F367505

General Info

Members Datasets Scaffolds Average Seq Length
257 183 257 80

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0056296|Ga0466972_0056296_1078_1347
Length 89
Sequence MNGVFIAVEVDEAVARDAEIAAKLAEVCPVDIYAVGDDGSVRIVEENLDECVLCRLCIDAAPAGSVRVIKLYDDGPERVLSSESDPTPA

Samples

Sample ID Description Type Environment
1 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
137 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
138 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
141 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
142 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
145 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
146 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0
Rhizoplane 5.84
Rhizosphere 89.88
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1021065 3300002073 Bacteria 766
2 Ga0070658_10213177 3300005327 Bacteria 1632
3 Ga0070676_11490528 3300005328 Bacteria 521
4 Ga0070683_100110030 3300005329 Bacteria 2599
5 Ga0070683_101088779 3300005329 Bacteria 768
6 Ga0070683_101240034 3300005329 Bacteria 717
7 Ga0070683_101783602 3300005329 Bacteria 592
8 Ga0070690_100819847 3300005330 Bacteria 723
9 Ga0070670_101501472 3300005331 Bacteria 619
10 Ga0070670_101883897 3300005331 Unclassified 551
11 Ga0068869_100164784 3300005334 Bacteria 1728
12 Ga0070666_11235588 3300005335 Bacteria 557
13 Ga0070680_100557902 3300005336 Bacteria 982
14 Ga0070682_100765018 3300005337 Bacteria 781
15 Ga0070682_100938345 3300005337 Unclassified 714
16 Ga0068868_100007532 3300005338 Bacteria 7754
17 Ga0068868_100111886 3300005338 Bacteria 2219
18 Ga0068868_102023820 3300005338 Unclassified 547
19 Ga0070660_100375844 3300005339 Bacteria 1173
20 Ga0070687_101417921 3300005343 Bacteria 520
21 Ga0070692_10320635 3300005345 Bacteria 953
22 Ga0070668_101330260 3300005347 Bacteria 654
23 Ga0070669_100066461 3300005353 Bacteria 2658
24 Ga0070674_100000064 3300005356 Bacteria 47689
25 Ga0070674_101407427 3300005356 Bacteria 624
26 Ga0070673_100001567 3300005364 Bacteria 13472
27 Ga0070673_100202299 3300005364 Bacteria 1711
28 Ga0070688_100050817 3300005365 Bacteria 2584
29 Ga0070667_101053500 3300005367 Unclassified 760
30 Ga0070714_100004789 3300005435 Bacteria 10255
31 Ga0070714_100006760 3300005435 Bacteria 8890
32 Ga0070714_100565508 3300005435 Bacteria 1090
33 Ga0070701_11112014 3300005438 Bacteria 557
34 Ga0070700_100147266 3300005441 Bacteria 1606
35 Ga0070700_100668428 3300005441 Unclassified 822
36 Ga0070663_101054923 3300005455 Bacteria 709
37 Ga0070662_101822524 3300005457 Bacteria 526
38 Ga0070681_10679368 3300005458 Bacteria 945
39 Ga0068867_100330040 3300005459 Bacteria 1266
40 Ga0070685_10517592 3300005466 Bacteria 847
41 Ga0070679_100757411 3300005530 Bacteria 914
42 Ga0070679_101795403 3300005530 Bacteria 562
43 Ga0070684_102306090 3300005535 Bacteria 507
44 Ga0070672_100425147 3300005543 Bacteria 1141
45 Ga0070665_100787544 3300005548 Bacteria 964
46 Ga0070664_100796468 3300005564 Bacteria 883
47 Ga0068857_100320816 3300005577 Bacteria 1431
48 Ga0068854_101538335 3300005578 Bacteria 605
49 Ga0068856_101738788 3300005614 Bacteria 636
50 Ga0070702_100983427 3300005615 Bacteria 667
51 Ga0070702_101208224 3300005615 Bacteria 610
52 Ga0068852_100446371 3300005616 Bacteria 1280
53 Ga0068852_101669298 3300005616 Bacteria 660
54 Ga0068866_10000001 3300005718 Bacteria 519680
55 Ga0068866_10161008 3300005718 Bacteria 1309
56 Ga0068866_10469426 3300005718 Bacteria 827
57 Ga0068851_10286291 3300005834 Bacteria 944
58 Ga0068851_10588808 3300005834 Bacteria 676
59 Ga0068870_10881995 3300005840 Bacteria 631
60 Ga0068862_100987876 3300005844 Bacteria 832
61 Ga0081455_10001330 3300005937 Bacteria 30557
62 Ga0081455_10320269 3300005937 Bacteria 1105
63 Ga0081538_10003262 3300005981 Bacteria 15408
64 Ga0081540_1074684 3300005983 Bacteria 1552
65 Ga0081539_10275854 3300005985 Bacteria 734
66 Ga0075365_10522973 3300006038 Bacteria 839
67 Ga0075364_10167456 3300006051 Bacteria 1485
68 Ga0070716_100495718 3300006173 Bacteria 900
69 Ga0070712_100000003 3300006175 Bacteria 253696
70 Ga0075367_10397351 3300006178 Bacteria 872
71 Ga0075428_100609693 3300006844 Bacteria 1165
72 Ga0075430_100718435 3300006846 Bacteria 824
73 Ga0075431_100539777 3300006847 Unclassified 1154
74 Ga0075431_102135325 3300006847 Bacteria 515
75 Ga0075433_10428788 3300006852 Bacteria 1166
76 Ga0075434_100734085 3300006871 Bacteria 1005
77 Ga0075429_100899622 3300006880 Bacteria 775
78 Ga0068865_100198393 3300006881 Bacteria 1556
79 Ga0068865_100460108 3300006881 Bacteria 1054
80 Ga0099795_10244410 3300007788 Bacteria 772
81 Ga0105240_10043184 3300009093 Bacteria 5739
82 Ga0111539_10626245 3300009094 Bacteria 1253
83 Ga0111539_11102038 3300009094 Bacteria 923
84 Ga0111539_11278814 3300009094 Bacteria 852
85 Ga0105245_10121962 3300009098 Bacteria 2436
86 Ga0105245_11906187 3300009098 Bacteria 647
87 Ga0105245_12054869 3300009098 Bacteria 625
88 Ga0114129_11878161 3300009147 Bacteria 727
89 Ga0105243_10207946 3300009148 Bacteria 1721
90 Ga0105243_10861597 3300009148 Bacteria 898
91 Ga0105242_10734228 3300009176 Bacteria 970
92 Ga0105242_10754226 3300009176 Bacteria 958
93 Ga0105248_12303953 3300009177 Bacteria 613
94 Ga0105237_12272764 3300009545 Bacteria 552
95 Ga0105239_11154049 3300010375 Bacteria 892
96 Ga0157369_11322499 3300013105 Bacteria 734
97 Ga0163162_13081215 3300013306 Bacteria 535
98 Ga0157375_13121193 3300013308 Bacteria 553
99 Ga0157380_10150101 3300014326 Bacteria 2014
100 Ga0157380_12322516 3300014326 Bacteria 601
101 Ga0157380_12853354 3300014326 Bacteria 550
102 Ga0213876_10150556 3300021384 Bacteria 1237
103 Ga0207656_10308842 3300025321 Bacteria 784
104 Ga0207642_10000002 3300025899 Bacteria 658166
105 Ga0207688_10217355 3300025901 Bacteria 1150
106 Ga0207680_10068710 3300025903 Bacteria 2187
107 Ga0207685_10000027 3300025905 Bacteria 102101
108 Ga0207645_10761232 3300025907 Bacteria 658
109 Ga0207643_10151022 3300025908 Bacteria 1393
110 Ga0207705_10822281 3300025909 Bacteria 721
111 Ga0207707_10480094 3300025912 Bacteria 1062
112 Ga0207695_11624799 3300025913 Bacteria 527
113 Ga0207693_10000028 3300025915 Bacteria 120041
114 Ga0207662_10835171 3300025918 Bacteria 650
115 Ga0207657_10208688 3300025919 Bacteria 1568
116 Ga0207649_11358835 3300025920 Bacteria 562
117 Ga0207652_10673996 3300025921 Bacteria 924
118 Ga0207681_10058150 3300025923 Bacteria 2646
119 Ga0207681_10219998 3300025923 Bacteria 1469
120 Ga0207650_10642932 3300025925 Bacteria 894
121 Ga0207687_10204686 3300025927 Bacteria 1545
122 Ga0207687_10293653 3300025927 Bacteria 1307
123 Ga0207664_10000046 3300025929 Bacteria 140749
124 Ga0207664_10006937 3300025929 Bacteria 7835
125 Ga0207706_10145234 3300025933 Bacteria 2087
126 Ga0207686_10264633 3300025934 Bacteria 1262
127 Ga0207686_10645549 3300025934 Bacteria 837
128 Ga0207686_11002161 3300025934 Bacteria 678
129 Ga0207709_10044415 3300025935 Bacteria 2685
130 Ga0207670_11440375 3300025936 Bacteria 585
131 Ga0207669_10000018 3300025937 Bacteria 114254
132 Ga0207704_10327768 3300025938 Bacteria 1184
133 Ga0207704_10487884 3300025938 Bacteria 990
134 Ga0207665_11570519 3300025939 Bacteria 522
135 Ga0207691_10161277 3300025940 Bacteria 1967
136 Ga0207661_10794437 3300025944 Bacteria 871
137 Ga0207661_11145004 3300025944 Bacteria 716
138 Ga0207679_11175495 3300025945 Bacteria 704
139 Ga0207651_10002404 3300025960 Bacteria 8943
140 Ga0207651_11074406 3300025960 Bacteria 721
141 Ga0207712_10874411 3300025961 Bacteria 793
142 Ga0207640_11397772 3300025981 Bacteria 627
143 Ga0207677_10000525 3300026023 Bacteria 24518
144 Ga0207677_10202042 3300026023 Bacteria 1580
145 Ga0207677_10856272 3300026023 Bacteria 817
146 Ga0207708_10034339 3300026075 Bacteria 3858
147 Ga0207702_12330967 3300026078 Bacteria 523
148 Ga0207648_10042936 3300026089 Bacteria 3970
149 Ga0207676_10451666 3300026095 Bacteria 1212
150 Ga0207674_10886221 3300026116 Bacteria 860
151 Ga0207683_10515825 3300026121 Bacteria 1104
152 Ga0207698_10475882 3300026142 Bacteria 1211
153 Ga0207698_10717163 3300026142 Bacteria 996
154 Ga0268265_10706271 3300028380 Bacteria 975
155 Ga0268265_10773123 3300028380 Bacteria 934
156 Ga0268264_10272246 3300028381 Bacteria 1582
157 Ga0265326_10000030 3300028558 Bacteria 96518
158 Ga0265334_10000156 3300028573 Bacteria 42408
159 Ga0265338_10000536 3300028800 Bacteria 66434
160 Ga0265324_10000980 3300029957 Bacteria 17655
161 Ga0265320_10021535 3300031240 Bacteria 3464
162 Ga0265340_10468874 3300031247 Bacteria 554
163 Ga0307408_100559908 3300031548 Bacteria 1010
164 Ga0265314_10690055 3300031711 Bacteria 517
165 Ga0307405_10503515 3300031731 Bacteria 971
166 Ga0307405_10849237 3300031731 Bacteria 769
167 Ga0307413_10240291 3300031824 Bacteria 1337
168 Ga0307413_10292683 3300031824 Bacteria 1231
169 Ga0307413_10916959 3300031824 Bacteria 745
170 Ga0307413_11454929 3300031824 Bacteria 604
171 Ga0307410_11241348 3300031852 Bacteria 650
172 Ga0307406_11433442 3300031901 Bacteria 606
173 Ga0307406_11604003 3300031901 Bacteria 575
174 Ga0307407_10753244 3300031903 Bacteria 738
175 Ga0307407_11707605 3300031903 Bacteria 501
176 Ga0307412_11164976 3300031911 Bacteria 689
177 Ga0307409_100009209 3300031995 Bacteria 6053
178 Ga0307409_100360218 3300031995 Bacteria 1375
179 Ga0307409_100949030 3300031995 Bacteria 876
180 Ga0307409_101085605 3300031995 Bacteria 821
181 Ga0307409_102695613 3300031995 Bacteria 525
182 Ga0307409_102939963 3300031995 Bacteria 503
183 Ga0307416_100012581 3300032002 Bacteria 5710
184 Ga0307416_101352561 3300032002 Bacteria 818
185 Ga0307416_102282180 3300032002 Bacteria 642
186 Ga0307414_10814800 3300032004 Bacteria 852
187 Ga0307414_11002858 3300032004 Bacteria 769
188 Ga0307411_10279983 3300032005 Bacteria 1327
189 Ga0307411_10921116 3300032005 Bacteria 778
190 Ga0307415_100004028 3300032126 Bacteria 7574
191 Ga0307415_100939418 3300032126 Bacteria 800
192 Ga0307415_101327847 3300032126 Bacteria 682
193 Ga0307415_101380106 3300032126 Bacteria 670
194 Ga0307415_101475203 3300032126 Bacteria 650
195 Ga0436364_1548050 3300037853 Bacteria 600
196 Ga0451800_1053192 3300041459 Bacteria 573
197 Ga0451806_198579 3300041462 Bacteria 772
198 Ga0451837_0848824 3300041494 Bacteria 571
199 Ga0451853_2595020 3300041512 Bacteria 666
200 Ga0450914_025111 3300042118 Bacteria 688
201 Ga0450890_013214 3300042127 Bacteria 1077
202 Ga0450905_040917 3300042142 Bacteria 737
203 Ga0439458_0022007 3300042157 Bacteria 1479
204 Ga0439444_0043666 3300042437 Bacteria 889
205 Ga0439459_0005973 3300042438 Bacteria 2017
206 Ga0439440_0006914 3300042993 Bacteria 2295
207 Ga0466972_0052897 3300044658 Bacteria 1956
208 Ga0466972_0056296 3300044658 Bacteria 1891
209 Ga0466965_0710909 3300044683 Bacteria 577
210 Ga0466961_0925567 3300044693 Bacteria 519
211 Ga0466964_0101327 3300044706 Bacteria 1270
212 Ga0466971_0031024 3300044719 Bacteria 2393
213 Ga0466957_0255572 3300044842 Bacteria 1166
214 Ga0466960_0692454 3300044901 Bacteria 611
215 Ga0466960_0715562 3300044901 Bacteria 601
216 Ga0466960_1053146 3300044901 Bacteria 501
217 Ga0466967_0112149 3300045976 Bacteria 2507
218 Ga0466967_1630443 3300045976 Bacteria 642
219 Ga0466967_1728098 3300045976 Bacteria 623
220 Ga0495582_0378253 3300046473 Bacteria 816
221 Ga0495596_0156924 3300046500 Bacteria 884
222 Ga0495606_0441211 3300046507 Bacteria 669
223 Ga0495608_0000068 3300046511 Bacteria 79694
224 Ga0495628_0898887 3300046516 Bacteria 615
225 Ga0495642_0103451 3300046528 Bacteria 1214
226 Ga0495669_0138816 3300046684 Bacteria 1147
227 Ga0495674_1007939 3300047319 Bacteria 638
228 Ga0495672_0048695 3300047320 Bacteria 2512
229 Ga0496100_0438476 3300048903 Bacteria 1000
230 Ga0496101_0742318 3300048904 Bacteria 775
231 Ga0496102_0785026 3300048905 Bacteria 875
232 Ga0496102_0851850 3300048905 Bacteria 834
233 Ga0496102_1760618 3300048905 Bacteria 537
234 Ga0496107_0879877 3300048910 Bacteria 653
235 Ga0496109_0076281 3300048912 Bacteria 3083
236 Ga0496110_0714075 3300048913 Bacteria 904
237 Ga0496110_1048670 3300048913 Bacteria 723
238 Ga0496111_0703989 3300048914 Bacteria 735
239 Ga0496112_0000006 3300048915 Bacteria 365227
240 Ga0496112_0000463 3300048915 Bacteria 27080
241 Ga0496113_0035507 3300048916 Bacteria 3646
242 Ga0496121_0792611 3300048924 Bacteria 558
243 Ga0496124_0202593 3300048927 Bacteria 1508
244 Ga0496124_0418571 3300048927 Bacteria 924
245 Ga0501067_0462538 3300049583 Bacteria 709
246 nmdc:mga0yw44_864031_c1 3300050492 Bacteria 614
247 nmdc:mga09592_1162118_c1 3300050508 Bacteria 639
248 nmdc:mga09592_228656_c1 3300050508 Bacteria 1611
249 nmdc:mga0qj67_1568811_c1 3300050509 Bacteria 505
250 nmdc:mga0qj67_443052_c1 3300050509 Bacteria 1046
251 nmdc:mga0qj67_959506_c1 3300050509 Bacteria 672
252 nmdc:mga06r32_491644_c1 3300050510 Bacteria 1204
253 nmdc:mga08y16_1377464_c1 3300050511 Bacteria 669
254 nmdc:mga08y16_2018252_c1 3300050511 Bacteria 526
255 nmdc:mga0a205_724659_c1 3300050515 Bacteria 844
256 Ga0466962_0006216 3300061719 Bacteria 5736
257 Ga0530510_0753080 3300061734 Bacteria 743

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_12272764 Ga0105237_122727642 66
2 3300048910 Ga0496107_0879877 Ga0496107_0879877_384_620 68
3 3300028380 Ga0268265_10773123 Ga0268265_107731232 73
4 3300050509 nmdc:mga0qj67_1568811_c1 nmdc:mga0qj67_1568811_c1_30_251 73
5 3300005356 Ga0070674_100000064 Ga0070674_10000006445 74
6 3300005718 Ga0068866_10000001 Ga0068866_10000001365 74
7 3300025899 Ga0207642_10000002 Ga0207642_1000000285 74
8 3300025937 Ga0207669_10000018 Ga0207669_1000001862 74
9 3300026078 Ga0207702_12330967 Ga0207702_123309672 74
10 3300005353 Ga0070669_100066461 Ga0070669_1000664612 75
11 3300005364 Ga0070673_100001567 Ga0070673_1000015672 75
12 3300025923 Ga0207681_10058150 Ga0207681_100581502 75
13 3300025960 Ga0207651_10002404 Ga0207651_100024044 75
14 3300005329 Ga0070683_101088779 Ga0070683_1010887791 76
15 3300005441 Ga0070700_100668428 Ga0070700_1006684281 76
16 3300006051 Ga0075364_10167456 Ga0075364_101674562 76
17 3300006178 Ga0075367_10397351 Ga0075367_103973512 76
18 3300006847 Ga0075431_100539777 Ga0075431_1005397772 76
19 3300006852 Ga0075433_10428788 Ga0075433_104287882 76
20 3300028381 Ga0268264_10272246 Ga0268264_102722463 76
21 3300031995 Ga0307409_100360218 Ga0307409_1003602181 76
22 3300048905 Ga0496102_1760618 Ga0496102_1760618_206_445 76
23 3300048914 Ga0496111_0703989 Ga0496111_0703989_84_317 76
24 3300050510 nmdc:mga06r32_491644_c1 nmdc:mga06r32_491644_c1_550_789 76
25 3300050515 nmdc:mga0a205_724659_c1 nmdc:mga0a205_724659_c1_399_638 76
26 3300005338 Ga0068868_102023820 Ga0068868_1020238201 77
27 3300005455 Ga0070663_101054923 Ga0070663_1010549231 77
28 3300005614 Ga0068856_101738788 Ga0068856_1017387882 77
29 3300005615 Ga0070702_101208224 Ga0070702_1012082242 77
30 3300005616 Ga0068852_100446371 Ga0068852_1004463712 77
31 3300005718 Ga0068866_10161008 Ga0068866_101610082 77
32 3300005834 Ga0068851_10286291 Ga0068851_102862912 77
33 3300005985 Ga0081539_10275854 Ga0081539_102758542 77
34 3300006038 Ga0075365_10522973 Ga0075365_105229732 77
35 3300006173 Ga0070716_100495718 Ga0070716_1004957182 77
36 3300006881 Ga0068865_100460108 Ga0068865_1004601082 77
37 3300009094 Ga0111539_10626245 Ga0111539_106262452 77
38 3300009098 Ga0105245_11906187 Ga0105245_119061871 77
39 3300009148 Ga0105243_10861597 Ga0105243_108615972 77
40 3300009176 Ga0105242_10734228 Ga0105242_107342282 77
41 3300009177 Ga0105248_12303953 Ga0105248_123039532 77
42 3300013306 Ga0163162_13081215 Ga0163162_130812152 77
43 3300013308 Ga0157375_13121193 Ga0157375_131211931 77
44 3300021384 Ga0213876_10150556 Ga0213876_101505562 77
45 3300025905 Ga0207685_10000027 Ga0207685_1000002721 77
46 3300025934 Ga0207686_10645549 Ga0207686_106455492 77
47 3300025938 Ga0207704_10327768 Ga0207704_103277682 77
48 3300026023 Ga0207677_10856272 Ga0207677_108562721 77
49 3300026142 Ga0207698_10475882 Ga0207698_104758822 77
50 3300031548 Ga0307408_100559908 Ga0307408_1005599082 77
51 3300031731 Ga0307405_10503515 Ga0307405_105035152 77
52 3300031731 Ga0307405_10849237 Ga0307405_108492372 77
53 3300031824 Ga0307413_10240291 Ga0307413_102402912 77
54 3300031824 Ga0307413_10916959 Ga0307413_109169591 77
55 3300031824 Ga0307413_11454929 Ga0307413_114549292 77
56 3300031852 Ga0307410_11241348 Ga0307410_112413482 77
57 3300031901 Ga0307406_11433442 Ga0307406_114334422 77
58 3300031903 Ga0307407_11707605 Ga0307407_117076052 77
59 3300031995 Ga0307409_100009209 Ga0307409_1000092092 77
60 3300031995 Ga0307409_102695613 Ga0307409_1026956132 77
61 3300032002 Ga0307416_100012581 Ga0307416_1000125812 77
62 3300032004 Ga0307414_10814800 Ga0307414_108148002 77
63 3300032005 Ga0307411_10279983 Ga0307411_102799832 77
64 3300032126 Ga0307415_100004028 Ga0307415_1000040288 77
65 3300032126 Ga0307415_101327847 Ga0307415_1013278472 77
66 3300037853 Ga0436364_1548050 Ga0436364_1548050_144_377 77
67 3300041462 Ga0451806_198579 Ga0451806_198579_448_681 77
68 3300046473 Ga0495582_0378253 Ga0495582_0378253_227_460 77
69 3300046500 Ga0495596_0156924 Ga0495596_0156924_544_777 77
70 3300048913 Ga0496110_0714075 Ga0496110_0714075_652_894 77
71 3300048913 Ga0496110_1048670 Ga0496110_1048670_91_324 77
72 3300050492 nmdc:mga0yw44_864031_c1 nmdc:mga0yw44_864031_c1_25_258 77
73 3300005329 Ga0070683_100110030 Ga0070683_1001100302 78
74 3300005329 Ga0070683_101240034 Ga0070683_1012400341 78
75 3300005331 Ga0070670_101883897 Ga0070670_1018838972 78
76 3300005337 Ga0070682_100765018 Ga0070682_1007650182 78
77 3300005337 Ga0070682_100938345 Ga0070682_1009383451 78
78 3300005338 Ga0068868_100007532 Ga0068868_1000075326 78
79 3300005365 Ga0070688_100050817 Ga0070688_1000508171 78
80 3300005367 Ga0070667_101053500 Ga0070667_1010535001 78
81 3300005435 Ga0070714_100004789 Ga0070714_10000478911 78
82 3300005435 Ga0070714_100006760 Ga0070714_1000067608 78
83 3300005458 Ga0070681_10679368 Ga0070681_106793682 78
84 3300005530 Ga0070679_100757411 Ga0070679_1007574112 78
85 3300005937 Ga0081455_10001330 Ga0081455_1000133012 78
86 3300005937 Ga0081455_10320269 Ga0081455_103202692 78
87 3300005981 Ga0081538_10003262 Ga0081538_1000326214 78
88 3300005983 Ga0081540_1074684 Ga0081540_10746842 78
89 3300006175 Ga0070712_100000003 Ga0070712_1000000033 78
90 3300006844 Ga0075428_100609693 Ga0075428_1006096932 78
91 3300006846 Ga0075430_100718435 Ga0075430_1007184352 78
92 3300006847 Ga0075431_102135325 Ga0075431_1021353251 78
93 3300007788 Ga0099795_10244410 Ga0099795_102444102 78
94 3300009093 Ga0105240_10043184 Ga0105240_100431846 78
95 3300009094 Ga0111539_11278814 Ga0111539_112788142 78
96 3300009147 Ga0114129_11878161 Ga0114129_118781611 78
97 3300025903 Ga0207680_10068710 Ga0207680_100687102 78
98 3300025912 Ga0207707_10480094 Ga0207707_104800942 78
99 3300025913 Ga0207695_11624799 Ga0207695_116247992 78
100 3300025915 Ga0207693_10000028 Ga0207693_1000002889 78
101 3300025921 Ga0207652_10673996 Ga0207652_106739962 78
102 3300025929 Ga0207664_10000046 Ga0207664_1000004699 78
103 3300025929 Ga0207664_10006937 Ga0207664_100069372 78
104 3300025934 Ga0207686_11002161 Ga0207686_110021612 78
105 3300025944 Ga0207661_11145004 Ga0207661_111450041 78
106 3300025945 Ga0207679_11175495 Ga0207679_111754952 78
107 3300026023 Ga0207677_10000525 Ga0207677_1000052515 78
108 3300028558 Ga0265326_10000030 Ga0265326_1000003025 78
109 3300028573 Ga0265334_10000156 Ga0265334_1000015632 78
110 3300028800 Ga0265338_10000536 Ga0265338_1000053622 78
111 3300029957 Ga0265324_10000980 Ga0265324_1000098016 78
112 3300031240 Ga0265320_10021535 Ga0265320_100215352 78
113 3300031247 Ga0265340_10468874 Ga0265340_104688742 78
114 3300031711 Ga0265314_10690055 Ga0265314_106900552 78
115 3300031901 Ga0307406_11604003 Ga0307406_116040032 78
116 3300031911 Ga0307412_11164976 Ga0307412_111649762 78
117 3300031995 Ga0307409_101085605 Ga0307409_1010856052 78
118 3300031995 Ga0307409_102939963 Ga0307409_1029399631 78
119 3300032002 Ga0307416_101352561 Ga0307416_1013525612 78
120 3300032002 Ga0307416_102282180 Ga0307416_1022821802 78
121 3300032126 Ga0307415_101475203 Ga0307415_1014752032 78
122 3300041494 Ga0451837_0848824 Ga0451837_0848824_50_292 78
123 3300041512 Ga0451853_2595020 Ga0451853_2595020_106_342 78
124 3300044658 Ga0466972_0056296 Ga0466972_0056296_1078_1347 78
125 3300044901 Ga0466960_1053146 Ga0466960_1053146_148_393 78
126 3300046507 Ga0495606_0441211 Ga0495606_0441211_285_521 78
127 3300046528 Ga0495642_0103451 Ga0495642_0103451_52_288 78
128 3300047320 Ga0495672_0048695 Ga0495672_0048695_709_954 78
129 3300048903 Ga0496100_0438476 Ga0496100_0438476_104_346 78
130 3300048904 Ga0496101_0742318 Ga0496101_0742318_503_739 78
131 3300048905 Ga0496102_0785026 Ga0496102_0785026_580_816 78
132 3300048912 Ga0496109_0076281 Ga0496109_0076281_369_614 78
133 3300048915 Ga0496112_0000006 Ga0496112_0000006_337806_338051 78
134 3300048915 Ga0496112_0000463 Ga0496112_0000463_8058_8300 78
135 3300048916 Ga0496113_0035507 Ga0496113_0035507_285_530 78
136 3300048927 Ga0496124_0202593 Ga0496124_0202593_1232_1474 78
137 3300048927 Ga0496124_0418571 Ga0496124_0418571_28_270 78
138 3300050508 nmdc:mga09592_1162118_c1 nmdc:mga09592_1162118_c1_238_474 78
139 3300050509 nmdc:mga0qj67_443052_c1 nmdc:mga0qj67_443052_c1_582_818 78
140 3300050509 nmdc:mga0qj67_959506_c1 nmdc:mga0qj67_959506_c1_227_466 78
141 3300050511 nmdc:mga08y16_1377464_c1 nmdc:mga08y16_1377464_c1_170_406 78
142 3300031824 Ga0307413_10292683 Ga0307413_102926832 79
143 3300032004 Ga0307414_11002858 Ga0307414_110028582 79
144 3300046511 Ga0495608_0000068 Ga0495608_0000068_77229_77489 79
145 3300046516 Ga0495628_0898887 Ga0495628_0898887_320_565 79
146 3300046684 Ga0495669_0138816 Ga0495669_0138816_179_439 79
147 3300047319 Ga0495674_1007939 Ga0495674_1007939_45_290 79
148 3300048924 Ga0496121_0792611 Ga0496121_0792611_42_296 79
149 3300005435 Ga0070714_100565508 Ga0070714_1005655082 80
150 3300014326 Ga0157380_12322516 Ga0157380_123225162 80
151 3300014326 Ga0157380_12853354 Ga0157380_128533542 80
152 3300025927 Ga0207687_10293653 Ga0207687_102936532 80
153 3300025939 Ga0207665_11570519 Ga0207665_115705192 80
154 3300031903 Ga0307407_10753244 Ga0307407_107532441 80
155 3300031995 Ga0307409_100949030 Ga0307409_1009490302 80
156 3300032126 Ga0307415_100939418 Ga0307415_1009394182 80
157 3300044658 Ga0466972_0052897 Ga0466972_0052897_1003_1251 80
158 3300044683 Ga0466965_0710909 Ga0466965_0710909_189_440 80
159 3300044693 Ga0466961_0925567 Ga0466961_0925567_10_258 80
160 3300044706 Ga0466964_0101327 Ga0466964_0101327_776_1024 80
161 3300044719 Ga0466971_0031024 Ga0466971_0031024_1087_1335 80
162 3300044842 Ga0466957_0255572 Ga0466957_0255572_565_813 80
163 3300044901 Ga0466960_0692454 Ga0466960_0692454_225_473 80
164 3300044901 Ga0466960_0715562 Ga0466960_0715562_282_530 80
165 3300045976 Ga0466967_0112149 Ga0466967_0112149_944_1192 80
166 3300045976 Ga0466967_1630443 Ga0466967_1630443_325_576 80
167 3300061719 Ga0466962_0006216 Ga0466962_0006216_1554_1802 80
168 3300002073 JGI24745J21846_1021065 JGI24745J21846_10210652 81
169 3300005327 Ga0070658_10213177 Ga0070658_102131773 81
170 3300005328 Ga0070676_11490528 Ga0070676_114905281 81
171 3300005329 Ga0070683_101783602 Ga0070683_1017836022 81
172 3300005330 Ga0070690_100819847 Ga0070690_1008198472 81
173 3300005331 Ga0070670_101501472 Ga0070670_1015014722 81
174 3300005334 Ga0068869_100164784 Ga0068869_1001647842 81
175 3300005335 Ga0070666_11235588 Ga0070666_112355882 81
176 3300005336 Ga0070680_100557902 Ga0070680_1005579022 81
177 3300005338 Ga0068868_100111886 Ga0068868_1001118862 81
178 3300005339 Ga0070660_100375844 Ga0070660_1003758442 81
179 3300005343 Ga0070687_101417921 Ga0070687_1014179212 81
180 3300005345 Ga0070692_10320635 Ga0070692_103206352 81
181 3300005347 Ga0070668_101330260 Ga0070668_1013302602 81
182 3300005356 Ga0070674_101407427 Ga0070674_1014074271 81
183 3300005364 Ga0070673_100202299 Ga0070673_1002022992 81
184 3300005438 Ga0070701_11112014 Ga0070701_111120142 81
185 3300005441 Ga0070700_100147266 Ga0070700_1001472663 81
186 3300005457 Ga0070662_101822524 Ga0070662_1018225241 81
187 3300005459 Ga0068867_100330040 Ga0068867_1003300402 81
188 3300005466 Ga0070685_10517592 Ga0070685_105175922 81
189 3300005530 Ga0070679_101795403 Ga0070679_1017954032 81
190 3300005535 Ga0070684_102306090 Ga0070684_1023060901 81
191 3300005543 Ga0070672_100425147 Ga0070672_1004251472 81
192 3300005548 Ga0070665_100787544 Ga0070665_1007875442 81
193 3300005564 Ga0070664_100796468 Ga0070664_1007964682 81
194 3300005577 Ga0068857_100320816 Ga0068857_1003208163 81
195 3300005578 Ga0068854_101538335 Ga0068854_1015383352 81
196 3300005615 Ga0070702_100983427 Ga0070702_1009834272 81
197 3300005616 Ga0068852_101669298 Ga0068852_1016692982 81
198 3300005718 Ga0068866_10469426 Ga0068866_104694262 81
199 3300005834 Ga0068851_10588808 Ga0068851_105888082 81
200 3300005840 Ga0068870_10881995 Ga0068870_108819952 81
201 3300005844 Ga0068862_100987876 Ga0068862_1009878762 81
202 3300006871 Ga0075434_100734085 Ga0075434_1007340851 81
203 3300006880 Ga0075429_100899622 Ga0075429_1008996222 81
204 3300006881 Ga0068865_100198393 Ga0068865_1001983932 81
205 3300009094 Ga0111539_11102038 Ga0111539_111020382 81
206 3300009098 Ga0105245_10121962 Ga0105245_101219622 81
207 3300009098 Ga0105245_12054869 Ga0105245_120548692 81
208 3300009148 Ga0105243_10207946 Ga0105243_102079464 81
209 3300009176 Ga0105242_10754226 Ga0105242_107542262 81
210 3300010375 Ga0105239_11154049 Ga0105239_111540492 81
211 3300013105 Ga0157369_11322499 Ga0157369_113224992 81
212 3300014326 Ga0157380_10150101 Ga0157380_101501013 81
213 3300025321 Ga0207656_10308842 Ga0207656_103088422 81
214 3300025901 Ga0207688_10217355 Ga0207688_102173552 81
215 3300025907 Ga0207645_10761232 Ga0207645_107612322 81
216 3300025908 Ga0207643_10151022 Ga0207643_101510222 81
217 3300025909 Ga0207705_10822281 Ga0207705_108222812 81
218 3300025918 Ga0207662_10835171 Ga0207662_108351711 81
219 3300025919 Ga0207657_10208688 Ga0207657_102086882 81
220 3300025920 Ga0207649_11358835 Ga0207649_113588351 81
221 3300025923 Ga0207681_10219998 Ga0207681_102199982 81
222 3300025925 Ga0207650_10642932 Ga0207650_106429322 81
223 3300025927 Ga0207687_10204686 Ga0207687_102046862 81
224 3300025933 Ga0207706_10145234 Ga0207706_101452342 81
225 3300025934 Ga0207686_10264633 Ga0207686_102646332 81
226 3300025935 Ga0207709_10044415 Ga0207709_100444151 81
227 3300025936 Ga0207670_11440375 Ga0207670_114403752 81
228 3300025938 Ga0207704_10487884 Ga0207704_104878842 81
229 3300025940 Ga0207691_10161277 Ga0207691_101612773 81
230 3300025944 Ga0207661_10794437 Ga0207661_107944372 81
231 3300025960 Ga0207651_11074406 Ga0207651_110744062 81
232 3300025961 Ga0207712_10874411 Ga0207712_108744112 81
233 3300025981 Ga0207640_11397772 Ga0207640_113977722 81
234 3300026023 Ga0207677_10202042 Ga0207677_102020422 81
235 3300026075 Ga0207708_10034339 Ga0207708_100343396 81
236 3300026089 Ga0207648_10042936 Ga0207648_100429363 81
237 3300026095 Ga0207676_10451666 Ga0207676_104516662 81
238 3300026116 Ga0207674_10886221 Ga0207674_108862212 81
239 3300026121 Ga0207683_10515825 Ga0207683_105158252 81
240 3300026142 Ga0207698_10717163 Ga0207698_107171632 81
241 3300028380 Ga0268265_10706271 Ga0268265_107062712 81
242 3300032005 Ga0307411_10921116 Ga0307411_109211162 81
243 3300032126 Ga0307415_101380106 Ga0307415_1013801062 81
244 3300041459 Ga0451800_1053192 Ga0451800_1053192_16_261 81
245 3300042118 Ga0450914_025111 Ga0450914_025111_168_413 81
246 3300042127 Ga0450890_013214 Ga0450890_013214_372_617 81
247 3300042142 Ga0450905_040917 Ga0450905_040917_235_480 81
248 3300042157 Ga0439458_0022007 Ga0439458_0022007_631_876 81
249 3300042437 Ga0439444_0043666 Ga0439444_0043666_575_820 81
250 3300042438 Ga0439459_0005973 Ga0439459_0005973_537_782 81
251 3300042993 Ga0439440_0006914 Ga0439440_0006914_504_749 81
252 3300045976 Ga0466967_1728098 Ga0466967_1728098_119_367 81
253 3300048905 Ga0496102_0851850 Ga0496102_0851850_327_572 81
254 3300049583 Ga0501067_0462538 Ga0501067_0462538_169_435 81
255 3300050508 nmdc:mga09592_228656_c1 nmdc:mga09592_228656_c1_848_1093 81
256 3300050511 nmdc:mga08y16_2018252_c1 nmdc:mga08y16_2018252_c1_199_444 81
257 3300061734 Ga0530510_0753080 Ga0530510_0753080_264_524 81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eu0-assembly1.cif.gz_C the cryo-em structure of a. thaliana pol iv-rdr2 backtracked complex 0.8259 9 73
8hyj-assembly1.cif.gz_C a cryo-em structure of ktf1-bound polymerase v transcription elongation complex 0.8171 9 73
7eu1-assembly1.cif.gz_C the cryo-em structure of a. thaliana pol iv-rdr2 holoenzyme 0.7598 9 73
7ok0-assembly1.cif.gz_D cryo-em structure of the sulfolobus acidocaldarius rna polymerase at 2.88 a 0.7546 8 73
8a8o-assembly1.cif.gz_C paps reductase from methanothermococcus thermolithotrophicus refined to 1.45 a 0.7501 10 78
ID Description Score Start End Superfamily
af_O60928_162_323_2.60.40.1400 Mainly Beta;Sandwich;Immunoglobulin-like;G protein-activated inward rectifier potassium channel 1 0.831 35 53 2.60.40.1400
af_Q46905_5_80_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.808 11 69 3.30.70.20
af_Q8IHT3_226_284_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.807 12 66 3.30.70.20
af_P68646_5_89_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7736 11 69 3.30.70.20
af_Q8IHT3_226_284_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7272 12 66 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A538LMB1-F1-model_v4 Ferredoxin family protein 0.9972 7 80
AF-A0A538ERN0-F1-model_v4 Ferredoxin family protein 0.9959 7 80
AF-A0A2W6BSA5-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9849 7 81
AF-A0A7V9EBU3-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9826 7 81
AF-A0A2T4UDQ8-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9749 7 81

Feature Viewer

pLDDT pTM Quality
91.93 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map