F367637

General Info

Members Datasets Scaffolds Average Seq Length
257 157 514 192

Family's Representative Sequence

Representative Sequence 3300049577|Ga0501041_0169783|Ga0501041_0169783_151_795
Length 214
Sequence MQVQTNVLDCSSLLDHLSRRVALAEIILFHHVQGLTVGINAFADGLRAAGHTVHTPDLFETLTFPTLEEGIDFVRGIGFGTILDRGVAAAEAFGPELVYAGFSLGVMPAQKLAQTRAGARGALFFDACIPVEEFGDRWPEDVPVQIHGMDHDPSFADEGDLDAARALVDSTENAELFLYPGDVHLFADSSLASYDPAAARLMTERVLDFLSKIE

Samples

Sample ID Description Type Environment
1 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
3 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
43 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
45 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
77 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
78 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
79 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
80 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
81 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
82 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
83 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
100 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
109 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.84
Nodule 0
Rhizoplane 10.12
Rhizosphere 78.99
Stem 0
Stem Tuber 0
Unclassified 11.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501041_0169783 3300049577 Bacteria 1365
2 Ga0055524_1009030 3300003775 Bacteria 4091
3 Ga0055528_1005219 3300003790 Bacteria 6103
4 Ga0070658_10084166 3300005327 Bacteria 2615
5 Ga0070683_100213720 3300005329 Bacteria 1832
6 Ga0070668_100152493 3300005347 Bacteria 1870
7 Ga0070675_100861466 3300005354 Unclassified 829
8 Ga0070671_100549356 3300005355 Bacteria 996
9 Ga0070667_100264800 3300005367 Bacteria 1540
10 Ga0070708_100034833 3300005445 Bacteria 4383
11 Ga0070663_100025930 3300005455 Bacteria 3963
12 Ga0070681_10018889 3300005458 Bacteria 6896
13 Ga0070681_10198013 3300005458 Bacteria 1927
14 Ga0070706_100040862 3300005467 Bacteria 4281
15 Ga0070707_100043137 3300005468 Bacteria 4318
16 Ga0070707_100264345 3300005468 Unclassified 1673
17 Ga0070698_100000721 3300005471 Bacteria 35505
18 Ga0070698_100032979 3300005471 Bacteria 5365
19 Ga0070699_100069744 3300005518 Bacteria 3055
20 Ga0070699_100220057 3300005518 Unclassified 1692
21 Ga0070679_100069102 3300005530 Bacteria 3523
22 Ga0068856_100566610 3300005614 Bacteria 1157
23 Ga0068856_100621769 3300005614 Bacteria 1101
24 Ga0068859_100180146 3300005617 Bacteria 2196
25 Ga0068863_100070715 3300005841 Bacteria 3301
26 Ga0081455_10017225 3300005937 Bacteria 6936
27 Ga0081538_10058035 3300005981 Bacteria 2249
28 Ga0081538_10120326 3300005981 Bacteria 1263
29 Ga0075365_10147928 3300006038 Bacteria 1633
30 Ga0075365_10177612 3300006038 Bacteria 1488
31 Ga0075363_100129158 3300006048 Bacteria 1416
32 Ga0070715_10131441 3300006163 Unclassified 1205
33 Ga0097621_100859404 3300006237 Bacteria 843
34 Ga0075428_100232262 3300006844 Bacteria 1990
35 Ga0075428_100800938 3300006844 Bacteria 1001
36 Ga0075431_100437326 3300006847 Archaea 1305
37 Ga0075429_100297739 3300006880 Bacteria 1412
38 Ga0097620_100180149 3300006931 Bacteria 2196
39 Ga0105251_10005231 3300009011 Bacteria 8554
40 Ga0105250_10012475 3300009092 Bacteria 3508
41 Ga0111539_12191812 3300009094 Unclassified 641
42 Ga0114129_10168400 3300009147 Bacteria 2988
43 Ga0114129_11083896 3300009147 Bacteria 1004
44 Ga0105248_10006903 3300009177 Bacteria 12443
45 Ga0105249_10276456 3300009553 Bacteria 1675
46 Ga0105246_10084654 3300011119 Bacteria 2269
47 Ga0157370_10506191 3300013104 Bacteria 1109
48 Ga0163163_10009327 3300014325 Bacteria 8756
49 Ga0182008_10267933 3300014497 Bacteria 885
50 Ga0163161_10163795 3300017792 Bacteria 1697
51 Ga0209129_1001347 3300025258 Bacteria 13877
52 Ga0209130_1022826 3300025284 Bacteria 1389
53 Ga0209025_1014652 3300025294 Bacteria 4799
54 Ga0209564_1027746 3300025295 Bacteria 1830
55 Ga0209256_1019410 3300025299 Bacteria 2164
56 Ga0207426_1001020 3300025302 Bacteria 27032
57 Ga0207713_1031387 3300025735 Bacteria 2349
58 Ga0207680_10333225 3300025903 Bacteria 1063
59 Ga0207684_10031135 3300025910 Bacteria 4540
60 Ga0207707_10422266 3300025912 Bacteria 1143
61 Ga0207646_10002662 3300025922 Bacteria 20943
62 Ga0207646_10015189 3300025922 Bacteria 7283
63 Ga0207650_10263141 3300025925 Bacteria 1399
64 Ga0207644_10106706 3300025931 Bacteria 2112
65 Ga0207668_10143527 3300025972 Bacteria 1839
66 Ga0207658_10203959 3300025986 Bacteria 1653
67 Ga0207678_10074926 3300026067 Bacteria 2899
68 Ga0207702_10671610 3300026078 Unclassified 1020
69 Ga0207702_10868470 3300026078 Bacteria 893
70 Ga0207641_10048821 3300026088 Bacteria 3574
71 Ga0207676_10313564 3300026095 Unclassified 1437
72 Ga0207698_10044266 3300026142 Bacteria 3343
73 Ga0207428_10050228 3300027907 Bacteria 3338
74 Ga0307515_10080758 3300028794 Bacteria 4234
75 Ga0307509_10247720 3300031507 Bacteria 1568
76 Ga0307415_100640184 3300032126 Bacteria 952
77 Ga0373946_0139211 3300035171 Bacteria 1123
78 Ga0373935_0091339 3300035692 Bacteria 1994
79 Ga0373925_0507193 3300037068 Bacteria 990
80 Ga0395899_0001314 3300037312 Bacteria 21401
81 Ga0395900_0018376 3300037418 Bacteria 7131
82 Ga0395900_0075083 3300037418 Bacteria 3475
83 Ga0395900_0159003 3300037418 Bacteria 2306
84 Ga0395900_0266545 3300037418 Bacteria 1709
85 Ga0395898_0040810 3300037466 Bacteria 4587
86 Ga0395898_0075880 3300037466 Bacteria 3246
87 Ga0395898_0854691 3300037466 Bacteria 849
88 Ga0395905_0209956 3300037471 Bacteria 1824
89 Ga0395905_1413830 3300037471 Bacteria 600
90 Ga0436364_0732126 3300037853 Bacteria 28168
91 Ga0395901_0051994 3300038443 Bacteria 4259
92 Ga0395901_0162612 3300038443 Bacteria 2344
93 Ga0395901_0274120 3300038443 Bacteria 1754
94 Ga0395901_0350020 3300038443 Bacteria 1525
95 Ga0436365_0415777 3300039437 Bacteria 13372
96 Ga0436363_1432490 3300039450 Bacteria 9830
97 Ga0436362_1015922 3300039453 Unclassified 1557
98 Ga0439454_037184 3300042011 Bacteria 785
99 Ga0439463_005442 3300042016 Bacteria 3161
100 Ga0450923_030226 3300042125 Bacteria 1101
101 Ga0439444_0059062 3300042437 Bacteria 797
102 Ga0439464_0001784 3300042439 Bacteria 5187
103 Ga0439460_0001489 3300042461 Bacteria 5523
104 Ga0466965_0327774 3300044683 Bacteria 835
105 Ga0466966_0089723 3300044684 Bacteria 1909
106 Ga0466966_0242682 3300044684 Bacteria 1086
107 Ga0466961_0062026 3300044693 Bacteria 2376
108 Ga0466961_0416199 3300044693 Bacteria 815
109 Ga0466970_0069418 3300044765 Bacteria 1894
110 Ga0466967_0232212 3300045976 Bacteria 1757
111 Ga0466967_0559108 3300045976 Bacteria 1126
112 Ga0495638_0073073 3300046460 Bacteria 2094
113 Ga0495653_0033218 3300046463 Bacteria 4089
114 Ga0495653_0115906 3300046463 Unclassified 1917
115 Ga0495618_0129790 3300046514 Unclassified 1613
116 Ga0495645_0016492 3300046543 Bacteria 5276
117 Ga0496100_0188829 3300048903 Bacteria 1495
118 Ga0496100_0391929 3300048903 Bacteria 1056
119 Ga0496101_0084624 3300048904 Unclassified 2349
120 Ga0496102_0342611 3300048905 Bacteria 1407
121 Ga0496103_0193268 3300048906 Bacteria 1308
122 Ga0496104_0314657 3300048907 Bacteria 1478
123 Ga0496104_0509146 3300048907 Bacteria 1115
124 Ga0496104_1228658 3300048907 Bacteria 652
125 Ga0496105_0069680 3300048908 Bacteria 2906
126 Ga0496105_0146040 3300048908 Unclassified 1945
127 Ga0496106_0310425 3300048909 Bacteria 1265
128 Ga0496107_0220805 3300048910 Bacteria 1410
129 Ga0496107_0354201 3300048910 Bacteria 1092
130 Ga0496108_0301645 3300048911 Bacteria 1395
131 Ga0496108_0539263 3300048911 Bacteria 1018
132 Ga0496109_0680219 3300048912 Unclassified 966
133 Ga0496110_0329176 3300048913 Bacteria 1391
134 Ga0496110_0370290 3300048913 Bacteria 1305
135 Ga0496111_0312618 3300048914 Bacteria 1164
136 Ga0496112_0058866 3300048915 Bacteria 3784
137 Ga0496112_0066583 3300048915 Bacteria 3554
138 Ga0496112_0517431 3300048915 Bacteria 1128
139 Ga0496113_0246369 3300048916 Bacteria 1426
140 Ga0496113_0261844 3300048916 Bacteria 1381
141 Ga0496114_0287893 3300048917 Bacteria 1449
142 Ga0496114_0572967 3300048917 Bacteria 996
143 Ga0496119_0044699 3300048922 Bacteria 2785
144 Ga0496120_0228603 3300048923 Unclassified 884
145 Ga0496121_0235228 3300048924 Bacteria 1280
146 Ga0496122_0158501 3300048925 Bacteria 1384
147 Ga0496123_0144516 3300048926 Bacteria 1294
148 Ga0496124_0093529 3300048927 Bacteria 2446
149 Ga0496125_0182636 3300048928 Bacteria 1395
150 Ga0496126_0077571 3300048929 Bacteria 2945
151 Ga0501031_0028025 3300049568 Bacteria 3671
152 Ga0501031_0231219 3300049568 Bacteria 1203
153 Ga0501031_0598884 3300049568 Bacteria 709
154 Ga0501033_0041739 3300049570 Unclassified 3422
155 Ga0501036_0025916 3300049572 Bacteria 4947
156 Ga0501036_0038118 3300049572 Bacteria 4067
157 Ga0501036_0573267 3300049572 Bacteria 937
158 Ga0501036_0768717 3300049572 Unclassified 794
159 Ga0501038_0022855 3300049574 Bacteria 5598
160 Ga0501038_0077123 3300049574 Bacteria 2814
161 Ga0501038_0451055 3300049574 Bacteria 989
162 Ga0501039_0032917 3300049575 Bacteria 3999
163 Ga0501039_0096372 3300049575 Unclassified 2306
164 Ga0501039_0519596 3300049575 Bacteria 935
165 Ga0501040_0017460 3300049576 Bacteria 4762
166 Ga0501040_0093185 3300049576 Bacteria 2095
167 Ga0501040_0417632 3300049576 Bacteria 964
168 Ga0501041_0002549 3300049577 Bacteria 10386
169 Ga0501041_0036251 3300049577 Bacteria 2989
170 Ga0501041_0136760 3300049577 Bacteria 1527
171 Ga0501041_0496373 3300049577 Unclassified 776
172 Ga0501042_0012817 3300049578 Bacteria 5691
173 Ga0501042_0132918 3300049578 Bacteria 1794
174 Ga0501042_0149499 3300049578 Bacteria 1684
175 Ga0501042_0446712 3300049578 Bacteria 938
176 Ga0501042_0804559 3300049578 Bacteria 684
177 Ga0501043_0306284 3300049579 Bacteria 1213
178 Ga0501046_0019044 3300049580 Bacteria 5697
179 Ga0501048_0002465 3300049582 Bacteria 14123
180 Ga0501068_0083432 3300049584 Bacteria 1964
181 Ga0501069_0117669 3300049585 Unclassified 1516
182 Ga0501070_0499798 3300049586 Bacteria 977
183 Ga0501071_0023178 3300049587 Bacteria 4334
184 Ga0501071_0025234 3300049587 Bacteria 4161
185 Ga0501071_0027983 3300049587 Bacteria 3969
186 Ga0501071_0102227 3300049587 Bacteria 2113
187 Ga0501071_0110058 3300049587 Bacteria 2035
188 Ga0501072_0004435 3300049588 Bacteria 10660
189 Ga0501072_0086007 3300049588 Bacteria 2495
190 Ga0501072_0088625 3300049588 Bacteria 2455
191 Ga0501072_0110219 3300049588 Bacteria 2191
192 Ga0501072_0129447 3300049588 Bacteria 2011
193 Ga0501072_0136056 3300049588 Bacteria 1959
194 Ga0501072_0170114 3300049588 Bacteria 1739
195 Ga0501073_0143963 3300049589 Unclassified 1652
196 Ga0501074_0015019 3300049590 Bacteria 5635
197 Ga0501074_0082015 3300049590 Bacteria 2313
198 Ga0501074_0335085 3300049590 Bacteria 1074
199 Ga0501074_0758209 3300049590 Unclassified 684
200 Ga0501075_0006373 3300049591 Bacteria 8121
201 Ga0501075_0009817 3300049591 Bacteria 6708
202 Ga0501075_0063765 3300049591 Bacteria 2778
203 Ga0501075_0101144 3300049591 Bacteria 2189
204 Ga0501075_0145012 3300049591 Unclassified 1809
205 Ga0501076_0002125 3300049592 Bacteria 13600
206 Ga0501076_0005330 3300049592 Bacteria 9234
207 Ga0501076_0081004 3300049592 Bacteria 2606
208 Ga0501076_0221937 3300049592 Unclassified 1544
209 Ga0501076_0382429 3300049592 Bacteria 1157
210 Ga0501077_0019078 3300049593 Bacteria 4336
211 Ga0501077_0066249 3300049593 Bacteria 2291
212 Ga0501077_0537201 3300049593 Bacteria 750
213 Ga0501079_0006430 3300049741 Bacteria 8820
214 Ga0501079_0040454 3300049741 Bacteria 3596
215 Ga0501079_0079328 3300049741 Bacteria 2539
216 Ga0501079_0103200 3300049741 Bacteria 2212
217 Ga0501079_0230488 3300049741 Bacteria 1447
218 Ga0501080_0029291 3300049742 Bacteria 5125
219 Ga0501080_0406952 3300049742 Unclassified 1224
220 Ga0501080_0481144 3300049742 Bacteria 1111
221 Ga0501081_0003929 3300049743 Bacteria 9526
222 Ga0501081_0051221 3300049743 Bacteria 2847
223 Ga0501083_0048603 3300049744 Unclassified 2863
224 Ga0501083_0609551 3300049744 Bacteria 710
225 Ga0501035_0018137 3300049822 Bacteria 6485
226 Ga0501045_0013512 3300049824 Bacteria 5767
227 Ga0501045_0074484 3300049824 Bacteria 2500
228 Ga0501045_0077967 3300049824 Bacteria 2442
229 nmdc:mga03683_134811_c1 3300050489 Bacteria 1107
230 nmdc:mga00v17_150595_c1 3300050491 Bacteria 1495
231 nmdc:mga00v17_68984_c1 3300050491 Bacteria 2186
232 nmdc:mga05p37_343123_c1 3300050507 Bacteria 1761
233 nmdc:mga05p37_553172_c1 3300050507 Bacteria 1309
234 nmdc:mga09592_523614_c1 3300050508 Bacteria 1020
235 nmdc:mga09592_71001_c1 3300050508 Bacteria 2955
236 nmdc:mga0qj67_99908_c1 3300050509 Unclassified 2338
237 nmdc:mga06r32_1502780_c1 3300050510 Bacteria 614
238 nmdc:mga08y16_1181432_c1 3300050511 Bacteria 737
239 nmdc:mga0n895_700120_c1 3300050512 Bacteria 1009
240 nmdc:mga0rr50_555103_c1 3300050513 Bacteria 978
241 Ga0495601_0014881 3300053077 Unclassified 4697
242 Ga0495612_0277645 3300053078 Unclassified 748
243 Ga0500616_0079091 3300053153 Bacteria 1656
244 Ga0501084_0131157 3300054114 Unclassified 2109
245 Ga0501084_0172823 3300054114 Bacteria 1824
246 Ga0501084_0268477 3300054114 Bacteria 1440
247 Ga0501084_0281364 3300054114 Bacteria 1405
248 Ga0501082_0006920 3300060353 Bacteria 9802
249 Ga0501082_0114349 3300060353 Unclassified 2337
250 Ga0501082_0520006 3300060353 Bacteria 1040
251 Ga0530510_0020054 3300061734 Bacteria 4753
252 Ga0530510_0021092 3300061734 Bacteria 4636
253 Ga0530510_0037184 3300061734 Bacteria 3509
254 Ga0530510_0069131 3300061734 Bacteria 2563
255 Ga0530510_0114012 3300061734 Bacteria 1981
256 Ga0530510_0515392 3300061734 Bacteria 907
257 2947224994 2947224130 Bacteria 9938529
258 Ga0501041_0169783
259 Ga0055524_1009030
260 Ga0055528_1005219
261 Ga0070658_10084166
262 Ga0070683_100213720
263 Ga0070668_100152493
264 Ga0070675_100861466
265 Ga0070671_100549356
266 Ga0070667_100264800
267 Ga0070708_100034833
268 Ga0070663_100025930
269 Ga0070681_10018889
270 Ga0070681_10198013
271 Ga0070706_100040862
272 Ga0070707_100043137
273 Ga0070707_100264345
274 Ga0070698_100000721
275 Ga0070698_100032979
276 Ga0070699_100069744
277 Ga0070699_100220057
278 Ga0070679_100069102
279 Ga0068856_100566610
280 Ga0068856_100621769
281 Ga0068859_100180146
282 Ga0068863_100070715
283 Ga0081455_10017225
284 Ga0081538_10058035
285 Ga0081538_10120326
286 Ga0075365_10147928
287 Ga0075365_10177612
288 Ga0075363_100129158
289 Ga0070715_10131441
290 Ga0097621_100859404
291 Ga0075428_100232262
292 Ga0075428_100800938
293 Ga0075431_100437326
294 Ga0075429_100297739
295 Ga0097620_100180149
296 Ga0105251_10005231
297 Ga0105250_10012475
298 Ga0111539_12191812
299 Ga0114129_10168400
300 Ga0114129_11083896
301 Ga0105248_10006903
302 Ga0105249_10276456
303 Ga0105246_10084654
304 Ga0157370_10506191
305 Ga0163163_10009327
306 Ga0182008_10267933
307 Ga0163161_10163795
308 Ga0209129_1001347
309 Ga0209130_1022826
310 Ga0209025_1014652
311 Ga0209564_1027746
312 Ga0209256_1019410
313 Ga0207426_1001020
314 Ga0207713_1031387
315 Ga0207680_10333225
316 Ga0207684_10031135
317 Ga0207707_10422266
318 Ga0207646_10002662
319 Ga0207646_10015189
320 Ga0207650_10263141
321 Ga0207644_10106706
322 Ga0207668_10143527
323 Ga0207658_10203959
324 Ga0207678_10074926
325 Ga0207702_10671610
326 Ga0207702_10868470
327 Ga0207641_10048821
328 Ga0207676_10313564
329 Ga0207698_10044266
330 Ga0207428_10050228
331 Ga0307515_10080758
332 Ga0307509_10247720
333 Ga0307415_100640184
334 Ga0373946_0139211
335 Ga0373935_0091339
336 Ga0373925_0507193
337 Ga0395899_0001314
338 Ga0395900_0018376
339 Ga0395900_0075083
340 Ga0395900_0159003
341 Ga0395900_0266545
342 Ga0395898_0040810
343 Ga0395898_0075880
344 Ga0395898_0854691
345 Ga0395905_0209956
346 Ga0395905_1413830
347 Ga0436364_0732126
348 Ga0395901_0051994
349 Ga0395901_0162612
350 Ga0395901_0274120
351 Ga0395901_0350020
352 Ga0436365_0415777
353 Ga0436363_1432490
354 Ga0436362_1015922
355 Ga0439454_037184
356 Ga0439463_005442
357 Ga0450923_030226
358 Ga0439444_0059062
359 Ga0439464_0001784
360 Ga0439460_0001489
361 Ga0466965_0327774
362 Ga0466966_0089723
363 Ga0466966_0242682
364 Ga0466961_0062026
365 Ga0466961_0416199
366 Ga0466970_0069418
367 Ga0466967_0232212
368 Ga0466967_0559108
369 Ga0495638_0073073
370 Ga0495653_0033218
371 Ga0495653_0115906
372 Ga0495618_0129790
373 Ga0495645_0016492
374 Ga0496100_0188829
375 Ga0496100_0391929
376 Ga0496101_0084624
377 Ga0496102_0342611
378 Ga0496103_0193268
379 Ga0496104_0314657
380 Ga0496104_0509146
381 Ga0496104_1228658
382 Ga0496105_0069680
383 Ga0496105_0146040
384 Ga0496106_0310425
385 Ga0496107_0220805
386 Ga0496107_0354201
387 Ga0496108_0301645
388 Ga0496108_0539263
389 Ga0496109_0680219
390 Ga0496110_0329176
391 Ga0496110_0370290
392 Ga0496111_0312618
393 Ga0496112_0058866
394 Ga0496112_0066583
395 Ga0496112_0517431
396 Ga0496113_0246369
397 Ga0496113_0261844
398 Ga0496114_0287893
399 Ga0496114_0572967
400 Ga0496119_0044699
401 Ga0496120_0228603
402 Ga0496121_0235228
403 Ga0496122_0158501
404 Ga0496123_0144516
405 Ga0496124_0093529
406 Ga0496125_0182636
407 Ga0496126_0077571
408 Ga0501031_0028025
409 Ga0501031_0231219
410 Ga0501031_0598884
411 Ga0501033_0041739
412 Ga0501036_0025916
413 Ga0501036_0038118
414 Ga0501036_0573267
415 Ga0501036_0768717
416 Ga0501038_0022855
417 Ga0501038_0077123
418 Ga0501038_0451055
419 Ga0501039_0032917
420 Ga0501039_0096372
421 Ga0501039_0519596
422 Ga0501040_0017460
423 Ga0501040_0093185
424 Ga0501040_0417632
425 Ga0501041_0002549
426 Ga0501041_0036251
427 Ga0501041_0136760
428 Ga0501041_0496373
429 Ga0501042_0012817
430 Ga0501042_0132918
431 Ga0501042_0149499
432 Ga0501042_0446712
433 Ga0501042_0804559
434 Ga0501043_0306284
435 Ga0501046_0019044
436 Ga0501048_0002465
437 Ga0501068_0083432
438 Ga0501069_0117669
439 Ga0501070_0499798
440 Ga0501071_0023178
441 Ga0501071_0025234
442 Ga0501071_0027983
443 Ga0501071_0102227
444 Ga0501071_0110058
445 Ga0501072_0004435
446 Ga0501072_0086007
447 Ga0501072_0088625
448 Ga0501072_0110219
449 Ga0501072_0129447
450 Ga0501072_0136056
451 Ga0501072_0170114
452 Ga0501073_0143963
453 Ga0501074_0015019
454 Ga0501074_0082015
455 Ga0501074_0335085
456 Ga0501074_0758209
457 Ga0501075_0006373
458 Ga0501075_0009817
459 Ga0501075_0063765
460 Ga0501075_0101144
461 Ga0501075_0145012
462 Ga0501076_0002125
463 Ga0501076_0005330
464 Ga0501076_0081004
465 Ga0501076_0221937
466 Ga0501076_0382429
467 Ga0501077_0019078
468 Ga0501077_0066249
469 Ga0501077_0537201
470 Ga0501079_0006430
471 Ga0501079_0040454
472 Ga0501079_0079328
473 Ga0501079_0103200
474 Ga0501079_0230488
475 Ga0501080_0029291
476 Ga0501080_0406952
477 Ga0501080_0481144
478 Ga0501081_0003929
479 Ga0501081_0051221
480 Ga0501083_0048603
481 Ga0501083_0609551
482 Ga0501035_0018137
483 Ga0501045_0013512
484 Ga0501045_0074484
485 Ga0501045_0077967
486 nmdc:mga03683_134811_c1
487 nmdc:mga00v17_150595_c1
488 nmdc:mga00v17_68984_c1
489 nmdc:mga05p37_343123_c1
490 nmdc:mga05p37_553172_c1
491 nmdc:mga09592_523614_c1
492 nmdc:mga09592_71001_c1
493 nmdc:mga0qj67_99908_c1
494 nmdc:mga06r32_1502780_c1
495 nmdc:mga08y16_1181432_c1
496 nmdc:mga0n895_700120_c1
497 nmdc:mga0rr50_555103_c1
498 Ga0495601_0014881
499 Ga0495612_0277645
500 Ga0500616_0079091
501 Ga0501084_0131157
502 Ga0501084_0172823
503 Ga0501084_0268477
504 Ga0501084_0281364
505 Ga0501082_0006920
506 Ga0501082_0114349
507 Ga0501082_0520006
508 Ga0530510_0020054
509 Ga0530510_0021092
510 Ga0530510_0037184
511 Ga0530510_0069131
512 Ga0530510_0114012
513 Ga0530510_0515392
514 2947224994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

17

214

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.8318 2 189
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.8161 2 189
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.8031 1 190
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.7958 1 190
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.7929 1 191
ID Description Score Start End Superfamily
af_Q18925_2_245_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8345 2 190 3.40.50.1820
af_Q18925_2_245_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8228 2 190 3.40.50.1820
af_Q18927_1_243_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8223 1 190 3.40.50.1820
af_Q18927_1_243_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8147 1 190 3.40.50.1820
af_O17263_18_263_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8125 2 191 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7V9VIF3-F1-model_v4 DUF664 domain-containing protein 0.9987 1 188 GO:0016787
AF-A0A5F0EB98-F1-model_v4 deleted 0.9985 75 189
AF-A0A5F0D2H6-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9965 75 191 GO:0016787
AF-T1B671-F1-model_v4 Dienelactone hydrolase 0.9963 1 140 GO:0016787
AF-A0A7W1RWH2-F1-model_v4 Dienelactone hydrolase family protein 0.9962 1 189 GO:0016787

Map