F367493

General Info

Members Datasets Scaffolds Average Seq Length
257 171 514 258

Family's Representative Sequence

Representative Sequence 3300042016|Ga0439463_034594|Ga0439463_034594_238_1113
Length 291
Sequence VIDLYERAETTPRPSDDALRLFDLTGRVALVTGGTRGLGLAIARAFSSAGADLVVASRKADACDAVAAELRAGGGRALACPCHVGRWDDLERLVEASYGEFGRVDVLVNSAGISPLYPSLSAVSEELFDKVIGVNLKGPFRLSALVGERMVAGDGGSIVNISSTGAVRPTGDIVPYSAAKAGLNAMTVGLADALGPRVRVNAIMPGPFLTTISRNWDMDALAQRTQTFPLRRAGVADEIVGAALYLAGDASTYTTGSILTVDGGAQWSMPGGGDARDGIAASGVCDDPGEG

Samples

Sample ID Description Type Environment
1 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
2 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
132 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
157 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
158 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
159 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
160 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
161 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
162 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 2508501039 Frankia saprophytica CN3 Isolate Nodule
166 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
167 2671180195 Frankia sp. CcI49 Isolate Nodule
168 2687453737 Frankia sp. BMG5.36 Isolate Nodule
169 2773857922 Frankia sp. CcI49 Isolate Nodule
170 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
171 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.89
Metatranscriptomes 0.39
Isolates 2.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.06
Nodule 1.56
Rhizoplane 14.01
Rhizosphere 60.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439463_034594 3300042016 Bacteria 1278
2 Ga0070687_100248217 3300005343 Bacteria 1104
3 Ga0070668_100009537 3300005347 Bacteria 7203
4 Ga0070668_100051802 3300005347 Bacteria 3164
5 Ga0070714_100045110 3300005435 Bacteria 3734
6 Ga0070714_100527528 3300005435 Bacteria 1128
7 Ga0070713_100408304 3300005436 Bacteria 1269
8 Ga0070710_10073015 3300005437 Bacteria 1982
9 Ga0070705_100119183 3300005440 Bacteria 1701
10 Ga0070708_100002767 3300005445 Bacteria 13624
11 Ga0070708_100003778 3300005445 Bacteria 11881
12 Ga0070708_100092592 3300005445 Bacteria 2754
13 Ga0070685_10053937 3300005466 Bacteria 2331
14 Ga0070706_100014372 3300005467 Bacteria 7316
15 Ga0070706_100161234 3300005467 Bacteria 2094
16 Ga0070707_100005065 3300005468 Bacteria 12355
17 Ga0070707_100287447 3300005468 Bacteria 1598
18 Ga0070698_100012772 3300005471 Bacteria 8896
19 Ga0070698_100026413 3300005471 Bacteria 6044
20 Ga0070699_100008573 3300005518 Bacteria 8858
21 Ga0070684_100511165 3300005535 Bacteria 1113
22 Ga0070697_100157081 3300005536 Bacteria 1920
23 Ga0070696_100035439 3300005546 Bacteria 3436
24 Ga0070665_100011436 3300005548 Bacteria 8973
25 Ga0070704_100286648 3300005549 Bacteria 1367
26 Ga0068856_100226388 3300005614 Bacteria 1885
27 Ga0068859_100013416 3300005617 Bacteria 8216
28 Ga0068864_100072480 3300005618 Bacteria 3002
29 Ga0068864_100076551 3300005618 Bacteria 2924
30 Ga0068863_100000568 3300005841 Bacteria 37563
31 Ga0068863_100000707 3300005841 Bacteria 33567
32 Ga0068858_100003378 3300005842 Bacteria 15887
33 Ga0068860_100011962 3300005843 Bacteria 8553
34 Ga0068860_100105641 3300005843 Bacteria 2689
35 Ga0068862_100000087 3300005844 Bacteria 110040
36 Ga0068862_100067229 3300005844 Bacteria 3089
37 Ga0068862_100086899 3300005844 Bacteria 2719
38 Ga0070717_10013456 3300006028 Bacteria 6270
39 Ga0070717_10129762 3300006028 Bacteria 2167
40 Ga0075365_10041852 3300006038 Bacteria 2994
41 Ga0075365_10150249 3300006038 Bacteria 1620
42 Ga0075363_100052963 3300006048 Bacteria 2167
43 Ga0075363_100107490 3300006048 Bacteria 1548
44 Ga0075363_100167421 3300006048 Bacteria 1246
45 Ga0075363_100212711 3300006048 Bacteria 1107
46 Ga0075364_10125077 3300006051 Bacteria 1723
47 Ga0075364_10493225 3300006051 Bacteria 837
48 Ga0070715_10243280 3300006163 Bacteria 937
49 Ga0070716_100006202 3300006173 Bacteria 5834
50 Ga0070716_100036451 3300006173 Bacteria 2712
51 Ga0070712_100140652 3300006175 Bacteria 1841
52 Ga0075362_10023880 3300006177 Bacteria 2589
53 Ga0075367_10067402 3300006178 Bacteria 2146
54 Ga0075367_10089230 3300006178 Bacteria 1874
55 Ga0075367_10137852 3300006178 Bacteria 1510
56 Ga0075369_10140254 3300006186 Bacteria 1102
57 Ga0075370_10174809 3300006353 Bacteria 1263
58 Ga0075428_100052125 3300006844 Bacteria 4486
59 Ga0075430_100007684 3300006846 Bacteria 9108
60 Ga0075431_100000393 3300006847 Bacteria 35138
61 Ga0075431_100178969 3300006847 Bacteria 2177
62 Ga0075429_100004603 3300006880 Bacteria 11862
63 Ga0097620_100013416 3300006931 Bacteria 8216
64 Ga0105247_10122130 3300009101 Bacteria 1689
65 Ga0105248_10016531 3300009177 Bacteria 8124
66 Ga0105249_10014927 3300009553 Bacteria 6870
67 Ga0105249_10058973 3300009553 Bacteria 3519
68 Ga0163163_10003112 3300014325 Bacteria 14060
69 Ga0163163_10040562 3300014325 Bacteria 4546
70 Ga0163163_10183405 3300014325 Bacteria 2140
71 Ga0163163_10769072 3300014325 Bacteria 1026
72 Ga0157379_10029933 3300014968 Bacteria 4842
73 Ga0157379_10086144 3300014968 Bacteria 2816
74 Ga0213874_10026876 3300021377 Bacteria 1633
75 Ga0213876_10192076 3300021384 Bacteria 1086
76 Ga0213875_10018254 3300021388 Bacteria 3382
77 Ga0213875_10094865 3300021388 Bacteria 1391
78 Ga0213875_10130461 3300021388 Bacteria 1175
79 Ga0207653_10024230 3300025885 Bacteria 1937
80 Ga0207647_10045131 3300025904 Bacteria 2751
81 Ga0207684_10079142 3300025910 Bacteria 2796
82 Ga0207684_10129114 3300025910 Bacteria 2169
83 Ga0207693_10006790 3300025915 Bacteria 9450
84 Ga0207663_10101431 3300025916 Bacteria 1934
85 Ga0207646_10015863 3300025922 Bacteria 7090
86 Ga0207646_10050868 3300025922 Bacteria 3708
87 Ga0207646_10225055 3300025922 Bacteria 1695
88 Ga0207700_10145359 3300025928 Bacteria 1953
89 Ga0207664_10025481 3300025929 Bacteria 4457
90 Ga0207664_10133598 3300025929 Bacteria 2091
91 Ga0207665_10000520 3300025939 Bacteria 26052
92 Ga0207665_10054236 3300025939 Bacteria 2703
93 Ga0207711_10033475 3300025941 Bacteria 4348
94 Ga0207712_10060434 3300025961 Bacteria 2686
95 Ga0207668_10000128 3300025972 Bacteria 53883
96 Ga0207668_10021856 3300025972 Bacteria 4085
97 Ga0207703_10009272 3300026035 Bacteria 7739
98 Ga0207703_10302367 3300026035 Bacteria 1459
99 Ga0207702_10187494 3300026078 Bacteria 1909
100 Ga0207702_10344800 3300026078 Bacteria 1424
101 Ga0207702_10370404 3300026078 Bacteria 1375
102 Ga0207641_10000590 3300026088 Bacteria 39948
103 Ga0207641_10001572 3300026088 Bacteria 22309
104 Ga0207648_10485421 3300026089 Bacteria 1129
105 Ga0207676_10047214 3300026095 Bacteria 3336
106 Ga0207676_10121952 3300026095 Bacteria 2200
107 Ga0207674_10142917 3300026116 Bacteria 2352
108 Ga0207675_100080006 3300026118 Bacteria 3063
109 Ga0268266_10008731 3300028379 Bacteria 8981
110 Ga0268265_10000070 3300028380 Bacteria 138524
111 Ga0268264_10008444 3300028381 Bacteria 8565
112 Ga0268264_10150382 3300028381 Bacteria 2087
113 Ga0307515_10048479 3300028794 Bacteria 6421
114 Ga0265338_10001597 3300028800 Bacteria 36374
115 Ga0265338_10065511 3300028800 Bacteria 3150
116 Ga0307512_10005148 3300030522 Bacteria 13817
117 Ga0307512_10015378 3300030522 Bacteria 7095
118 Ga0307513_10018192 3300031456 Bacteria 8409
119 Ga0307513_10168239 3300031456 Bacteria 2073
120 Ga0307508_10168143 3300031616 Bacteria 1796
121 Ga0307516_10010778 3300031730 Bacteria 10008
122 Ga0307516_10071154 3300031730 Bacteria 3339
123 Ga0307410_10310102 3300031852 Bacteria 1248
124 Ga0307409_100033220 3300031995 Bacteria 3752
125 Ga0307415_100321645 3300032126 Bacteria 1290
126 Ga0373941_0010843 3300035115 Bacteria 2341
127 Ga0373924_0048934 3300035410 Bacteria 1748
128 Ga0373933_0198497 3300035724 Bacteria 1283
129 Ga0373937_0020850 3300036401 Bacteria 5878
130 Ga0372808_000128 3300036459 Bacteria 4116
131 Ga0436364_0029177 3300037853 Bacteria 1319
132 Ga0436364_0335124 3300037853 Bacteria 5485
133 Ga0436364_0399188 3300037853 Bacteria 1138
134 Ga0436364_0589011 3300037853 Bacteria 2218
135 Ga0436364_1521327 3300037853 Bacteria 1594
136 Ga0436363_0140356 3300039450 Bacteria 2874
137 Ga0466966_0132537 3300044684 Bacteria 1525
138 Ga0466963_0065719 3300044694 Bacteria 2432
139 Ga0466963_0231214 3300044694 Bacteria 1296
140 Ga0466959_0190126 3300045049 Bacteria 1433
141 Ga0466959_0408237 3300045049 Bacteria 923
142 Ga0466958_0076816 3300045836 Bacteria 2050
143 Ga0466967_0079925 3300045976 Bacteria 2949
144 Ga0466967_0320691 3300045976 Bacteria 1494
145 Ga0466967_0399365 3300045976 Bacteria 1337
146 Ga0495638_0216495 3300046460 Bacteria 1073
147 Ga0495651_0003493 3300046462 Bacteria 12048
148 Ga0495653_0109985 3300046463 Bacteria 1982
149 Ga0495650_0016015 3300046471 Bacteria 3819
150 Ga0495580_0386546 3300046472 Bacteria 945
151 Ga0495582_0028916 3300046473 Bacteria 3043
152 Ga0495664_0132312 3300046477 Bacteria 1511
153 Ga0495608_0069756 3300046511 Bacteria 2295
154 Ga0495608_0092961 3300046511 Bacteria 1949
155 Ga0495618_0087956 3300046514 Bacteria 1987
156 Ga0495652_0044446 3300046529 Bacteria 3825
157 Ga0495652_0204546 3300046529 Bacteria 1496
158 Ga0495652_0227931 3300046529 Bacteria 1396
159 Ga0495667_0003093 3300046559 Bacteria 11163
160 Ga0495599_0129421 3300046678 Bacteria 1568
161 Ga0495623_0073091 3300046679 Bacteria 2132
162 Ga0495658_0268366 3300046683 Bacteria 1075
163 Ga0495669_0137257 3300046684 Bacteria 1153
164 Ga0495624_0076064 3300046690 Bacteria 2084
165 Ga0495680_0286757 3300047322 Bacteria 1159
166 Ga0495602_0045927 3300048088 Bacteria 3950
167 Ga0496100_0011251 3300048903 Bacteria 5090
168 Ga0496100_0011531 3300048903 Bacteria 5033
169 Ga0496100_0013685 3300048903 Bacteria 4688
170 Ga0496101_0011013 3300048904 Bacteria 5989
171 Ga0496101_0044896 3300048904 Bacteria 3163
172 Ga0496101_0096303 3300048904 Bacteria 2209
173 Ga0496102_0000017 3300048905 Bacteria 284200
174 Ga0496102_0037714 3300048905 Bacteria 4361
175 Ga0496102_0072221 3300048905 Bacteria 3170
176 Ga0496103_0000041 3300048906 Bacteria 169542
177 Ga0496103_0222264 3300048906 Bacteria 1215
178 Ga0496104_0003005 3300048907 Bacteria 14521
179 Ga0496104_0482153 3300048907 Bacteria 1151
180 Ga0496105_0003082 3300048908 Bacteria 12254
181 Ga0496105_0003946 3300048908 Bacteria 11094
182 Ga0496105_0247598 3300048908 Bacteria 1445
183 Ga0496106_0022685 3300048909 Bacteria 4664
184 Ga0496106_0061702 3300048909 Bacteria 2845
185 Ga0496107_0008758 3300048910 Bacteria 7011
186 Ga0496107_0208779 3300048910 Bacteria 1452
187 Ga0496107_0248478 3300048910 Bacteria 1323
188 Ga0496108_0000551 3300048911 Bacteria 29323
189 Ga0496108_0136455 3300048911 Bacteria 2111
190 Ga0496109_0005274 3300048912 Bacteria 10798
191 Ga0496109_0018807 3300048912 Bacteria 6077
192 Ga0496109_0372145 3300048912 Bacteria 1350
193 Ga0496110_0001359 3300048913 Bacteria 17641
194 Ga0496110_0025553 3300048913 Bacteria 5047
195 Ga0496110_0228485 3300048913 Bacteria 1692
196 Ga0496111_0001966 3300048914 Bacteria 12212
197 Ga0496111_0093941 3300048914 Bacteria 2199
198 Ga0496112_0009524 3300048915 Bacteria 8761
199 Ga0496112_0132855 3300048915 Bacteria 2460
200 Ga0496113_0005438 3300048916 Bacteria 7942
201 Ga0496114_0079881 3300048917 Bacteria 2762
202 Ga0496114_0301244 3300048917 Bacteria 1415
203 Ga0496116_0000121 3300048919 Bacteria 166606
204 Ga0496117_0000215 3300048920 Bacteria 111676
205 Ga0496118_0000057 3300048921 Bacteria 228315
206 Ga0496119_0006697 3300048922 Bacteria 10590
207 Ga0496121_0006025 3300048924 Bacteria 15290
208 Ga0496124_0117483 3300048927 Bacteria 2130
209 Ga0496125_0013269 3300048928 Bacteria 8108
210 Ga0496126_0000135 3300048929 Bacteria 169551
211 Ga0501036_0094645 3300049572 Bacteria 2525
212 Ga0501036_0710692 3300049572 Bacteria 830
213 Ga0501039_0026411 3300049575 Bacteria 4462
214 Ga0501042_0110251 3300049578 Bacteria 1982
215 Ga0501046_0269150 3300049580 Bacteria 1250
216 Ga0501048_0088681 3300049582 Bacteria 2182
217 Ga0501068_0164434 3300049584 Bacteria 1399
218 Ga0501069_0000043 3300049585 Bacteria 77795
219 Ga0501070_0000298 3300049586 Bacteria 46144
220 Ga0501070_0454793 3300049586 Bacteria 1032
221 Ga0501071_0075643 3300049587 Bacteria 2458
222 Ga0501071_0201559 3300049587 Bacteria 1495
223 Ga0501076_0052105 3300049592 Bacteria 3241
224 Ga0501077_0022731 3300049593 Bacteria 3974
225 Ga0501080_0140908 3300049742 Bacteria 2229
226 nmdc:mga03683_46551_c1 3300050489 Bacteria 1798
227 nmdc:mga03n38_329147_c1 3300050490 Bacteria 827
228 nmdc:mga03n38_36743_c1 3300050490 Bacteria 2108
229 nmdc:mga0yw44_3159_c1 3300050492 Bacteria 7230
230 nmdc:mga0yw44_83779_c1 3300050492 Bacteria 2003
231 nmdc:mga0yw44_89404_c1 3300050492 Bacteria 1943
232 nmdc:mga06z11_21051_c1 3300050494 Bacteria 3024
233 nmdc:mga06z11_74799_c1 3300050494 Bacteria 1802
234 nmdc:mga07m45_103619_c1 3300050496 Bacteria 1635
235 nmdc:mga09592_240057_c1 3300050508 Bacteria 1570
236 nmdc:mga09592_552_c1 3300050508 Bacteria 28490
237 nmdc:mga0qj67_134057_c1 3300050509 Bacteria 2007
238 nmdc:mga06r32_959_c1 3300050510 Bacteria 25765
239 Ga0495595_0051072 3300053084 Bacteria 1916
240 Ga0495595_0086234 3300053084 Bacteria 1502
241 Ga0495619_0033124 3300053085 Bacteria 3355
242 Ga0500646_0105829 3300053090 Bacteria 889
243 Ga0500651_0138797 3300053093 Bacteria 1466
244 Ga0500566_0031174 3300053094 Bacteria 3109
245 Ga0500641_0066194 3300053096 Bacteria 1513
246 Ga0500650_0050514 3300053098 Bacteria 1931
247 Ga0500569_003191 3300053109 Bacteria 3318
248 Ga0500589_173333 3300053147 Bacteria 855
249 Ga0500616_0004138 3300053153 Bacteria 10496
250 Ga0501082_0056513 3300060353 Bacteria 3381
251 2508674564 2508501039 Bacteria 9978592
252 2552107931 2551306166 Bacteria 9731570
253 2671838373 2671180195 Bacteria 9757215
254 2689958421 2687453737 Bacteria 11203906
255 2774856529 2773857922 Bacteria 9757215
256 2857710755 2857710386 Bacteria 3186771
257 2870788186 2870782633 Bacteria 9624083
258 Ga0439463_034594
259 Ga0070687_100248217
260 Ga0070668_100009537
261 Ga0070668_100051802
262 Ga0070714_100045110
263 Ga0070714_100527528
264 Ga0070713_100408304
265 Ga0070710_10073015
266 Ga0070705_100119183
267 Ga0070708_100002767
268 Ga0070708_100003778
269 Ga0070708_100092592
270 Ga0070685_10053937
271 Ga0070706_100014372
272 Ga0070706_100161234
273 Ga0070707_100005065
274 Ga0070707_100287447
275 Ga0070698_100012772
276 Ga0070698_100026413
277 Ga0070699_100008573
278 Ga0070684_100511165
279 Ga0070697_100157081
280 Ga0070696_100035439
281 Ga0070665_100011436
282 Ga0070704_100286648
283 Ga0068856_100226388
284 Ga0068859_100013416
285 Ga0068864_100072480
286 Ga0068864_100076551
287 Ga0068863_100000568
288 Ga0068863_100000707
289 Ga0068858_100003378
290 Ga0068860_100011962
291 Ga0068860_100105641
292 Ga0068862_100000087
293 Ga0068862_100067229
294 Ga0068862_100086899
295 Ga0070717_10013456
296 Ga0070717_10129762
297 Ga0075365_10041852
298 Ga0075365_10150249
299 Ga0075363_100052963
300 Ga0075363_100107490
301 Ga0075363_100167421
302 Ga0075363_100212711
303 Ga0075364_10125077
304 Ga0075364_10493225
305 Ga0070715_10243280
306 Ga0070716_100006202
307 Ga0070716_100036451
308 Ga0070712_100140652
309 Ga0075362_10023880
310 Ga0075367_10067402
311 Ga0075367_10089230
312 Ga0075367_10137852
313 Ga0075369_10140254
314 Ga0075370_10174809
315 Ga0075428_100052125
316 Ga0075430_100007684
317 Ga0075431_100000393
318 Ga0075431_100178969
319 Ga0075429_100004603
320 Ga0097620_100013416
321 Ga0105247_10122130
322 Ga0105248_10016531
323 Ga0105249_10014927
324 Ga0105249_10058973
325 Ga0163163_10003112
326 Ga0163163_10040562
327 Ga0163163_10183405
328 Ga0163163_10769072
329 Ga0157379_10029933
330 Ga0157379_10086144
331 Ga0213874_10026876
332 Ga0213876_10192076
333 Ga0213875_10018254
334 Ga0213875_10094865
335 Ga0213875_10130461
336 Ga0207653_10024230
337 Ga0207647_10045131
338 Ga0207684_10079142
339 Ga0207684_10129114
340 Ga0207693_10006790
341 Ga0207663_10101431
342 Ga0207646_10015863
343 Ga0207646_10050868
344 Ga0207646_10225055
345 Ga0207700_10145359
346 Ga0207664_10025481
347 Ga0207664_10133598
348 Ga0207665_10000520
349 Ga0207665_10054236
350 Ga0207711_10033475
351 Ga0207712_10060434
352 Ga0207668_10000128
353 Ga0207668_10021856
354 Ga0207703_10009272
355 Ga0207703_10302367
356 Ga0207702_10187494
357 Ga0207702_10344800
358 Ga0207702_10370404
359 Ga0207641_10000590
360 Ga0207641_10001572
361 Ga0207648_10485421
362 Ga0207676_10047214
363 Ga0207676_10121952
364 Ga0207674_10142917
365 Ga0207675_100080006
366 Ga0268266_10008731
367 Ga0268265_10000070
368 Ga0268264_10008444
369 Ga0268264_10150382
370 Ga0307515_10048479
371 Ga0265338_10001597
372 Ga0265338_10065511
373 Ga0307512_10005148
374 Ga0307512_10015378
375 Ga0307513_10018192
376 Ga0307513_10168239
377 Ga0307508_10168143
378 Ga0307516_10010778
379 Ga0307516_10071154
380 Ga0307410_10310102
381 Ga0307409_100033220
382 Ga0307415_100321645
383 Ga0373941_0010843
384 Ga0373924_0048934
385 Ga0373933_0198497
386 Ga0373937_0020850
387 Ga0372808_000128
388 Ga0436364_0029177
389 Ga0436364_0335124
390 Ga0436364_0399188
391 Ga0436364_0589011
392 Ga0436364_1521327
393 Ga0436363_0140356
394 Ga0466966_0132537
395 Ga0466963_0065719
396 Ga0466963_0231214
397 Ga0466959_0190126
398 Ga0466959_0408237
399 Ga0466958_0076816
400 Ga0466967_0079925
401 Ga0466967_0320691
402 Ga0466967_0399365
403 Ga0495638_0216495
404 Ga0495651_0003493
405 Ga0495653_0109985
406 Ga0495650_0016015
407 Ga0495580_0386546
408 Ga0495582_0028916
409 Ga0495664_0132312
410 Ga0495608_0069756
411 Ga0495608_0092961
412 Ga0495618_0087956
413 Ga0495652_0044446
414 Ga0495652_0204546
415 Ga0495652_0227931
416 Ga0495667_0003093
417 Ga0495599_0129421
418 Ga0495623_0073091
419 Ga0495658_0268366
420 Ga0495669_0137257
421 Ga0495624_0076064
422 Ga0495680_0286757
423 Ga0495602_0045927
424 Ga0496100_0011251
425 Ga0496100_0011531
426 Ga0496100_0013685
427 Ga0496101_0011013
428 Ga0496101_0044896
429 Ga0496101_0096303
430 Ga0496102_0000017
431 Ga0496102_0037714
432 Ga0496102_0072221
433 Ga0496103_0000041
434 Ga0496103_0222264
435 Ga0496104_0003005
436 Ga0496104_0482153
437 Ga0496105_0003082
438 Ga0496105_0003946
439 Ga0496105_0247598
440 Ga0496106_0022685
441 Ga0496106_0061702
442 Ga0496107_0008758
443 Ga0496107_0208779
444 Ga0496107_0248478
445 Ga0496108_0000551
446 Ga0496108_0136455
447 Ga0496109_0005274
448 Ga0496109_0018807
449 Ga0496109_0372145
450 Ga0496110_0001359
451 Ga0496110_0025553
452 Ga0496110_0228485
453 Ga0496111_0001966
454 Ga0496111_0093941
455 Ga0496112_0009524
456 Ga0496112_0132855
457 Ga0496113_0005438
458 Ga0496114_0079881
459 Ga0496114_0301244
460 Ga0496116_0000121
461 Ga0496117_0000215
462 Ga0496118_0000057
463 Ga0496119_0006697
464 Ga0496121_0006025
465 Ga0496124_0117483
466 Ga0496125_0013269
467 Ga0496126_0000135
468 Ga0501036_0094645
469 Ga0501036_0710692
470 Ga0501039_0026411
471 Ga0501042_0110251
472 Ga0501046_0269150
473 Ga0501048_0088681
474 Ga0501068_0164434
475 Ga0501069_0000043
476 Ga0501070_0000298
477 Ga0501070_0454793
478 Ga0501071_0075643
479 Ga0501071_0201559
480 Ga0501076_0052105
481 Ga0501077_0022731
482 Ga0501080_0140908
483 nmdc:mga03683_46551_c1
484 nmdc:mga03n38_329147_c1
485 nmdc:mga03n38_36743_c1
486 nmdc:mga0yw44_3159_c1
487 nmdc:mga0yw44_83779_c1
488 nmdc:mga0yw44_89404_c1
489 nmdc:mga06z11_21051_c1
490 nmdc:mga06z11_74799_c1
491 nmdc:mga07m45_103619_c1
492 nmdc:mga09592_240057_c1
493 nmdc:mga09592_552_c1
494 nmdc:mga0qj67_134057_c1
495 nmdc:mga06r32_959_c1
496 Ga0495595_0051072
497 Ga0495595_0086234
498 Ga0495619_0033124
499 Ga0500646_0105829
500 Ga0500651_0138797
501 Ga0500566_0031174
502 Ga0500641_0066194
503 Ga0500650_0050514
504 Ga0500569_003191
505 Ga0500589_173333
506 Ga0500616_0004138
507 Ga0501082_0056513
508 2508674564
509 2552107931
510 2671838373
511 2689958421
512 2774856529
513 2857710755
514 2870788186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

27

220

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

33

266

0.94

PF08659

KR

KR domain

28

201

0.91

PF23441

22

267

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3op4-assembly1.cif.gz_A crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. n16961 in complex with nadp+ 0.9648 22 265
5t2u-assembly1.cif.gz_B short chain dehydrogenase/reductase family protein 0.9632 23 267
4ag3-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with nadph at 1.8a resolution 0.963 21 265
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9619 23 264
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9615 24 267
ID Description Score Start End Superfamily
af_Q9Y6Z9_1_254_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9669 20 265 3.40.50.720
5t2uB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9632 23 267 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9597 24 267 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9592 24 265 3.40.50.720
af_P9WGQ9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9585 24 265 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3D1G9F4-F1-model_v4 3-oxoacyl-ACP reductase 0.9718 25 115 GO:0016491
AF-A0A2N0QKI9-F1-model_v4 NAD(P)-binding protein 0.9705 24 148 GO:0005829
GO:0009688
GO:0010301
AF-A0A0S7XKD8-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase 0.9695 24 267 GO:0016616
GO:0030497
AF-A0A7Z2VFU7-F1-model_v4 SDR family oxidoreductase 0.9693 24 269 GO:0006633
GO:0016616
GO:0048038
AF-A0A522E0N1-F1-model_v4 SDR family oxidoreductase 0.9693 24 267 GO:0016491

Map