F367505
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 257 | 183 | 257 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300044658|Ga0466972_0056296|Ga0466972_0056296_1078_1347 |
| Length | 89 |
| Sequence | MNGVFIAVEVDEAVARDAEIAAKLAEVCPVDIYAVGDDGSVRIVEENLDECVLCRLCIDAAPAGSVRVIKLYDDGPERVLSSESDPTPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 54 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 74 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 121 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 122 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 123 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 126 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 127 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 128 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 129 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 130 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 131 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 132 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 133 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 134 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 135 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 136 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 137 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 139 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 140 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 141 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 142 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 143 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 144 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 145 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 146 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 147 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 148 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 149 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 150 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 151 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 167 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 168 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 170 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 171 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 172 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 175 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 177 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 183 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.56 |
| Nodule | 0 |
| Rhizoplane | 5.84 |
| Rhizosphere | 89.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1021065 | 3300002073 | Bacteria | 766 |
| 2 | Ga0070658_10213177 | 3300005327 | Bacteria | 1632 |
| 3 | Ga0070676_11490528 | 3300005328 | Bacteria | 521 |
| 4 | Ga0070683_100110030 | 3300005329 | Bacteria | 2599 |
| 5 | Ga0070683_101088779 | 3300005329 | Bacteria | 768 |
| 6 | Ga0070683_101240034 | 3300005329 | Bacteria | 717 |
| 7 | Ga0070683_101783602 | 3300005329 | Bacteria | 592 |
| 8 | Ga0070690_100819847 | 3300005330 | Bacteria | 723 |
| 9 | Ga0070670_101501472 | 3300005331 | Bacteria | 619 |
| 10 | Ga0070670_101883897 | 3300005331 | Unclassified | 551 |
| 11 | Ga0068869_100164784 | 3300005334 | Bacteria | 1728 |
| 12 | Ga0070666_11235588 | 3300005335 | Bacteria | 557 |
| 13 | Ga0070680_100557902 | 3300005336 | Bacteria | 982 |
| 14 | Ga0070682_100765018 | 3300005337 | Bacteria | 781 |
| 15 | Ga0070682_100938345 | 3300005337 | Unclassified | 714 |
| 16 | Ga0068868_100007532 | 3300005338 | Bacteria | 7754 |
| 17 | Ga0068868_100111886 | 3300005338 | Bacteria | 2219 |
| 18 | Ga0068868_102023820 | 3300005338 | Unclassified | 547 |
| 19 | Ga0070660_100375844 | 3300005339 | Bacteria | 1173 |
| 20 | Ga0070687_101417921 | 3300005343 | Bacteria | 520 |
| 21 | Ga0070692_10320635 | 3300005345 | Bacteria | 953 |
| 22 | Ga0070668_101330260 | 3300005347 | Bacteria | 654 |
| 23 | Ga0070669_100066461 | 3300005353 | Bacteria | 2658 |
| 24 | Ga0070674_100000064 | 3300005356 | Bacteria | 47689 |
| 25 | Ga0070674_101407427 | 3300005356 | Bacteria | 624 |
| 26 | Ga0070673_100001567 | 3300005364 | Bacteria | 13472 |
| 27 | Ga0070673_100202299 | 3300005364 | Bacteria | 1711 |
| 28 | Ga0070688_100050817 | 3300005365 | Bacteria | 2584 |
| 29 | Ga0070667_101053500 | 3300005367 | Unclassified | 760 |
| 30 | Ga0070714_100004789 | 3300005435 | Bacteria | 10255 |
| 31 | Ga0070714_100006760 | 3300005435 | Bacteria | 8890 |
| 32 | Ga0070714_100565508 | 3300005435 | Bacteria | 1090 |
| 33 | Ga0070701_11112014 | 3300005438 | Bacteria | 557 |
| 34 | Ga0070700_100147266 | 3300005441 | Bacteria | 1606 |
| 35 | Ga0070700_100668428 | 3300005441 | Unclassified | 822 |
| 36 | Ga0070663_101054923 | 3300005455 | Bacteria | 709 |
| 37 | Ga0070662_101822524 | 3300005457 | Bacteria | 526 |
| 38 | Ga0070681_10679368 | 3300005458 | Bacteria | 945 |
| 39 | Ga0068867_100330040 | 3300005459 | Bacteria | 1266 |
| 40 | Ga0070685_10517592 | 3300005466 | Bacteria | 847 |
| 41 | Ga0070679_100757411 | 3300005530 | Bacteria | 914 |
| 42 | Ga0070679_101795403 | 3300005530 | Bacteria | 562 |
| 43 | Ga0070684_102306090 | 3300005535 | Bacteria | 507 |
| 44 | Ga0070672_100425147 | 3300005543 | Bacteria | 1141 |
| 45 | Ga0070665_100787544 | 3300005548 | Bacteria | 964 |
| 46 | Ga0070664_100796468 | 3300005564 | Bacteria | 883 |
| 47 | Ga0068857_100320816 | 3300005577 | Bacteria | 1431 |
| 48 | Ga0068854_101538335 | 3300005578 | Bacteria | 605 |
| 49 | Ga0068856_101738788 | 3300005614 | Bacteria | 636 |
| 50 | Ga0070702_100983427 | 3300005615 | Bacteria | 667 |
| 51 | Ga0070702_101208224 | 3300005615 | Bacteria | 610 |
| 52 | Ga0068852_100446371 | 3300005616 | Bacteria | 1280 |
| 53 | Ga0068852_101669298 | 3300005616 | Bacteria | 660 |
| 54 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 55 | Ga0068866_10161008 | 3300005718 | Bacteria | 1309 |
| 56 | Ga0068866_10469426 | 3300005718 | Bacteria | 827 |
| 57 | Ga0068851_10286291 | 3300005834 | Bacteria | 944 |
| 58 | Ga0068851_10588808 | 3300005834 | Bacteria | 676 |
| 59 | Ga0068870_10881995 | 3300005840 | Bacteria | 631 |
| 60 | Ga0068862_100987876 | 3300005844 | Bacteria | 832 |
| 61 | Ga0081455_10001330 | 3300005937 | Bacteria | 30557 |
| 62 | Ga0081455_10320269 | 3300005937 | Bacteria | 1105 |
| 63 | Ga0081538_10003262 | 3300005981 | Bacteria | 15408 |
| 64 | Ga0081540_1074684 | 3300005983 | Bacteria | 1552 |
| 65 | Ga0081539_10275854 | 3300005985 | Bacteria | 734 |
| 66 | Ga0075365_10522973 | 3300006038 | Bacteria | 839 |
| 67 | Ga0075364_10167456 | 3300006051 | Bacteria | 1485 |
| 68 | Ga0070716_100495718 | 3300006173 | Bacteria | 900 |
| 69 | Ga0070712_100000003 | 3300006175 | Bacteria | 253696 |
| 70 | Ga0075367_10397351 | 3300006178 | Bacteria | 872 |
| 71 | Ga0075428_100609693 | 3300006844 | Bacteria | 1165 |
| 72 | Ga0075430_100718435 | 3300006846 | Bacteria | 824 |
| 73 | Ga0075431_100539777 | 3300006847 | Unclassified | 1154 |
| 74 | Ga0075431_102135325 | 3300006847 | Bacteria | 515 |
| 75 | Ga0075433_10428788 | 3300006852 | Bacteria | 1166 |
| 76 | Ga0075434_100734085 | 3300006871 | Bacteria | 1005 |
| 77 | Ga0075429_100899622 | 3300006880 | Bacteria | 775 |
| 78 | Ga0068865_100198393 | 3300006881 | Bacteria | 1556 |
| 79 | Ga0068865_100460108 | 3300006881 | Bacteria | 1054 |
| 80 | Ga0099795_10244410 | 3300007788 | Bacteria | 772 |
| 81 | Ga0105240_10043184 | 3300009093 | Bacteria | 5739 |
| 82 | Ga0111539_10626245 | 3300009094 | Bacteria | 1253 |
| 83 | Ga0111539_11102038 | 3300009094 | Bacteria | 923 |
| 84 | Ga0111539_11278814 | 3300009094 | Bacteria | 852 |
| 85 | Ga0105245_10121962 | 3300009098 | Bacteria | 2436 |
| 86 | Ga0105245_11906187 | 3300009098 | Bacteria | 647 |
| 87 | Ga0105245_12054869 | 3300009098 | Bacteria | 625 |
| 88 | Ga0114129_11878161 | 3300009147 | Bacteria | 727 |
| 89 | Ga0105243_10207946 | 3300009148 | Bacteria | 1721 |
| 90 | Ga0105243_10861597 | 3300009148 | Bacteria | 898 |
| 91 | Ga0105242_10734228 | 3300009176 | Bacteria | 970 |
| 92 | Ga0105242_10754226 | 3300009176 | Bacteria | 958 |
| 93 | Ga0105248_12303953 | 3300009177 | Bacteria | 613 |
| 94 | Ga0105237_12272764 | 3300009545 | Bacteria | 552 |
| 95 | Ga0105239_11154049 | 3300010375 | Bacteria | 892 |
| 96 | Ga0157369_11322499 | 3300013105 | Bacteria | 734 |
| 97 | Ga0163162_13081215 | 3300013306 | Bacteria | 535 |
| 98 | Ga0157375_13121193 | 3300013308 | Bacteria | 553 |
| 99 | Ga0157380_10150101 | 3300014326 | Bacteria | 2014 |
| 100 | Ga0157380_12322516 | 3300014326 | Bacteria | 601 |
| 101 | Ga0157380_12853354 | 3300014326 | Bacteria | 550 |
| 102 | Ga0213876_10150556 | 3300021384 | Bacteria | 1237 |
| 103 | Ga0207656_10308842 | 3300025321 | Bacteria | 784 |
| 104 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 105 | Ga0207688_10217355 | 3300025901 | Bacteria | 1150 |
| 106 | Ga0207680_10068710 | 3300025903 | Bacteria | 2187 |
| 107 | Ga0207685_10000027 | 3300025905 | Bacteria | 102101 |
| 108 | Ga0207645_10761232 | 3300025907 | Bacteria | 658 |
| 109 | Ga0207643_10151022 | 3300025908 | Bacteria | 1393 |
| 110 | Ga0207705_10822281 | 3300025909 | Bacteria | 721 |
| 111 | Ga0207707_10480094 | 3300025912 | Bacteria | 1062 |
| 112 | Ga0207695_11624799 | 3300025913 | Bacteria | 527 |
| 113 | Ga0207693_10000028 | 3300025915 | Bacteria | 120041 |
| 114 | Ga0207662_10835171 | 3300025918 | Bacteria | 650 |
| 115 | Ga0207657_10208688 | 3300025919 | Bacteria | 1568 |
| 116 | Ga0207649_11358835 | 3300025920 | Bacteria | 562 |
| 117 | Ga0207652_10673996 | 3300025921 | Bacteria | 924 |
| 118 | Ga0207681_10058150 | 3300025923 | Bacteria | 2646 |
| 119 | Ga0207681_10219998 | 3300025923 | Bacteria | 1469 |
| 120 | Ga0207650_10642932 | 3300025925 | Bacteria | 894 |
| 121 | Ga0207687_10204686 | 3300025927 | Bacteria | 1545 |
| 122 | Ga0207687_10293653 | 3300025927 | Bacteria | 1307 |
| 123 | Ga0207664_10000046 | 3300025929 | Bacteria | 140749 |
| 124 | Ga0207664_10006937 | 3300025929 | Bacteria | 7835 |
| 125 | Ga0207706_10145234 | 3300025933 | Bacteria | 2087 |
| 126 | Ga0207686_10264633 | 3300025934 | Bacteria | 1262 |
| 127 | Ga0207686_10645549 | 3300025934 | Bacteria | 837 |
| 128 | Ga0207686_11002161 | 3300025934 | Bacteria | 678 |
| 129 | Ga0207709_10044415 | 3300025935 | Bacteria | 2685 |
| 130 | Ga0207670_11440375 | 3300025936 | Bacteria | 585 |
| 131 | Ga0207669_10000018 | 3300025937 | Bacteria | 114254 |
| 132 | Ga0207704_10327768 | 3300025938 | Bacteria | 1184 |
| 133 | Ga0207704_10487884 | 3300025938 | Bacteria | 990 |
| 134 | Ga0207665_11570519 | 3300025939 | Bacteria | 522 |
| 135 | Ga0207691_10161277 | 3300025940 | Bacteria | 1967 |
| 136 | Ga0207661_10794437 | 3300025944 | Bacteria | 871 |
| 137 | Ga0207661_11145004 | 3300025944 | Bacteria | 716 |
| 138 | Ga0207679_11175495 | 3300025945 | Bacteria | 704 |
| 139 | Ga0207651_10002404 | 3300025960 | Bacteria | 8943 |
| 140 | Ga0207651_11074406 | 3300025960 | Bacteria | 721 |
| 141 | Ga0207712_10874411 | 3300025961 | Bacteria | 793 |
| 142 | Ga0207640_11397772 | 3300025981 | Bacteria | 627 |
| 143 | Ga0207677_10000525 | 3300026023 | Bacteria | 24518 |
| 144 | Ga0207677_10202042 | 3300026023 | Bacteria | 1580 |
| 145 | Ga0207677_10856272 | 3300026023 | Bacteria | 817 |
| 146 | Ga0207708_10034339 | 3300026075 | Bacteria | 3858 |
| 147 | Ga0207702_12330967 | 3300026078 | Bacteria | 523 |
| 148 | Ga0207648_10042936 | 3300026089 | Bacteria | 3970 |
| 149 | Ga0207676_10451666 | 3300026095 | Bacteria | 1212 |
| 150 | Ga0207674_10886221 | 3300026116 | Bacteria | 860 |
| 151 | Ga0207683_10515825 | 3300026121 | Bacteria | 1104 |
| 152 | Ga0207698_10475882 | 3300026142 | Bacteria | 1211 |
| 153 | Ga0207698_10717163 | 3300026142 | Bacteria | 996 |
| 154 | Ga0268265_10706271 | 3300028380 | Bacteria | 975 |
| 155 | Ga0268265_10773123 | 3300028380 | Bacteria | 934 |
| 156 | Ga0268264_10272246 | 3300028381 | Bacteria | 1582 |
| 157 | Ga0265326_10000030 | 3300028558 | Bacteria | 96518 |
| 158 | Ga0265334_10000156 | 3300028573 | Bacteria | 42408 |
| 159 | Ga0265338_10000536 | 3300028800 | Bacteria | 66434 |
| 160 | Ga0265324_10000980 | 3300029957 | Bacteria | 17655 |
| 161 | Ga0265320_10021535 | 3300031240 | Bacteria | 3464 |
| 162 | Ga0265340_10468874 | 3300031247 | Bacteria | 554 |
| 163 | Ga0307408_100559908 | 3300031548 | Bacteria | 1010 |
| 164 | Ga0265314_10690055 | 3300031711 | Bacteria | 517 |
| 165 | Ga0307405_10503515 | 3300031731 | Bacteria | 971 |
| 166 | Ga0307405_10849237 | 3300031731 | Bacteria | 769 |
| 167 | Ga0307413_10240291 | 3300031824 | Bacteria | 1337 |
| 168 | Ga0307413_10292683 | 3300031824 | Bacteria | 1231 |
| 169 | Ga0307413_10916959 | 3300031824 | Bacteria | 745 |
| 170 | Ga0307413_11454929 | 3300031824 | Bacteria | 604 |
| 171 | Ga0307410_11241348 | 3300031852 | Bacteria | 650 |
| 172 | Ga0307406_11433442 | 3300031901 | Bacteria | 606 |
| 173 | Ga0307406_11604003 | 3300031901 | Bacteria | 575 |
| 174 | Ga0307407_10753244 | 3300031903 | Bacteria | 738 |
| 175 | Ga0307407_11707605 | 3300031903 | Bacteria | 501 |
| 176 | Ga0307412_11164976 | 3300031911 | Bacteria | 689 |
| 177 | Ga0307409_100009209 | 3300031995 | Bacteria | 6053 |
| 178 | Ga0307409_100360218 | 3300031995 | Bacteria | 1375 |
| 179 | Ga0307409_100949030 | 3300031995 | Bacteria | 876 |
| 180 | Ga0307409_101085605 | 3300031995 | Bacteria | 821 |
| 181 | Ga0307409_102695613 | 3300031995 | Bacteria | 525 |
| 182 | Ga0307409_102939963 | 3300031995 | Bacteria | 503 |
| 183 | Ga0307416_100012581 | 3300032002 | Bacteria | 5710 |
| 184 | Ga0307416_101352561 | 3300032002 | Bacteria | 818 |
| 185 | Ga0307416_102282180 | 3300032002 | Bacteria | 642 |
| 186 | Ga0307414_10814800 | 3300032004 | Bacteria | 852 |
| 187 | Ga0307414_11002858 | 3300032004 | Bacteria | 769 |
| 188 | Ga0307411_10279983 | 3300032005 | Bacteria | 1327 |
| 189 | Ga0307411_10921116 | 3300032005 | Bacteria | 778 |
| 190 | Ga0307415_100004028 | 3300032126 | Bacteria | 7574 |
| 191 | Ga0307415_100939418 | 3300032126 | Bacteria | 800 |
| 192 | Ga0307415_101327847 | 3300032126 | Bacteria | 682 |
| 193 | Ga0307415_101380106 | 3300032126 | Bacteria | 670 |
| 194 | Ga0307415_101475203 | 3300032126 | Bacteria | 650 |
| 195 | Ga0436364_1548050 | 3300037853 | Bacteria | 600 |
| 196 | Ga0451800_1053192 | 3300041459 | Bacteria | 573 |
| 197 | Ga0451806_198579 | 3300041462 | Bacteria | 772 |
| 198 | Ga0451837_0848824 | 3300041494 | Bacteria | 571 |
| 199 | Ga0451853_2595020 | 3300041512 | Bacteria | 666 |
| 200 | Ga0450914_025111 | 3300042118 | Bacteria | 688 |
| 201 | Ga0450890_013214 | 3300042127 | Bacteria | 1077 |
| 202 | Ga0450905_040917 | 3300042142 | Bacteria | 737 |
| 203 | Ga0439458_0022007 | 3300042157 | Bacteria | 1479 |
| 204 | Ga0439444_0043666 | 3300042437 | Bacteria | 889 |
| 205 | Ga0439459_0005973 | 3300042438 | Bacteria | 2017 |
| 206 | Ga0439440_0006914 | 3300042993 | Bacteria | 2295 |
| 207 | Ga0466972_0052897 | 3300044658 | Bacteria | 1956 |
| 208 | Ga0466972_0056296 | 3300044658 | Bacteria | 1891 |
| 209 | Ga0466965_0710909 | 3300044683 | Bacteria | 577 |
| 210 | Ga0466961_0925567 | 3300044693 | Bacteria | 519 |
| 211 | Ga0466964_0101327 | 3300044706 | Bacteria | 1270 |
| 212 | Ga0466971_0031024 | 3300044719 | Bacteria | 2393 |
| 213 | Ga0466957_0255572 | 3300044842 | Bacteria | 1166 |
| 214 | Ga0466960_0692454 | 3300044901 | Bacteria | 611 |
| 215 | Ga0466960_0715562 | 3300044901 | Bacteria | 601 |
| 216 | Ga0466960_1053146 | 3300044901 | Bacteria | 501 |
| 217 | Ga0466967_0112149 | 3300045976 | Bacteria | 2507 |
| 218 | Ga0466967_1630443 | 3300045976 | Bacteria | 642 |
| 219 | Ga0466967_1728098 | 3300045976 | Bacteria | 623 |
| 220 | Ga0495582_0378253 | 3300046473 | Bacteria | 816 |
| 221 | Ga0495596_0156924 | 3300046500 | Bacteria | 884 |
| 222 | Ga0495606_0441211 | 3300046507 | Bacteria | 669 |
| 223 | Ga0495608_0000068 | 3300046511 | Bacteria | 79694 |
| 224 | Ga0495628_0898887 | 3300046516 | Bacteria | 615 |
| 225 | Ga0495642_0103451 | 3300046528 | Bacteria | 1214 |
| 226 | Ga0495669_0138816 | 3300046684 | Bacteria | 1147 |
| 227 | Ga0495674_1007939 | 3300047319 | Bacteria | 638 |
| 228 | Ga0495672_0048695 | 3300047320 | Bacteria | 2512 |
| 229 | Ga0496100_0438476 | 3300048903 | Bacteria | 1000 |
| 230 | Ga0496101_0742318 | 3300048904 | Bacteria | 775 |
| 231 | Ga0496102_0785026 | 3300048905 | Bacteria | 875 |
| 232 | Ga0496102_0851850 | 3300048905 | Bacteria | 834 |
| 233 | Ga0496102_1760618 | 3300048905 | Bacteria | 537 |
| 234 | Ga0496107_0879877 | 3300048910 | Bacteria | 653 |
| 235 | Ga0496109_0076281 | 3300048912 | Bacteria | 3083 |
| 236 | Ga0496110_0714075 | 3300048913 | Bacteria | 904 |
| 237 | Ga0496110_1048670 | 3300048913 | Bacteria | 723 |
| 238 | Ga0496111_0703989 | 3300048914 | Bacteria | 735 |
| 239 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 240 | Ga0496112_0000463 | 3300048915 | Bacteria | 27080 |
| 241 | Ga0496113_0035507 | 3300048916 | Bacteria | 3646 |
| 242 | Ga0496121_0792611 | 3300048924 | Bacteria | 558 |
| 243 | Ga0496124_0202593 | 3300048927 | Bacteria | 1508 |
| 244 | Ga0496124_0418571 | 3300048927 | Bacteria | 924 |
| 245 | Ga0501067_0462538 | 3300049583 | Bacteria | 709 |
| 246 | nmdc:mga0yw44_864031_c1 | 3300050492 | Bacteria | 614 |
| 247 | nmdc:mga09592_1162118_c1 | 3300050508 | Bacteria | 639 |
| 248 | nmdc:mga09592_228656_c1 | 3300050508 | Bacteria | 1611 |
| 249 | nmdc:mga0qj67_1568811_c1 | 3300050509 | Bacteria | 505 |
| 250 | nmdc:mga0qj67_443052_c1 | 3300050509 | Bacteria | 1046 |
| 251 | nmdc:mga0qj67_959506_c1 | 3300050509 | Bacteria | 672 |
| 252 | nmdc:mga06r32_491644_c1 | 3300050510 | Bacteria | 1204 |
| 253 | nmdc:mga08y16_1377464_c1 | 3300050511 | Bacteria | 669 |
| 254 | nmdc:mga08y16_2018252_c1 | 3300050511 | Bacteria | 526 |
| 255 | nmdc:mga0a205_724659_c1 | 3300050515 | Bacteria | 844 |
| 256 | Ga0466962_0006216 | 3300061719 | Bacteria | 5736 |
| 257 | Ga0530510_0753080 | 3300061734 | Bacteria | 743 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009545 | Ga0105237_12272764 | Ga0105237_122727642 | 66 |
| 2 | 3300048910 | Ga0496107_0879877 | Ga0496107_0879877_384_620 | 68 |
| 3 | 3300028380 | Ga0268265_10773123 | Ga0268265_107731232 | 73 |
| 4 | 3300050509 | nmdc:mga0qj67_1568811_c1 | nmdc:mga0qj67_1568811_c1_30_251 | 73 |
| 5 | 3300005356 | Ga0070674_100000064 | Ga0070674_10000006445 | 74 |
| 6 | 3300005718 | Ga0068866_10000001 | Ga0068866_10000001365 | 74 |
| 7 | 3300025899 | Ga0207642_10000002 | Ga0207642_1000000285 | 74 |
| 8 | 3300025937 | Ga0207669_10000018 | Ga0207669_1000001862 | 74 |
| 9 | 3300026078 | Ga0207702_12330967 | Ga0207702_123309672 | 74 |
| 10 | 3300005353 | Ga0070669_100066461 | Ga0070669_1000664612 | 75 |
| 11 | 3300005364 | Ga0070673_100001567 | Ga0070673_1000015672 | 75 |
| 12 | 3300025923 | Ga0207681_10058150 | Ga0207681_100581502 | 75 |
| 13 | 3300025960 | Ga0207651_10002404 | Ga0207651_100024044 | 75 |
| 14 | 3300005329 | Ga0070683_101088779 | Ga0070683_1010887791 | 76 |
| 15 | 3300005441 | Ga0070700_100668428 | Ga0070700_1006684281 | 76 |
| 16 | 3300006051 | Ga0075364_10167456 | Ga0075364_101674562 | 76 |
| 17 | 3300006178 | Ga0075367_10397351 | Ga0075367_103973512 | 76 |
| 18 | 3300006847 | Ga0075431_100539777 | Ga0075431_1005397772 | 76 |
| 19 | 3300006852 | Ga0075433_10428788 | Ga0075433_104287882 | 76 |
| 20 | 3300028381 | Ga0268264_10272246 | Ga0268264_102722463 | 76 |
| 21 | 3300031995 | Ga0307409_100360218 | Ga0307409_1003602181 | 76 |
| 22 | 3300048905 | Ga0496102_1760618 | Ga0496102_1760618_206_445 | 76 |
| 23 | 3300048914 | Ga0496111_0703989 | Ga0496111_0703989_84_317 | 76 |
| 24 | 3300050510 | nmdc:mga06r32_491644_c1 | nmdc:mga06r32_491644_c1_550_789 | 76 |
| 25 | 3300050515 | nmdc:mga0a205_724659_c1 | nmdc:mga0a205_724659_c1_399_638 | 76 |
| 26 | 3300005338 | Ga0068868_102023820 | Ga0068868_1020238201 | 77 |
| 27 | 3300005455 | Ga0070663_101054923 | Ga0070663_1010549231 | 77 |
| 28 | 3300005614 | Ga0068856_101738788 | Ga0068856_1017387882 | 77 |
| 29 | 3300005615 | Ga0070702_101208224 | Ga0070702_1012082242 | 77 |
| 30 | 3300005616 | Ga0068852_100446371 | Ga0068852_1004463712 | 77 |
| 31 | 3300005718 | Ga0068866_10161008 | Ga0068866_101610082 | 77 |
| 32 | 3300005834 | Ga0068851_10286291 | Ga0068851_102862912 | 77 |
| 33 | 3300005985 | Ga0081539_10275854 | Ga0081539_102758542 | 77 |
| 34 | 3300006038 | Ga0075365_10522973 | Ga0075365_105229732 | 77 |
| 35 | 3300006173 | Ga0070716_100495718 | Ga0070716_1004957182 | 77 |
| 36 | 3300006881 | Ga0068865_100460108 | Ga0068865_1004601082 | 77 |
| 37 | 3300009094 | Ga0111539_10626245 | Ga0111539_106262452 | 77 |
| 38 | 3300009098 | Ga0105245_11906187 | Ga0105245_119061871 | 77 |
| 39 | 3300009148 | Ga0105243_10861597 | Ga0105243_108615972 | 77 |
| 40 | 3300009176 | Ga0105242_10734228 | Ga0105242_107342282 | 77 |
| 41 | 3300009177 | Ga0105248_12303953 | Ga0105248_123039532 | 77 |
| 42 | 3300013306 | Ga0163162_13081215 | Ga0163162_130812152 | 77 |
| 43 | 3300013308 | Ga0157375_13121193 | Ga0157375_131211931 | 77 |
| 44 | 3300021384 | Ga0213876_10150556 | Ga0213876_101505562 | 77 |
| 45 | 3300025905 | Ga0207685_10000027 | Ga0207685_1000002721 | 77 |
| 46 | 3300025934 | Ga0207686_10645549 | Ga0207686_106455492 | 77 |
| 47 | 3300025938 | Ga0207704_10327768 | Ga0207704_103277682 | 77 |
| 48 | 3300026023 | Ga0207677_10856272 | Ga0207677_108562721 | 77 |
| 49 | 3300026142 | Ga0207698_10475882 | Ga0207698_104758822 | 77 |
| 50 | 3300031548 | Ga0307408_100559908 | Ga0307408_1005599082 | 77 |
| 51 | 3300031731 | Ga0307405_10503515 | Ga0307405_105035152 | 77 |
| 52 | 3300031731 | Ga0307405_10849237 | Ga0307405_108492372 | 77 |
| 53 | 3300031824 | Ga0307413_10240291 | Ga0307413_102402912 | 77 |
| 54 | 3300031824 | Ga0307413_10916959 | Ga0307413_109169591 | 77 |
| 55 | 3300031824 | Ga0307413_11454929 | Ga0307413_114549292 | 77 |
| 56 | 3300031852 | Ga0307410_11241348 | Ga0307410_112413482 | 77 |
| 57 | 3300031901 | Ga0307406_11433442 | Ga0307406_114334422 | 77 |
| 58 | 3300031903 | Ga0307407_11707605 | Ga0307407_117076052 | 77 |
| 59 | 3300031995 | Ga0307409_100009209 | Ga0307409_1000092092 | 77 |
| 60 | 3300031995 | Ga0307409_102695613 | Ga0307409_1026956132 | 77 |
| 61 | 3300032002 | Ga0307416_100012581 | Ga0307416_1000125812 | 77 |
| 62 | 3300032004 | Ga0307414_10814800 | Ga0307414_108148002 | 77 |
| 63 | 3300032005 | Ga0307411_10279983 | Ga0307411_102799832 | 77 |
| 64 | 3300032126 | Ga0307415_100004028 | Ga0307415_1000040288 | 77 |
| 65 | 3300032126 | Ga0307415_101327847 | Ga0307415_1013278472 | 77 |
| 66 | 3300037853 | Ga0436364_1548050 | Ga0436364_1548050_144_377 | 77 |
| 67 | 3300041462 | Ga0451806_198579 | Ga0451806_198579_448_681 | 77 |
| 68 | 3300046473 | Ga0495582_0378253 | Ga0495582_0378253_227_460 | 77 |
| 69 | 3300046500 | Ga0495596_0156924 | Ga0495596_0156924_544_777 | 77 |
| 70 | 3300048913 | Ga0496110_0714075 | Ga0496110_0714075_652_894 | 77 |
| 71 | 3300048913 | Ga0496110_1048670 | Ga0496110_1048670_91_324 | 77 |
| 72 | 3300050492 | nmdc:mga0yw44_864031_c1 | nmdc:mga0yw44_864031_c1_25_258 | 77 |
| 73 | 3300005329 | Ga0070683_100110030 | Ga0070683_1001100302 | 78 |
| 74 | 3300005329 | Ga0070683_101240034 | Ga0070683_1012400341 | 78 |
| 75 | 3300005331 | Ga0070670_101883897 | Ga0070670_1018838972 | 78 |
| 76 | 3300005337 | Ga0070682_100765018 | Ga0070682_1007650182 | 78 |
| 77 | 3300005337 | Ga0070682_100938345 | Ga0070682_1009383451 | 78 |
| 78 | 3300005338 | Ga0068868_100007532 | Ga0068868_1000075326 | 78 |
| 79 | 3300005365 | Ga0070688_100050817 | Ga0070688_1000508171 | 78 |
| 80 | 3300005367 | Ga0070667_101053500 | Ga0070667_1010535001 | 78 |
| 81 | 3300005435 | Ga0070714_100004789 | Ga0070714_10000478911 | 78 |
| 82 | 3300005435 | Ga0070714_100006760 | Ga0070714_1000067608 | 78 |
| 83 | 3300005458 | Ga0070681_10679368 | Ga0070681_106793682 | 78 |
| 84 | 3300005530 | Ga0070679_100757411 | Ga0070679_1007574112 | 78 |
| 85 | 3300005937 | Ga0081455_10001330 | Ga0081455_1000133012 | 78 |
| 86 | 3300005937 | Ga0081455_10320269 | Ga0081455_103202692 | 78 |
| 87 | 3300005981 | Ga0081538_10003262 | Ga0081538_1000326214 | 78 |
| 88 | 3300005983 | Ga0081540_1074684 | Ga0081540_10746842 | 78 |
| 89 | 3300006175 | Ga0070712_100000003 | Ga0070712_1000000033 | 78 |
| 90 | 3300006844 | Ga0075428_100609693 | Ga0075428_1006096932 | 78 |
| 91 | 3300006846 | Ga0075430_100718435 | Ga0075430_1007184352 | 78 |
| 92 | 3300006847 | Ga0075431_102135325 | Ga0075431_1021353251 | 78 |
| 93 | 3300007788 | Ga0099795_10244410 | Ga0099795_102444102 | 78 |
| 94 | 3300009093 | Ga0105240_10043184 | Ga0105240_100431846 | 78 |
| 95 | 3300009094 | Ga0111539_11278814 | Ga0111539_112788142 | 78 |
| 96 | 3300009147 | Ga0114129_11878161 | Ga0114129_118781611 | 78 |
| 97 | 3300025903 | Ga0207680_10068710 | Ga0207680_100687102 | 78 |
| 98 | 3300025912 | Ga0207707_10480094 | Ga0207707_104800942 | 78 |
| 99 | 3300025913 | Ga0207695_11624799 | Ga0207695_116247992 | 78 |
| 100 | 3300025915 | Ga0207693_10000028 | Ga0207693_1000002889 | 78 |
| 101 | 3300025921 | Ga0207652_10673996 | Ga0207652_106739962 | 78 |
| 102 | 3300025929 | Ga0207664_10000046 | Ga0207664_1000004699 | 78 |
| 103 | 3300025929 | Ga0207664_10006937 | Ga0207664_100069372 | 78 |
| 104 | 3300025934 | Ga0207686_11002161 | Ga0207686_110021612 | 78 |
| 105 | 3300025944 | Ga0207661_11145004 | Ga0207661_111450041 | 78 |
| 106 | 3300025945 | Ga0207679_11175495 | Ga0207679_111754952 | 78 |
| 107 | 3300026023 | Ga0207677_10000525 | Ga0207677_1000052515 | 78 |
| 108 | 3300028558 | Ga0265326_10000030 | Ga0265326_1000003025 | 78 |
| 109 | 3300028573 | Ga0265334_10000156 | Ga0265334_1000015632 | 78 |
| 110 | 3300028800 | Ga0265338_10000536 | Ga0265338_1000053622 | 78 |
| 111 | 3300029957 | Ga0265324_10000980 | Ga0265324_1000098016 | 78 |
| 112 | 3300031240 | Ga0265320_10021535 | Ga0265320_100215352 | 78 |
| 113 | 3300031247 | Ga0265340_10468874 | Ga0265340_104688742 | 78 |
| 114 | 3300031711 | Ga0265314_10690055 | Ga0265314_106900552 | 78 |
| 115 | 3300031901 | Ga0307406_11604003 | Ga0307406_116040032 | 78 |
| 116 | 3300031911 | Ga0307412_11164976 | Ga0307412_111649762 | 78 |
| 117 | 3300031995 | Ga0307409_101085605 | Ga0307409_1010856052 | 78 |
| 118 | 3300031995 | Ga0307409_102939963 | Ga0307409_1029399631 | 78 |
| 119 | 3300032002 | Ga0307416_101352561 | Ga0307416_1013525612 | 78 |
| 120 | 3300032002 | Ga0307416_102282180 | Ga0307416_1022821802 | 78 |
| 121 | 3300032126 | Ga0307415_101475203 | Ga0307415_1014752032 | 78 |
| 122 | 3300041494 | Ga0451837_0848824 | Ga0451837_0848824_50_292 | 78 |
| 123 | 3300041512 | Ga0451853_2595020 | Ga0451853_2595020_106_342 | 78 |
| 124 | 3300044658 | Ga0466972_0056296 | Ga0466972_0056296_1078_1347 | 78 |
| 125 | 3300044901 | Ga0466960_1053146 | Ga0466960_1053146_148_393 | 78 |
| 126 | 3300046507 | Ga0495606_0441211 | Ga0495606_0441211_285_521 | 78 |
| 127 | 3300046528 | Ga0495642_0103451 | Ga0495642_0103451_52_288 | 78 |
| 128 | 3300047320 | Ga0495672_0048695 | Ga0495672_0048695_709_954 | 78 |
| 129 | 3300048903 | Ga0496100_0438476 | Ga0496100_0438476_104_346 | 78 |
| 130 | 3300048904 | Ga0496101_0742318 | Ga0496101_0742318_503_739 | 78 |
| 131 | 3300048905 | Ga0496102_0785026 | Ga0496102_0785026_580_816 | 78 |
| 132 | 3300048912 | Ga0496109_0076281 | Ga0496109_0076281_369_614 | 78 |
| 133 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_337806_338051 | 78 |
| 134 | 3300048915 | Ga0496112_0000463 | Ga0496112_0000463_8058_8300 | 78 |
| 135 | 3300048916 | Ga0496113_0035507 | Ga0496113_0035507_285_530 | 78 |
| 136 | 3300048927 | Ga0496124_0202593 | Ga0496124_0202593_1232_1474 | 78 |
| 137 | 3300048927 | Ga0496124_0418571 | Ga0496124_0418571_28_270 | 78 |
| 138 | 3300050508 | nmdc:mga09592_1162118_c1 | nmdc:mga09592_1162118_c1_238_474 | 78 |
| 139 | 3300050509 | nmdc:mga0qj67_443052_c1 | nmdc:mga0qj67_443052_c1_582_818 | 78 |
| 140 | 3300050509 | nmdc:mga0qj67_959506_c1 | nmdc:mga0qj67_959506_c1_227_466 | 78 |
| 141 | 3300050511 | nmdc:mga08y16_1377464_c1 | nmdc:mga08y16_1377464_c1_170_406 | 78 |
| 142 | 3300031824 | Ga0307413_10292683 | Ga0307413_102926832 | 79 |
| 143 | 3300032004 | Ga0307414_11002858 | Ga0307414_110028582 | 79 |
| 144 | 3300046511 | Ga0495608_0000068 | Ga0495608_0000068_77229_77489 | 79 |
| 145 | 3300046516 | Ga0495628_0898887 | Ga0495628_0898887_320_565 | 79 |
| 146 | 3300046684 | Ga0495669_0138816 | Ga0495669_0138816_179_439 | 79 |
| 147 | 3300047319 | Ga0495674_1007939 | Ga0495674_1007939_45_290 | 79 |
| 148 | 3300048924 | Ga0496121_0792611 | Ga0496121_0792611_42_296 | 79 |
| 149 | 3300005435 | Ga0070714_100565508 | Ga0070714_1005655082 | 80 |
| 150 | 3300014326 | Ga0157380_12322516 | Ga0157380_123225162 | 80 |
| 151 | 3300014326 | Ga0157380_12853354 | Ga0157380_128533542 | 80 |
| 152 | 3300025927 | Ga0207687_10293653 | Ga0207687_102936532 | 80 |
| 153 | 3300025939 | Ga0207665_11570519 | Ga0207665_115705192 | 80 |
| 154 | 3300031903 | Ga0307407_10753244 | Ga0307407_107532441 | 80 |
| 155 | 3300031995 | Ga0307409_100949030 | Ga0307409_1009490302 | 80 |
| 156 | 3300032126 | Ga0307415_100939418 | Ga0307415_1009394182 | 80 |
| 157 | 3300044658 | Ga0466972_0052897 | Ga0466972_0052897_1003_1251 | 80 |
| 158 | 3300044683 | Ga0466965_0710909 | Ga0466965_0710909_189_440 | 80 |
| 159 | 3300044693 | Ga0466961_0925567 | Ga0466961_0925567_10_258 | 80 |
| 160 | 3300044706 | Ga0466964_0101327 | Ga0466964_0101327_776_1024 | 80 |
| 161 | 3300044719 | Ga0466971_0031024 | Ga0466971_0031024_1087_1335 | 80 |
| 162 | 3300044842 | Ga0466957_0255572 | Ga0466957_0255572_565_813 | 80 |
| 163 | 3300044901 | Ga0466960_0692454 | Ga0466960_0692454_225_473 | 80 |
| 164 | 3300044901 | Ga0466960_0715562 | Ga0466960_0715562_282_530 | 80 |
| 165 | 3300045976 | Ga0466967_0112149 | Ga0466967_0112149_944_1192 | 80 |
| 166 | 3300045976 | Ga0466967_1630443 | Ga0466967_1630443_325_576 | 80 |
| 167 | 3300061719 | Ga0466962_0006216 | Ga0466962_0006216_1554_1802 | 80 |
| 168 | 3300002073 | JGI24745J21846_1021065 | JGI24745J21846_10210652 | 81 |
| 169 | 3300005327 | Ga0070658_10213177 | Ga0070658_102131773 | 81 |
| 170 | 3300005328 | Ga0070676_11490528 | Ga0070676_114905281 | 81 |
| 171 | 3300005329 | Ga0070683_101783602 | Ga0070683_1017836022 | 81 |
| 172 | 3300005330 | Ga0070690_100819847 | Ga0070690_1008198472 | 81 |
| 173 | 3300005331 | Ga0070670_101501472 | Ga0070670_1015014722 | 81 |
| 174 | 3300005334 | Ga0068869_100164784 | Ga0068869_1001647842 | 81 |
| 175 | 3300005335 | Ga0070666_11235588 | Ga0070666_112355882 | 81 |
| 176 | 3300005336 | Ga0070680_100557902 | Ga0070680_1005579022 | 81 |
| 177 | 3300005338 | Ga0068868_100111886 | Ga0068868_1001118862 | 81 |
| 178 | 3300005339 | Ga0070660_100375844 | Ga0070660_1003758442 | 81 |
| 179 | 3300005343 | Ga0070687_101417921 | Ga0070687_1014179212 | 81 |
| 180 | 3300005345 | Ga0070692_10320635 | Ga0070692_103206352 | 81 |
| 181 | 3300005347 | Ga0070668_101330260 | Ga0070668_1013302602 | 81 |
| 182 | 3300005356 | Ga0070674_101407427 | Ga0070674_1014074271 | 81 |
| 183 | 3300005364 | Ga0070673_100202299 | Ga0070673_1002022992 | 81 |
| 184 | 3300005438 | Ga0070701_11112014 | Ga0070701_111120142 | 81 |
| 185 | 3300005441 | Ga0070700_100147266 | Ga0070700_1001472663 | 81 |
| 186 | 3300005457 | Ga0070662_101822524 | Ga0070662_1018225241 | 81 |
| 187 | 3300005459 | Ga0068867_100330040 | Ga0068867_1003300402 | 81 |
| 188 | 3300005466 | Ga0070685_10517592 | Ga0070685_105175922 | 81 |
| 189 | 3300005530 | Ga0070679_101795403 | Ga0070679_1017954032 | 81 |
| 190 | 3300005535 | Ga0070684_102306090 | Ga0070684_1023060901 | 81 |
| 191 | 3300005543 | Ga0070672_100425147 | Ga0070672_1004251472 | 81 |
| 192 | 3300005548 | Ga0070665_100787544 | Ga0070665_1007875442 | 81 |
| 193 | 3300005564 | Ga0070664_100796468 | Ga0070664_1007964682 | 81 |
| 194 | 3300005577 | Ga0068857_100320816 | Ga0068857_1003208163 | 81 |
| 195 | 3300005578 | Ga0068854_101538335 | Ga0068854_1015383352 | 81 |
| 196 | 3300005615 | Ga0070702_100983427 | Ga0070702_1009834272 | 81 |
| 197 | 3300005616 | Ga0068852_101669298 | Ga0068852_1016692982 | 81 |
| 198 | 3300005718 | Ga0068866_10469426 | Ga0068866_104694262 | 81 |
| 199 | 3300005834 | Ga0068851_10588808 | Ga0068851_105888082 | 81 |
| 200 | 3300005840 | Ga0068870_10881995 | Ga0068870_108819952 | 81 |
| 201 | 3300005844 | Ga0068862_100987876 | Ga0068862_1009878762 | 81 |
| 202 | 3300006871 | Ga0075434_100734085 | Ga0075434_1007340851 | 81 |
| 203 | 3300006880 | Ga0075429_100899622 | Ga0075429_1008996222 | 81 |
| 204 | 3300006881 | Ga0068865_100198393 | Ga0068865_1001983932 | 81 |
| 205 | 3300009094 | Ga0111539_11102038 | Ga0111539_111020382 | 81 |
| 206 | 3300009098 | Ga0105245_10121962 | Ga0105245_101219622 | 81 |
| 207 | 3300009098 | Ga0105245_12054869 | Ga0105245_120548692 | 81 |
| 208 | 3300009148 | Ga0105243_10207946 | Ga0105243_102079464 | 81 |
| 209 | 3300009176 | Ga0105242_10754226 | Ga0105242_107542262 | 81 |
| 210 | 3300010375 | Ga0105239_11154049 | Ga0105239_111540492 | 81 |
| 211 | 3300013105 | Ga0157369_11322499 | Ga0157369_113224992 | 81 |
| 212 | 3300014326 | Ga0157380_10150101 | Ga0157380_101501013 | 81 |
| 213 | 3300025321 | Ga0207656_10308842 | Ga0207656_103088422 | 81 |
| 214 | 3300025901 | Ga0207688_10217355 | Ga0207688_102173552 | 81 |
| 215 | 3300025907 | Ga0207645_10761232 | Ga0207645_107612322 | 81 |
| 216 | 3300025908 | Ga0207643_10151022 | Ga0207643_101510222 | 81 |
| 217 | 3300025909 | Ga0207705_10822281 | Ga0207705_108222812 | 81 |
| 218 | 3300025918 | Ga0207662_10835171 | Ga0207662_108351711 | 81 |
| 219 | 3300025919 | Ga0207657_10208688 | Ga0207657_102086882 | 81 |
| 220 | 3300025920 | Ga0207649_11358835 | Ga0207649_113588351 | 81 |
| 221 | 3300025923 | Ga0207681_10219998 | Ga0207681_102199982 | 81 |
| 222 | 3300025925 | Ga0207650_10642932 | Ga0207650_106429322 | 81 |
| 223 | 3300025927 | Ga0207687_10204686 | Ga0207687_102046862 | 81 |
| 224 | 3300025933 | Ga0207706_10145234 | Ga0207706_101452342 | 81 |
| 225 | 3300025934 | Ga0207686_10264633 | Ga0207686_102646332 | 81 |
| 226 | 3300025935 | Ga0207709_10044415 | Ga0207709_100444151 | 81 |
| 227 | 3300025936 | Ga0207670_11440375 | Ga0207670_114403752 | 81 |
| 228 | 3300025938 | Ga0207704_10487884 | Ga0207704_104878842 | 81 |
| 229 | 3300025940 | Ga0207691_10161277 | Ga0207691_101612773 | 81 |
| 230 | 3300025944 | Ga0207661_10794437 | Ga0207661_107944372 | 81 |
| 231 | 3300025960 | Ga0207651_11074406 | Ga0207651_110744062 | 81 |
| 232 | 3300025961 | Ga0207712_10874411 | Ga0207712_108744112 | 81 |
| 233 | 3300025981 | Ga0207640_11397772 | Ga0207640_113977722 | 81 |
| 234 | 3300026023 | Ga0207677_10202042 | Ga0207677_102020422 | 81 |
| 235 | 3300026075 | Ga0207708_10034339 | Ga0207708_100343396 | 81 |
| 236 | 3300026089 | Ga0207648_10042936 | Ga0207648_100429363 | 81 |
| 237 | 3300026095 | Ga0207676_10451666 | Ga0207676_104516662 | 81 |
| 238 | 3300026116 | Ga0207674_10886221 | Ga0207674_108862212 | 81 |
| 239 | 3300026121 | Ga0207683_10515825 | Ga0207683_105158252 | 81 |
| 240 | 3300026142 | Ga0207698_10717163 | Ga0207698_107171632 | 81 |
| 241 | 3300028380 | Ga0268265_10706271 | Ga0268265_107062712 | 81 |
| 242 | 3300032005 | Ga0307411_10921116 | Ga0307411_109211162 | 81 |
| 243 | 3300032126 | Ga0307415_101380106 | Ga0307415_1013801062 | 81 |
| 244 | 3300041459 | Ga0451800_1053192 | Ga0451800_1053192_16_261 | 81 |
| 245 | 3300042118 | Ga0450914_025111 | Ga0450914_025111_168_413 | 81 |
| 246 | 3300042127 | Ga0450890_013214 | Ga0450890_013214_372_617 | 81 |
| 247 | 3300042142 | Ga0450905_040917 | Ga0450905_040917_235_480 | 81 |
| 248 | 3300042157 | Ga0439458_0022007 | Ga0439458_0022007_631_876 | 81 |
| 249 | 3300042437 | Ga0439444_0043666 | Ga0439444_0043666_575_820 | 81 |
| 250 | 3300042438 | Ga0439459_0005973 | Ga0439459_0005973_537_782 | 81 |
| 251 | 3300042993 | Ga0439440_0006914 | Ga0439440_0006914_504_749 | 81 |
| 252 | 3300045976 | Ga0466967_1728098 | Ga0466967_1728098_119_367 | 81 |
| 253 | 3300048905 | Ga0496102_0851850 | Ga0496102_0851850_327_572 | 81 |
| 254 | 3300049583 | Ga0501067_0462538 | Ga0501067_0462538_169_435 | 81 |
| 255 | 3300050508 | nmdc:mga09592_228656_c1 | nmdc:mga09592_228656_c1_848_1093 | 81 |
| 256 | 3300050511 | nmdc:mga08y16_2018252_c1 | nmdc:mga08y16_2018252_c1_199_444 | 81 |
| 257 | 3300061734 | Ga0530510_0753080 | Ga0530510_0753080_264_524 | 81 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7eu0-assembly1.cif.gz_C | the cryo-em structure of a. thaliana pol iv-rdr2 backtracked complex | 0.8259 | 9 | 73 |
| 8hyj-assembly1.cif.gz_C | a cryo-em structure of ktf1-bound polymerase v transcription elongation complex | 0.8171 | 9 | 73 |
| 7eu1-assembly1.cif.gz_C | the cryo-em structure of a. thaliana pol iv-rdr2 holoenzyme | 0.7598 | 9 | 73 |
| 7ok0-assembly1.cif.gz_D | cryo-em structure of the sulfolobus acidocaldarius rna polymerase at 2.88 a | 0.7546 | 8 | 73 |
| 8a8o-assembly1.cif.gz_C | paps reductase from methanothermococcus thermolithotrophicus refined to 1.45 a | 0.7501 | 10 | 78 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O60928_162_323_2.60.40.1400 | Mainly Beta;Sandwich;Immunoglobulin-like;G protein-activated inward rectifier potassium channel 1 | 0.831 | 35 | 53 | 2.60.40.1400 |
| af_Q46905_5_80_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.808 | 11 | 69 | 3.30.70.20 |
| af_Q8IHT3_226_284_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.807 | 12 | 66 | 3.30.70.20 |
| af_P68646_5_89_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7736 | 11 | 69 | 3.30.70.20 |
| af_Q8IHT3_226_284_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7272 | 12 | 66 | 3.30.70.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538LMB1-F1-model_v4 | Ferredoxin family protein | 0.9972 | 7 | 80 |
|
| AF-A0A538ERN0-F1-model_v4 | Ferredoxin family protein | 0.9959 | 7 | 80 |
|
| AF-A0A2W6BSA5-F1-model_v4 | 4Fe-4S ferredoxin-type domain-containing protein | 0.9849 | 7 | 81 |
|
| AF-A0A7V9EBU3-F1-model_v4 | 4Fe-4S ferredoxin-type domain-containing protein | 0.9826 | 7 | 81 |
|
| AF-A0A2T4UDQ8-F1-model_v4 | 4Fe-4S ferredoxin-type domain-containing protein | 0.9749 | 7 | 81 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar