025295 Ga0209564_1011742 Ga0209564_10117425 139
53 3300025295 Ga0209564_1052168 Ga0209564_10521683 139
54 3300025297 Ga0209758_1026613 Ga0209758_10266131 139
55 3300025298 Ga0209050_1000882 Ga0209050_10008829 139
56 3300025299 Ga0209256_1002141 Ga0209256_100214111 139
57 3300025299 Ga0209256_1002531 Ga0209256_100253119 139
58 3300025302 Ga0207426_1066628 Ga0207426_10666281 139
59 3300025303 Ga0209051_1016241 Ga0209051_10162413 139
60 3300025304 Ga0209257_1000548 Ga0209257_100054844 139
61 3300025304 Ga0209257_1001915 Ga0209257_100191521 139
62 3300025304 Ga0209257_1001957 Ga0209257_100195722 139
63 3300025304 Ga0209257_1011408 Ga0209257_10114086 139
64 3300049570 Ga0501033_0144067 Ga0501033_0144067_1246_1665 139
65 3300049583 Ga0501067_0003943 Ga0501067_0003943_6613_7032 139
66 3300049584 Ga0501068_0005043 Ga0501068_0005043_321_740 139
67 3300049585 Ga0501069_0004419 Ga0501069_0004419_387_806 139
68 3300049586 Ga0501070_0011476 Ga0501070_0011476_585_1004 139
69 3300049587 Ga0501071_0003055 Ga0501071_0003055_9592_10011 139
70 3300049590 Ga0501074_0008710 Ga0501074_0008710_587_1006 139
71 3300049742 Ga0501080_0012478 Ga0501080_0012478_6483_6902 139
72 3300049744 Ga0501083_0008809 Ga0501083_0008809_242_661 139
73 3300054114 Ga0501084_0011057 Ga0501084_0011057_495_914 139
74 3300060353 Ga0501082_0010498 Ga0501082_0010498_540_959 139
75 3300060353 Ga0501082_0584474 Ga0501082_0584474_39_458 139
76 3300005331 Ga0070670_100050244 Ga0070670_1000502442 140
77 3300005457 Ga0070662_100246819 Ga0070662_1002468191 140
78 3300005577 Ga0068857_101206267 Ga0068857_1012062672 140
79 3300005844 Ga0068862_100020546 Ga0068862_1000205465 140
80 3300025933 Ga0207706_10195209 Ga0207706_101952092 140
81 3300028380 Ga0268265_10006143 Ga0268265_100061437 140
82 3300032002 Ga0307416_101622727 Ga0307416_1016227271 140
83 3300044673 Ga0453683_0526963 Ga0453683_0526963_254_676 140
84 3300045051 Ga0451576_0066828 Ga0451576_0066828_3130_3552 140
85 3300050509 nmdc:mga0qj67_272516_c1 nmdc:mga0qj67_272516_c1_126_548 140
86 3300005347 Ga0070668_100743606 Ga0070668_1007436061 141
87 3300005444 Ga0070694_100058368 Ga0070694_1000583683 141
88 3300005546 Ga0070696_100411793 Ga0070696_1004117932 141
89 3300005549 Ga0070704_100054962 Ga0070704_1000549624 141
90 3300005844 Ga0068862_100102690 Ga0068862_1001026903 141
91 3300006914 Ga0075436_100134466 Ga0075436_1001344663 141
92 3300009147 Ga0114129_10605206 Ga0114129_106052063 141
93 3300025294 Ga0209025_1007827 Ga0209025_10078277 141
94 3300025917 Ga0207660_10114693 Ga0207660_101146933 141
95 3300025936 Ga0207670_10315690 Ga0207670_103156902 141
96 3300025972 Ga0207668_11819404 Ga0207668_118194041 141
97 3300028380 Ga0268265_10021412 Ga0268265_100214125 141
98 3300031852 Ga0307410_10200621 Ga0307410_102006212 141
99 3300031901 Ga0307406_10566285 Ga0307406_105662852 141
100 3300031995 Ga0307409_100059724 Ga0307409_1000597242 141
101 3300032002 Ga0307416_100072105 Ga0307416_1000721052 141
102 3300032002 Ga0307416_100282311 Ga0307416_1002823112 141
103 3300032004 Ga0307414_11795018 Ga0307414_117950181 141
104 3300032126 Ga0307415_100904220 Ga0307415_1009042201 141
105 3300032126 Ga0307415_101617584 Ga0307415_1016175842 141
106 3300042006 Ga0439432_093840 Ga0439432_093840_84_509 141
107 3300049592 Ga0501076_0372625 Ga0501076_0372625_723_1154 141
108 3300049763 Ga0501266_067469 Ga0501266_067469_119_544 141
109 3300050507 nmdc:mga05p37_809650_c1 nmdc:mga05p37_809650_c1_227_652 141
110 3300050512 nmdc:mga0n895_15663_c1 nmdc:mga0n895_15663_c1_2841_3266 141
111 3300050514 nmdc:mga08x19_44219_c1 nmdc:mga08x19_44219_c1_1836_2261 141
112 3300005290 Ga0065712_10121776 Ga0065712_101217762 142
113 3300005328 Ga0070676_10420440 Ga0070676_104204402 142
114 3300005330 Ga0070690_100103344 Ga0070690_1001033442 142
115 3300005336 Ga0070680_100740973 Ga0070680_1007409731 142
116 3300005341 Ga0070691_10253447 Ga0070691_102534472 142
117 3300005344 Ga0070661_101018100 Ga0070661_1010181002 142
118 3300005345 Ga0070692_10540463 Ga0070692_105404631 142
119 3300005347 Ga0070668_100002558 Ga0070668_10000255810 142
120 3300005366 Ga0070659_100817800 Ga0070659_1008178002 142
121 3300005366 Ga0070659_101166854 Ga0070659_1011668541 142
122 3300005440 Ga0070705_101310436 Ga0070705_1013104361 142
123 3300005444 Ga0070694_100147186 Ga0070694_1001471862 142
124 3300005467 Ga0070706_100147209 Ga0070706_1001472094 142
125 3300005468 Ga0070707_100027501 Ga0070707_1000275012 142
126 3300005471 Ga0070698_100000606 Ga0070698_10000060646 142
127 3300005518 Ga0070699_100140454 Ga0070699_1001404543 142
128 3300005518 Ga0070699_100315769 Ga0070699_1003157693 142
129 3300005545 Ga0070695_100113173 Ga0070695_1001131733 142
130 3300005546 Ga0070696_100026105 Ga0070696_1000261058 142
131 3300005546 Ga0070696_100070038 Ga0070696_1000700382 142
132 3300005549 Ga0070704_100055734 Ga0070704_1000557341 142
133 3300005549 Ga0070704_100446577 Ga0070704_1004465771 142
134 3300006844 Ga0075428_101057637 Ga0075428_1010576371 142
135 3300006847 Ga0075431_101597312 Ga0075431_1015973121 142
136 3300006931 Ga0097620_101037547 Ga0097620_1010375471 142
137 3300007076 Ga0075435_100066949 Ga0075435_1000669492 142
138 3300009093 Ga0105240_11087127 Ga0105240_110871271 142
139 3300009094 Ga0111539_10226276 Ga0111539_102262765 142
140 3300009147 Ga0114129_10529826 Ga0114129_105298262 142
141 3300009148 Ga0105243_11444761 Ga0105243_114447612 142
142 3300009174 Ga0105241_10818289 Ga0105241_108182892 142
143 3300009177 Ga0105248_12272068 Ga0105248_122720681 142
144 3300014326 Ga0157380_10017526 Ga0157380_100175262 142
145 3300014326 Ga0157380_11354554 Ga0157380_113545541 142
146 3300025910 Ga0207684_10787583 Ga0207684_107875832 142
147 3300025922 Ga0207646_10087568 Ga0207646_100875685 142
148 3300025931 Ga0207644_10024278 Ga0207644_100242784 142
149 3300025932 Ga0207690_11645156 Ga0207690_116451561 142
150 3300025945 Ga0207679_11354236 Ga0207679_113542362 142
151 3300025972 Ga0207668_10075353 Ga0207668_100753531 142
152 3300025981 Ga0207640_11794689 Ga0207640_117946891 142
153 3300026088 Ga0207641_10151270 Ga0207641_101512705 142
154 3300027907 Ga0207428_10313783 Ga0207428_103137833 142
155 3300031548 Ga0307408_100290204 Ga0307408_1002902041 142
156 3300031548 Ga0307408_100727541 Ga0307408_1007275413 142
157 3300031548 Ga0307408_101128045 Ga0307408_1011280451 142
158 3300031548 Ga0307408_101276456 Ga0307408_1012764562 142
159 3300031731 Ga0307405_10061129 Ga0307405_100611291 142
160 3300031731 Ga0307405_10076572 Ga0307405_100765722 142
161 3300031731 Ga0307405_10114270 Ga0307405_101142702 142
162 3300031731 Ga0307405_10130219 Ga0307405_101302191 142
163 3300031731 Ga0307405_10880817 Ga0307405_108808172 142
164 3300031824 Ga0307413_10073457 Ga0307413_100734572 142
165 3300031824 Ga0307413_10096813 Ga0307413_100968133 142
166 3300031824 Ga0307413_10101832 Ga0307413_101018322 142
167 3300031824 Ga0307413_10170627 Ga0307413_101706274 142
168 3300031824 Ga0307413_10282750 Ga0307413_102827502 142
169 3300031852 Ga0307410_10004779 Ga0307410_100047795 142
170 3300031852 Ga0307410_10872742 Ga0307410_108727421 142
171 3300031852 Ga0307410_11603077 Ga0307410_116030771 142
172 3300031901 Ga0307406_10015434 Ga0307406_100154342 142
173 3300031903 Ga0307407_10013432 Ga0307407_100134324 142
174 3300031903 Ga0307407_10075061 Ga0307407_100750612 142
175 3300031903 Ga0307407_10174294 Ga0307407_101742941 142
176 3300031903 Ga0307407_10855750 Ga0307407_108557502 142
177 3300031911 Ga0307412_10027558 Ga0307412_100275582 142
178 3300031911 Ga0307412_10045084 Ga0307412_100450842 142
179 3300031995 Ga0307409_100229144 Ga0307409_1002291443 142
180 3300032002 Ga0307416_100027374 Ga0307416_1000273742 142
181 3300032004 Ga0307414_10613182 Ga0307414_106131822 142
182 3300032004 Ga0307414_11665604 Ga0307414_116656041 142
183 3300032005 Ga0307411_10005471 Ga0307411_100054719 142
184 3300032005 Ga0307411_10076941 Ga0307411_100769412 142
185 3300032005 Ga0307411_10120124 Ga0307411_101201242 142
186 3300032005 Ga0307411_10252500 Ga0307411_102525003 142
187 3300032126 Ga0307415_100002843 Ga0307415_1000028439 142
188 3300032126 Ga0307415_100748199 Ga0307415_1007481991 142
189 3300037312 Ga0395899_0209820 Ga0395899_0209820_39_467 142
190 3300041404 Ga0439436_0032554 Ga0439436_0032554_664_1092 142
191 3300041406 Ga0439439_0025559 Ga0439439_0025559_522_950 142
192 3300042004 Ga0439445_0032893 Ga0439445_0032893_12_440 142
193 3300042006 Ga0439432_007592 Ga0439432_007592_2009_2437 142
194 3300042006 Ga0439432_011347 Ga0439432_011347_1306_1734 142
195 3300042007 Ga0439449_0030509 Ga0439449_0030509_908_1336 142
196 3300042007 Ga0439449_0148623 Ga0439449_0148623_257_685 142
197 3300042436 Ga0439435_0061216 Ga0439435_0061216_222_671 142
198 3300046525 Ga0495663_0037081 Ga0495663_0037081_986_1414 142
199 3300047318 Ga0495636_0000059 Ga0495636_0000059_27024_27452 142
200 3300048912 Ga0496109_1573657 Ga0496109_1573657_92_520 142
201 3300048915 Ga0496112_0522802 Ga0496112_0522802_438_866 142
202 3300049514 Ga0501291_058079 Ga0501291_058079_268_696 142
203 3300049652 Ga0501202_005978 Ga0501202_005978_809_1237 142
204 3300049652 Ga0501202_085023 Ga0501202_085023_33_461 142
205 3300049661 Ga0501217_028473 Ga0501217_028473_339_767 142
206 3300049661 Ga0501217_322694 Ga0501217_322694_58_486 142
207 3300049663 Ga0501223_007887 Ga0501223_007887_1704_2132 142
208 3300049669 Ga0501235_191590 Ga0501235_191590_77_505 142
209 3300049679 Ga0501249_049409 Ga0501249_049409_25_453 142
210 3300049680 Ga0501250_029963 Ga0501250_029963_313_741 142
211 3300049683 Ga0501253_107612 Ga0501253_107612_37_465 142
212 3300049705 Ga0501225_0059449 Ga0501225_0059449_438_866 142
213 3300049705 Ga0501225_0233590 Ga0501225_0233590_142_570 142
214 3300049759 Ga0501262_041629 Ga0501262_041629_129_557 142
215 3300049763 Ga0501266_005969 Ga0501266_005969_450_878 142
216 3300049765 Ga0501268_066530 Ga0501268_066530_89_517 142
217 3300049776 Ga0501280_016354 Ga0501280_016354_49_477 142
218 3300050507 nmdc:mga05p37_423330_c1 nmdc:mga05p37_423330_c1_90_527 142
219 3300050512 nmdc:mga0n895_283638_c1 nmdc:mga0n895_283638_c1_1159_1587 142
220 3300050513 nmdc:mga0rr50_399462_c1 nmdc:mga0rr50_399462_c1_574_1002 142
221 3300050515 nmdc:mga0a205_19088_c1 nmdc:mga0a205_19088_c1_2203_2631 142
222 3300053153 Ga0500616_0000271 Ga0500616_0000271_48701_49129 142
223 3300005544 Ga0070686_101060332 Ga0070686_1010603321 143
224 3300025937 Ga0207669_10358555 Ga0207669_103585552 143
225 3300031548 Ga0307408_100579622 Ga0307408_1005796222 143
226 3300031852 Ga0307410_10408259 Ga0307410_104082591 143
227 3300031995 Ga0307409_100768845 Ga0307409_1007688451 143
228 3300032002 Ga0307416_100119737 Ga0307416_1001197373 143
229 3300032005 Ga0307411_10701890 Ga0307411_107018902 143
230 3300049520 Ga0501297_036654 Ga0501297_036654_69_503 143
231 3300049652 Ga0501202_067878 Ga0501202_067878_225_674 143
232 3300049661 Ga0501217_170772 Ga0501217_170772_112_561 143
233 3300049675 Ga0501243_046392 Ga0501243_046392_109_588 143
234 3300049679 Ga0501249_092135 Ga0501249_092135_193_627 143
235 3300049683 Ga0501253_059887 Ga0501253_059887_233_667 143
236 3300049703 Ga0501219_015667 Ga0501219_015667_138_587 143
237 3300049705 Ga0501225_0103600 Ga0501225_0103600_95_529 143
238 3300049765 Ga0501268_086935 Ga0501268_086935_104_538 143
239 3300037418 Ga0395900_0013488 Ga0395900_0013488_4465_4962 144
240 3300037466 Ga0395898_0103506 Ga0395898_0103506_1688_2185 144
241 3300037471 Ga0395905_0000863 Ga0395905_0000863_1784_2281 144
242 3300038443 Ga0395901_0002181 Ga0395901_0002181_676_1173 144
243 3300041404 Ga0439436_0026167 Ga0439436_0026167_79_531 144
244 3300042014 Ga0439457_120542 Ga0439457_120542_83_535 144
245 3300048911 Ga0496108_0108582 Ga0496108_0108582_806_1240 144
246 2162886011 MRS1b_contig_345482 MRS1b_0983.00000110 145
247 3300005327 Ga0070658_10007945 Ga0070658_1000794511 145
248 3300005329 Ga0070683_100358318 Ga0070683_1003583181 145
249 3300005333 Ga0070677_10069869 Ga0070677_100698692 145
250 3300005355 Ga0070671_100005920 Ga0070671_1000059204 145
251 3300005356 Ga0070674_101613766 Ga0070674_1016137661 145
252 3300005455 Ga0070663_100493974 Ga0070663_1004939742 145
253 3300005564 Ga0070664_100004035 Ga0070664_10000403511 145
254 3300005834 Ga0068851_10121281 Ga0068851_101212812 145
255 3300013306 Ga0163162_10161897 Ga0163162_101618972 145
256 3300013308 Ga0157375_10074200 Ga0157375_100742002 145
257 3300025931 Ga0207644_10021431 Ga0207644_100214315 145
258 3300048909 Ga0496106_0619911 Ga0496106_0619911_185_622 145

Structural Annotation

Top 5 Hits

ID Description Score Start End
4abm-assembly2.cif.gz_C crystal structure of chmp4b hairpin 0.8948 46 106
5eiu-assembly1.cif.gz_D mini trim5 b-box 2 dimer c2 crystal form 0.8907 46 106
3x29-assembly1.cif.gz_A crystal structure of mouse claudin-19 in complex with c-terminal fragment of clostridium perfringens enterotoxin 0.8884 43 103
3iqe-assembly1.cif.gz_D structure of f420 dependent methylene-tetrahydromethanopterin dehydrogenase in complex with methylene-tetrahydromethanopterin and coenzyme f420 0.7868 50 99
3h2v-assembly4.cif.gz_D human raver1 rrm1 domain in complex with human vinculin tail domain vt 0.7606 8 110
ID Description Score Start End Superfamily
af_B0V349_3_195_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.889 43 109 1.20.140.150
af_Q8LPS2_498_670_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.8419 44 134 1.20.58.390
af_I1M1Y0_11_214_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8215 2 129 1.20.120.550
af_A0A1D6F8H0_397_508_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.7996 1 111 1.20.58.390
af_Q9FNL6_13_218_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7956 5 131 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A536AN38-F1-model_v4 DUF1211 domain-containing protein 0.9846 3 138 GO:0016020
AF-A0A536RYC8-F1-model_v4 DUF1211 domain-containing protein 0.9745 30 138 GO:0016020
AF-A0A1Q8AV34-F1-model_v4 Uncharacterized protein 0.9686 43 140 GO:0016020
AF-A0A1Q7MME3-F1-model_v4 Yip1 domain-containing protein 0.9674 5 137
AF-A0A1Q8BE81-F1-model_v4 Uncharacterized protein 0.9591 31 140 GO:0016020

Feature Viewer

pLDDT pTM Quality
87.29 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map