F367451

General Info

Members Datasets Scaffolds Average Seq Length
257 153 514 168

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0408668|Ga0373937_0408668_675_1262
Length 195
Sequence LDWCSQLYVSLLQSGSAAIAGHSDFDAQLNHKSKRTMKIAISVSACCLLFAASLFASSLQEQNKAIAKRAFEEILSRGRFELAEELYARDFINHGIHRNASLEEDQAALKGWHQAFPDVVITAEKLIAEGDLVTVYWIARGTNTGAGNGLPATGKKAELAGITIWRIVDNKIKEEWSAFDQLSMMQQLGLLPPNK

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.12
Rhizosphere 89.88
Stem 0
Stem Tuber 0
Unclassified 32.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0408668 3300036401 Bacteria 1288
2 JGI24737J22298_10010834 3300001990 Bacteria 2999
3 JGI25404J52841_10008723 3300003659 Archaea 2165
4 JGI25405J52794_10100255 3300003911 Unclassified 646
5 Ga0065714_10076391 3300005288 Unclassified 2796
6 Ga0065704_10015927 3300005289 Bacteria 2464
7 Ga0065704_10174347 3300005289 Unclassified 1273
8 Ga0065704_10211305 3300005289 Bacteria 1107
9 Ga0065712_10006466 3300005290 Unclassified 3675
10 Ga0065712_10098394 3300005290 Bacteria 2120
11 Ga0065712_10178065 3300005290 Bacteria 1207
12 Ga0065715_10005746 3300005293 Bacteria 3248
13 Ga0065715_10009934 3300005293 Bacteria 5271
14 Ga0065715_10281215 3300005293 Bacteria 1074
15 Ga0065707_10017151 3300005295 Bacteria 2293
16 Ga0065707_10141442 3300005295 Bacteria 1767
17 Ga0065707_10390391 3300005295 Unclassified 865
18 Ga0065707_10402019 3300005295 Bacteria 851
19 Ga0065707_10469499 3300005295 Unclassified 783
20 Ga0070676_10526822 3300005328 Unclassified 843
21 Ga0070683_100125062 3300005329 Bacteria 2431
22 Ga0070690_100429970 3300005330 Bacteria 975
23 Ga0070690_100842976 3300005330 Unclassified 713
24 Ga0068869_100065611 3300005334 Unclassified 2673
25 Ga0070666_10298002 3300005335 Bacteria 1148
26 Ga0068868_100050976 3300005338 Bacteria 3253
27 Ga0070660_100043663 3300005339 Unclassified 3427
28 Ga0070660_100337467 3300005339 Unclassified 1240
29 Ga0070689_100052291 3300005340 Bacteria 3159
30 Ga0070687_100009612 3300005343 Bacteria 4150
31 Ga0070675_100011574 3300005354 Bacteria 6910
32 Ga0070675_100192108 3300005354 Bacteria 1769
33 Ga0070674_100216485 3300005356 Unclassified 1488
34 Ga0070673_100063221 3300005364 Bacteria 2944
35 Ga0070673_101002482 3300005364 Bacteria 778
36 Ga0070688_100005363 3300005365 Bacteria 6743
37 Ga0070688_100057588 3300005365 Bacteria 2443
38 Ga0070659_100005281 3300005366 Bacteria 9270
39 Ga0070659_100497470 3300005366 Unclassified 1039
40 Ga0070709_10596271 3300005434 Bacteria 850
41 Ga0070714_100459204 3300005435 Unclassified 1211
42 Ga0070713_100148911 3300005436 Bacteria 2080
43 Ga0070713_100229264 3300005436 Bacteria 1688
44 Ga0070713_100826672 3300005436 Bacteria 889
45 Ga0070710_10093478 3300005437 Bacteria 1778
46 Ga0070710_10351788 3300005437 Unclassified 975
47 Ga0070701_10320468 3300005438 Unclassified 959
48 Ga0070711_100844985 3300005439 Unclassified 779
49 Ga0070705_100075121 3300005440 Unclassified 2057
50 Ga0070700_100006653 3300005441 Bacteria 6191
51 Ga0070694_100031077 3300005444 Bacteria 3499
52 Ga0070708_100061425 3300005445 Bacteria 3357
53 Ga0070708_100062467 3300005445 Archaea 3331
54 Ga0070708_100167196 3300005445 Bacteria 2052
55 Ga0070708_100237938 3300005445 Bacteria 1709
56 Ga0070708_100284344 3300005445 Bacteria 1557
57 Ga0070663_100021881 3300005455 Bacteria 4262
58 Ga0070678_100067891 3300005456 Unclassified 2656
59 Ga0070662_100068238 3300005457 Bacteria 2614
60 Ga0070662_100125753 3300005457 Bacteria 1970
61 Ga0070662_100446438 3300005457 Bacteria 1073
62 Ga0070685_10027962 3300005466 Unclassified 3122
63 Ga0070685_10089170 3300005466 Unclassified 1864
64 Ga0070706_100081998 3300005467 Bacteria 2988
65 Ga0070706_100084831 3300005467 Archaea 2934
66 Ga0070707_100051946 3300005468 Bacteria 3929
67 Ga0070707_100180741 3300005468 Bacteria 2056
68 Ga0070707_100447498 3300005468 Unclassified 1252
69 Ga0070707_100882139 3300005468 Bacteria 859
70 Ga0070707_101273310 3300005468 Bacteria 702
71 Ga0070698_100059130 3300005471 Archaea 3872
72 Ga0070698_100300116 3300005471 Bacteria 1537
73 Ga0070698_100710228 3300005471 Bacteria 947
74 Ga0070698_100838460 3300005471 Unclassified 864
75 Ga0070684_100002361 3300005535 Bacteria 13918
76 Ga0070684_100070672 3300005535 Bacteria 3072
77 Ga0070697_100133172 3300005536 Bacteria 2085
78 Ga0070697_100239690 3300005536 Bacteria 1548
79 Ga0070697_100259329 3300005536 Bacteria 1488
80 Ga0070695_100121299 3300005545 Bacteria 1789
81 Ga0070695_100421414 3300005545 Bacteria 1016
82 Ga0070696_100420012 3300005546 Bacteria 1050
83 Ga0070696_100649669 3300005546 Bacteria 855
84 Ga0070665_100130690 3300005548 Bacteria 2513
85 Ga0070665_100217192 3300005548 Unclassified 1913
86 Ga0070704_100013020 3300005549 Bacteria 5149
87 Ga0070664_100088453 3300005564 Bacteria 2678
88 Ga0070664_100187027 3300005564 Bacteria 1844
89 Ga0068859_100044611 3300005617 Bacteria 4454
90 Ga0068864_100056642 3300005618 Bacteria 3386
91 Ga0068863_100232260 3300005841 Bacteria 1779
92 Ga0068863_100514972 3300005841 Unclassified 1179
93 Ga0068858_100030360 3300005842 Bacteria 5018
94 Ga0068860_100017567 3300005843 Bacteria 6970
95 Ga0081455_10000171 3300005937 Bacteria 80763
96 Ga0081455_10017429 3300005937 Bacteria 6886
97 Ga0081455_10041902 3300005937 Bacteria 4022
98 Ga0081455_10110654 3300005937 Bacteria 2183
99 Ga0081455_10195125 3300005937 Bacteria 1521
100 Ga0081455_10213474 3300005937 Bacteria 1436
101 Ga0081455_10449936 3300005937 Bacteria 880
102 Ga0081540_1000225 3300005983 Bacteria 59402
103 Ga0081540_1045914 3300005983 Bacteria 2211
104 Ga0081540_1256004 3300005983 Bacteria 609
105 Ga0081539_10017512 3300005985 Bacteria 5025
106 Ga0081539_10066847 3300005985 Unclassified 1946
107 Ga0081539_10162102 3300005985 Bacteria 1065
108 Ga0070717_10034267 3300006028 Bacteria 4104
109 Ga0070717_10056511 3300006028 Bacteria 3242
110 Ga0070717_10114009 3300006028 Bacteria 2308
111 Ga0070717_10363456 3300006028 Unclassified 1296
112 Ga0070716_100025139 3300006173 Bacteria 3175
113 Ga0070716_100237221 3300006173 Unclassified 1235
114 Ga0070712_100105568 3300006175 Bacteria 2092
115 Ga0070712_100245708 3300006175 Unclassified 1427
116 Ga0070712_100780446 3300006175 Unclassified 819
117 Ga0075428_100166016 3300006844 Unclassified 2395
118 Ga0075433_10381518 3300006852 Unclassified 1244
119 Ga0075433_11075165 3300006852 Bacteria 700
120 Ga0075434_100664828 3300006871 Bacteria 1060
121 Ga0097620_100044613 3300006931 Bacteria 4454
122 Ga0099794_10224466 3300007265 Bacteria 966
123 Ga0111539_11089310 3300009094 Unclassified 928
124 Ga0105245_10954683 3300009098 Unclassified 900
125 Ga0105245_10966126 3300009098 Unclassified 895
126 Ga0105247_10664452 3300009101 Bacteria 780
127 Ga0114129_10002187 3300009147 Bacteria 26922
128 Ga0114129_11062702 3300009147 Bacteria 1016
129 Ga0105243_10025239 3300009148 Bacteria 4539
130 Ga0105241_10488791 3300009174 Bacteria 1095
131 Ga0105248_10712755 3300009177 Bacteria 1132
132 Ga0105237_10079682 3300009545 Unclassified 3265
133 Ga0105249_10072348 3300009553 Bacteria 3187
134 Ga0099796_10254849 3300010159 Unclassified 730
135 Ga0105239_10090160 3300010375 Bacteria 3382
136 Ga0105239_10389371 3300010375 Unclassified 1577
137 Ga0105246_10607075 3300011119 Bacteria 946
138 Ga0157327_1013539 3300012512 Unclassified 821
139 Ga0157371_10853726 3300013102 Unclassified 688
140 Ga0157374_10021556 3300013296 Bacteria 5735
141 Ga0157378_10455210 3300013297 Bacteria 1271
142 Ga0163162_10062776 3300013306 Bacteria 3756
143 Ga0157372_11158912 3300013307 Unclassified 894
144 Ga0157375_10208531 3300013308 Unclassified 2111
145 Ga0157375_10322822 3300013308 Bacteria 1708
146 Ga0163163_10284809 3300014325 Unclassified 1704
147 Ga0163163_10829282 3300014325 Unclassified 988
148 Ga0157380_11178065 3300014326 Unclassified 809
149 Ga0157377_10045401 3300014745 Bacteria 2454
150 Ga0157379_10005223 3300014968 Bacteria 11149
151 Ga0157376_10027599 3300014969 Bacteria 4502
152 Ga0207673_1011530 3300025290 Bacteria 1145
153 Ga0207697_10000515 3300025315 Bacteria 21787
154 Ga0207697_10003228 3300025315 Bacteria 8107
155 Ga0207697_10077984 3300025315 Bacteria 1393
156 Ga0207697_10095504 3300025315 Bacteria 1263
157 Ga0207697_10141433 3300025315 Unclassified 1044
158 Ga0207697_10167034 3300025315 Bacteria 961
159 Ga0207653_10006733 3300025885 Bacteria 3591
160 Ga0207647_10008375 3300025904 Bacteria 7418
161 Ga0207699_10295582 3300025906 Unclassified 1130
162 Ga0207684_10205206 3300025910 Bacteria 1700
163 Ga0207684_10300181 3300025910 Unclassified 1385
164 Ga0207684_10322269 3300025910 Unclassified 1332
165 Ga0207654_10573918 3300025911 Unclassified 803
166 Ga0207671_10079208 3300025914 Bacteria 2461
167 Ga0207693_10013003 3300025915 Bacteria 6715
168 Ga0207693_10041132 3300025915 Unclassified 3640
169 Ga0207693_10077932 3300025915 Bacteria 2595
170 Ga0207693_10378479 3300025915 Bacteria 1107
171 Ga0207693_10543218 3300025915 Unclassified 906
172 Ga0207693_10634104 3300025915 Unclassified 831
173 Ga0207663_10180193 3300025916 Bacteria 1508
174 Ga0207662_10033116 3300025918 Bacteria 3010
175 Ga0207662_10038219 3300025918 Unclassified 2812
176 Ga0207657_10073861 3300025919 Bacteria 2881
177 Ga0207646_10252580 3300025922 Archaea 1593
178 Ga0207646_10872476 3300025922 Bacteria 799
179 Ga0207659_10002522 3300025926 Bacteria 10902
180 Ga0207664_10061978 3300025929 Bacteria 2986
181 Ga0207644_10208792 3300025931 Unclassified 1543
182 Ga0207690_10003906 3300025932 Bacteria 8814
183 Ga0207706_10037960 3300025933 Unclassified 4275
184 Ga0207706_10091608 3300025933 Bacteria 2673
185 Ga0207709_10153362 3300025935 Bacteria 1598
186 Ga0207669_10201685 3300025937 Unclassified 1445
187 Ga0207665_10296068 3300025939 Bacteria 1208
188 Ga0207665_10325602 3300025939 Unclassified 1154
189 Ga0207661_10317261 3300025944 Unclassified 1400
190 Ga0207661_10506964 3300025944 Unclassified 1103
191 Ga0207679_10111145 3300025945 Bacteria 2163
192 Ga0207679_10153428 3300025945 Bacteria 1878
193 Ga0207677_10937900 3300026023 Bacteria 782
194 Ga0207678_10004960 3300026067 Bacteria 11944
195 Ga0207708_10008737 3300026075 Bacteria 7495
196 Ga0207641_10437113 3300026088 Bacteria 1262
197 Ga0207676_10091982 3300026095 Bacteria 2493
198 Ga0207675_100023077 3300026118 Bacteria 5786
199 Ga0207683_10029864 3300026121 Unclassified 4720
200 Ga0209974_10044105 3300027876 Unclassified 1487
201 Ga0209974_10074510 3300027876 Unclassified 1161
202 Ga0268266_10071090 3300028379 Bacteria 3016
203 Ga0268266_11465016 3300028379 Unclassified 658
204 Ga0373926_0022879 3300035083 Bacteria 2169
205 Ga0373946_0032184 3300035171 Bacteria 2105
206 Ga0373935_0047097 3300035692 Unclassified 2725
207 Ga0373935_0068729 3300035692 Bacteria 2280
208 Ga0373927_0032138 3300035695 Bacteria 3418
209 Ga0373927_0131712 3300035695 Bacteria 1634
210 Ga0373933_0525635 3300035724 Unclassified 776
211 Ga0373947_0073724 3300035725 Bacteria 2098
212 Ga0373925_0102645 3300037068 Bacteria 2200
213 Ga0395899_0197405 3300037312 Unclassified 1405
214 Ga0395899_0274551 3300037312 Bacteria 1149
215 Ga0395900_0007623 3300037418 Bacteria 11176
216 Ga0395900_0019043 3300037418 Bacteria 6998
217 Ga0395900_0158533 3300037418 Bacteria 2310
218 Ga0395898_0005358 3300037466 Bacteria 13858
219 Ga0395901_0000785 3300038443 Bacteria 35426
220 Ga0395901_0182681 3300038443 Bacteria 2200
221 Ga0439448_0009939 3300042005 Unclassified 2812
222 Ga0451577_0134620 3300042876 Bacteria 2218
223 Ga0466964_0196889 3300044706 Bacteria 965
224 Ga0453684_0030499 3300044712 Bacteria 7616
225 Ga0495580_0176084 3300046472 Bacteria 1478
226 Ga0495684_0301533 3300047471 Bacteria 1151
227 Ga0496100_0459026 3300048903 Bacteria 977
228 Ga0496101_0209897 3300048904 Bacteria 1508
229 Ga0496102_0115197 3300048905 Bacteria 2508
230 Ga0496102_0245296 3300048905 Bacteria 1689
231 Ga0496103_0177819 3300048906 Unclassified 1367
232 Ga0496103_0229486 3300048906 Unclassified 1194
233 Ga0496104_0144814 3300048907 Unclassified 2282
234 Ga0496105_0089027 3300048908 Unclassified 2550
235 Ga0496105_0106378 3300048908 Bacteria 2316
236 Ga0496105_0645716 3300048908 Bacteria 817
237 Ga0496106_0233735 3300048909 Unclassified 1468
238 Ga0496108_0074179 3300048911 Unclassified 2872
239 Ga0496108_0342375 3300048911 Unclassified 1305
240 Ga0496108_0496569 3300048911 Bacteria 1066
241 Ga0496109_0211556 3300048912 Bacteria 1824
242 Ga0496110_0107616 3300048913 Bacteria 2503
243 Ga0496111_0143048 3300048914 Bacteria 1772
244 Ga0496111_0223249 3300048914 Unclassified 1400
245 Ga0496111_0379316 3300048914 Unclassified 1046
246 Ga0496112_0154212 3300048915 Unclassified 2264
247 Ga0496112_0515310 3300048915 Unclassified 1131
248 Ga0496112_0636092 3300048915 Unclassified 997
249 Ga0496113_0589023 3300048916 Unclassified 891
250 Ga0496115_0003158 3300048918 Bacteria 11845
251 Ga0496115_0158702 3300048918 Unclassified 1869
252 Ga0496115_0445383 3300048918 Bacteria 1047
253 nmdc:mga05p37_1380817_c1 3300050507 Bacteria 711
254 nmdc:mga05p37_90749_c1 3300050507 Bacteria 3765
255 nmdc:mga0n895_328823_c1 3300050512 Bacteria 1549
256 nmdc:mga0a205_1069856_c1 3300050515 Unclassified 654
257 nmdc:mga0a205_407888_c1 3300050515 Bacteria 1222
258 Ga0373937_0408668
259 JGI24737J22298_10010834
260 JGI25404J52841_10008723
261 JGI25405J52794_10100255
262 Ga0065714_10076391
263 Ga0065704_10015927
264 Ga0065704_10174347
265 Ga0065704_10211305
266 Ga0065712_10006466
267 Ga0065712_10098394
268 Ga0065712_10178065
269 Ga0065715_10005746
270 Ga0065715_10009934
271 Ga0065715_10281215
272 Ga0065707_10017151
273 Ga0065707_10141442
274 Ga0065707_10390391
275 Ga0065707_10402019
276 Ga0065707_10469499
277 Ga0070676_10526822
278 Ga0070683_100125062
279 Ga0070690_100429970
280 Ga0070690_100842976
281 Ga0068869_100065611
282 Ga0070666_10298002
283 Ga0068868_100050976
284 Ga0070660_100043663
285 Ga0070660_100337467
286 Ga0070689_100052291
287 Ga0070687_100009612
288 Ga0070675_100011574
289 Ga0070675_100192108
290 Ga0070674_100216485
291 Ga0070673_100063221
292 Ga0070673_101002482
293 Ga0070688_100005363
294 Ga0070688_100057588
295 Ga0070659_100005281
296 Ga0070659_100497470
297 Ga0070709_10596271
298 Ga0070714_100459204
299 Ga0070713_100148911
300 Ga0070713_100229264
301 Ga0070713_100826672
302 Ga0070710_10093478
303 Ga0070710_10351788
304 Ga0070701_10320468
305 Ga0070711_100844985
306 Ga0070705_100075121
307 Ga0070700_100006653
308 Ga0070694_100031077
309 Ga0070708_100061425
310 Ga0070708_100062467
311 Ga0070708_100167196
312 Ga0070708_100237938
313 Ga0070708_100284344
314 Ga0070663_100021881
315 Ga0070678_100067891
316 Ga0070662_100068238
317 Ga0070662_100125753
318 Ga0070662_100446438
319 Ga0070685_10027962
320 Ga0070685_10089170
321 Ga0070706_100081998
322 Ga0070706_100084831
323 Ga0070707_100051946
324 Ga0070707_100180741
325 Ga0070707_100447498
326 Ga0070707_100882139
327 Ga0070707_101273310
328 Ga0070698_100059130
329 Ga0070698_100300116
330 Ga0070698_100710228
331 Ga0070698_100838460
332 Ga0070684_100002361
333 Ga0070684_100070672
334 Ga0070697_100133172
335 Ga0070697_100239690
336 Ga0070697_100259329
337 Ga0070695_100121299
338 Ga0070695_100421414
339 Ga0070696_100420012
340 Ga0070696_100649669
341 Ga0070665_100130690
342 Ga0070665_100217192
343 Ga0070704_100013020
344 Ga0070664_100088453
345 Ga0070664_100187027
346 Ga0068859_100044611
347 Ga0068864_100056642
348 Ga0068863_100232260
349 Ga0068863_100514972
350 Ga0068858_100030360
351 Ga0068860_100017567
352 Ga0081455_10000171
353 Ga0081455_10017429
354 Ga0081455_10041902
355 Ga0081455_10110654
356 Ga0081455_10195125
357 Ga0081455_10213474
358 Ga0081455_10449936
359 Ga0081540_1000225
360 Ga0081540_1045914
361 Ga0081540_1256004
362 Ga0081539_10017512
363 Ga0081539_10066847
364 Ga0081539_10162102
365 Ga0070717_10034267
366 Ga0070717_10056511
367 Ga0070717_10114009
368 Ga0070717_10363456
369 Ga0070716_100025139
370 Ga0070716_100237221
371 Ga0070712_100105568
372 Ga0070712_100245708
373 Ga0070712_100780446
374 Ga0075428_100166016
375 Ga0075433_10381518
376 Ga0075433_11075165
377 Ga0075434_100664828
378 Ga0097620_100044613
379 Ga0099794_10224466
380 Ga0111539_11089310
381 Ga0105245_10954683
382 Ga0105245_10966126
383 Ga0105247_10664452
384 Ga0114129_10002187
385 Ga0114129_11062702
386 Ga0105243_10025239
387 Ga0105241_10488791
388 Ga0105248_10712755
389 Ga0105237_10079682
390 Ga0105249_10072348
391 Ga0099796_10254849
392 Ga0105239_10090160
393 Ga0105239_10389371
394 Ga0105246_10607075
395 Ga0157327_1013539
396 Ga0157371_10853726
397 Ga0157374_10021556
398 Ga0157378_10455210
399 Ga0163162_10062776
400 Ga0157372_11158912
401 Ga0157375_10208531
402 Ga0157375_10322822
403 Ga0163163_10284809
404 Ga0163163_10829282
405 Ga0157380_11178065
406 Ga0157377_10045401
407 Ga0157379_10005223
408 Ga0157376_10027599
409 Ga0207673_1011530
410 Ga0207697_10000515
411 Ga0207697_10003228
412 Ga0207697_10077984
413 Ga0207697_10095504
414 Ga0207697_10141433
415 Ga0207697_10167034
416 Ga0207653_10006733
417 Ga0207647_10008375
418 Ga0207699_10295582
419 Ga0207684_10205206
420 Ga0207684_10300181
421 Ga0207684_10322269
422 Ga0207654_10573918
423 Ga0207671_10079208
424 Ga0207693_10013003
425 Ga0207693_10041132
426 Ga0207693_10077932
427 Ga0207693_10378479
428 Ga0207693_10543218
429 Ga0207693_10634104
430 Ga0207663_10180193
431 Ga0207662_10033116
432 Ga0207662_10038219
433 Ga0207657_10073861
434 Ga0207646_10252580
435 Ga0207646_10872476
436 Ga0207659_10002522
437 Ga0207664_10061978
438 Ga0207644_10208792
439 Ga0207690_10003906
440 Ga0207706_10037960
441 Ga0207706_10091608
442 Ga0207709_10153362
443 Ga0207669_10201685
444 Ga0207665_10296068
445 Ga0207665_10325602
446 Ga0207661_10317261
447 Ga0207661_10506964
448 Ga0207679_10111145
449 Ga0207679_10153428
450 Ga0207677_10937900
451 Ga0207678_10004960
452 Ga0207708_10008737
453 Ga0207641_10437113
454 Ga0207676_10091982
455 Ga0207675_100023077
456 Ga0207683_10029864
457 Ga0209974_10044105
458 Ga0209974_10074510
459 Ga0268266_10071090
460 Ga0268266_11465016
461 Ga0373926_0022879
462 Ga0373946_0032184
463 Ga0373935_0047097
464 Ga0373935_0068729
465 Ga0373927_0032138
466 Ga0373927_0131712
467 Ga0373933_0525635
468 Ga0373947_0073724
469 Ga0373925_0102645
470 Ga0395899_0197405
471 Ga0395899_0274551
472 Ga0395900_0007623
473 Ga0395900_0019043
474 Ga0395900_0158533
475 Ga0395898_0005358
476 Ga0395901_0000785
477 Ga0395901_0182681
478 Ga0439448_0009939
479 Ga0451577_0134620
480 Ga0466964_0196889
481 Ga0453684_0030499
482 Ga0495580_0176084
483 Ga0495684_0301533
484 Ga0496100_0459026
485 Ga0496101_0209897
486 Ga0496102_0115197
487 Ga0496102_0245296
488 Ga0496103_0177819
489 Ga0496103_0229486
490 Ga0496104_0144814
491 Ga0496105_0089027
492 Ga0496105_0106378
493 Ga0496105_0645716
494 Ga0496106_0233735
495 Ga0496108_0074179
496 Ga0496108_0342375
497 Ga0496108_0496569
498 Ga0496109_0211556
499 Ga0496110_0107616
500 Ga0496111_0143048
501 Ga0496111_0223249
502 Ga0496111_0379316
503 Ga0496112_0154212
504 Ga0496112_0515310
505 Ga0496112_0636092
506 Ga0496113_0589023
507 Ga0496115_0003158
508 Ga0496115_0158702
509 Ga0496115_0445383
510 nmdc:mga05p37_1380817_c1
511 nmdc:mga05p37_90749_c1
512 nmdc:mga0n895_328823_c1
513 nmdc:mga0a205_1069856_c1
514 nmdc:mga0a205_407888_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07366

SnoaL

SnoaL-like polyketide cyclase

65

188

0.98

PF12680

SnoaL_2

SnoaL-like domain

67

175

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k0z-assembly1.cif.gz_B crystal structure of putative polyketide cyclase (np_977253.1) from bacillus cereus atcc 10987 at 1.91 a resolution 0.8721 26 155
2gex-assembly1.cif.gz_B crystal structure of snoal2 a putative hydroxylase from streptomyces nogalater 0.8587 24 140
2gey-assembly1.cif.gz_B crystal structure of aclr a putative hydroxylase from streptomyces galilaeus 0.8487 24 156
2gey-assembly3.cif.gz_C-2 crystal structure of aclr a putative hydroxylase from streptomyces galilaeus 0.8429 24 160
6hnm-assembly1.cif.gz_A crystal structure of idmh 96-104 loop truncation variant 0.8428 27 153
ID Description Score Start End Superfamily
3k0zB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8689 27 155 3.10.450.50
af_G5EC69_181_473_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8648 82 124 3.90.190.10
2geyC00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.843 24 160 3.10.450.50
af_O06820_1_123_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8354 26 151 3.10.450.50
4lgqD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8246 28 153 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A132TBB2-F1-model_v4 Ester cyclase 0.9006 24 155 GO:0030638
AF-A0A540VK17-F1-model_v4 SnoaL-like domain-containing protein 0.8983 22 161 GO:0016020
GO:0030638
AF-A0A2V6JBV5-F1-model_v4 Ester cyclase 0.8976 31 158 GO:0030638
AF-A0A7V8WS06-F1-model_v4 Ester cyclase 0.895 22 157 GO:0030638
AF-A0A1I1SWQ2-F1-model_v4 Predicted ester cyclase 0.893 25 152 GO:0030638

Map