F367432

General Info

Members Datasets Scaffolds Average Seq Length
257 180 514 149

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100857915|Ga0307415_1008579152
Length 150
Sequence MTDLTNVGDFANIDPAEFAKLVKNTPDAQLAGLMEGEHRTTILDGIFNRMPESFRADKAGNTNATIQWTITGGPKGSDTYEVRIADGKCETGQPTTDAPRLAVTVAPVDFVKVVSGNANPVMMFMSGKLKAKGDLGLAASIQNLFAIPKA

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
59 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
101 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 2501939600 Micromonospora sp. L5 Isolate Unclassified
136 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
137 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
138 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
139 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
140 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
141 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
142 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
143 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
144 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
145 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
146 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
147 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
148 2855683550 Micromonospora sp. RP3T Isolate Unclassified
149 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
150 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
151 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
152 2858868258 Micromonospora sp. MH33 Isolate Unclassified
153 2858882152 Micromonospora noduli MED15 Isolate Nodule
154 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
155 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
156 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
157 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
158 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
159 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
160 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
161 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
162 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
163 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
164 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
165 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
166 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
167 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
168 2902582711 Micromonospora sp. AP08 Isolate Unclassified
169 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
170 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
171 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
172 649633069 Micromonospora sp. L5 Isolate Unclassified
173 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
174 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
175 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
176 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
177 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
178 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
179 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
180 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.21
Metatranscriptomes 3.89
Isolates 17.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 2.33
Rhizoplane 3.11
Rhizosphere 82.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100857915 3300032126 Bacteria 834
2 JGI25406J46586_10025315 3300003203 Bacteria 2305
3 JGI25404J52841_10042830 3300003659 Bacteria 958
4 JGI25404J52841_10071800 3300003659 Bacteria 723
5 Ga0070658_10001441 3300005327 Bacteria 20287
6 Ga0070683_100354574 3300005329 Bacteria 1397
7 Ga0068869_100117517 3300005334 Bacteria 2030
8 Ga0070680_100106388 3300005336 Bacteria 2332
9 Ga0070682_100288243 3300005337 Bacteria 1200
10 Ga0070660_100278567 3300005339 Bacteria 1368
11 Ga0070689_100526147 3300005340 Bacteria 1016
12 Ga0070689_100997051 3300005340 Bacteria 745
13 Ga0070661_100249343 3300005344 Bacteria 1370
14 Ga0070661_100768351 3300005344 Bacteria 789
15 Ga0070669_101437449 3300005353 Bacteria 599
16 Ga0070659_100541533 3300005366 Bacteria 996
17 Ga0070714_100462911 3300005435 Bacteria 1206
18 Ga0070713_100265941 3300005436 Bacteria 1569
19 Ga0070710_10533617 3300005437 Bacteria 808
20 Ga0070681_10188311 3300005458 Bacteria 1983
21 Ga0070681_10440607 3300005458 Bacteria 1215
22 Ga0070679_100356241 3300005530 Bacteria 1411
23 Ga0070679_101621988 3300005530 Bacteria 594
24 Ga0070684_100026966 3300005535 Bacteria 4844
25 Ga0068853_100224185 3300005539 Bacteria 1718
26 Ga0070672_102116915 3300005543 Bacteria 507
27 Ga0070665_100128292 3300005548 Bacteria 2539
28 Ga0068855_100115236 3300005563 Bacteria 3081
29 Ga0070664_100029761 3300005564 Bacteria 4554
30 Ga0070664_100236035 3300005564 Bacteria 1640
31 Ga0068857_100279984 3300005577 Bacteria 1534
32 Ga0068857_101506368 3300005577 Bacteria 655
33 Ga0068856_100125442 3300005614 Bacteria 2570
34 Ga0068859_100027844 3300005617 Bacteria 5668
35 Ga0068864_100084761 3300005618 Bacteria 2785
36 Ga0068864_100210990 3300005618 Bacteria 1788
37 Ga0068863_100033278 3300005841 Bacteria 4910
38 Ga0068863_100264005 3300005841 Bacteria 1665
39 Ga0068863_100705737 3300005841 Bacteria 1003
40 Ga0068862_100120584 3300005844 Bacteria 2311
41 Ga0081540_1070452 3300005983 Bacteria 1619
42 Ga0081539_10000143 3300005985 Bacteria 165345
43 Ga0070716_101155217 3300006173 Bacteria 620
44 Ga0097621_101646269 3300006237 Bacteria 611
45 Ga0075428_100000203 3300006844 Bacteria 56882
46 Ga0075428_100002783 3300006844 Bacteria 19053
47 Ga0075428_100013585 3300006844 Bacteria 9066
48 Ga0075428_100368884 3300006844 Bacteria 1540
49 Ga0075428_100589128 3300006844 Bacteria 1188
50 Ga0075428_100590159 3300006844 Bacteria 1187
51 Ga0075428_100956013 3300006844 Bacteria 908
52 Ga0075430_100000155 3300006846 Bacteria 44657
53 Ga0075430_100004182 3300006846 Bacteria 12179
54 Ga0075430_100017715 3300006846 Bacteria 6063
55 Ga0075431_100033847 3300006847 Bacteria 5265
56 Ga0075431_100096089 3300006847 Bacteria 3059
57 Ga0075431_100150495 3300006847 Bacteria 2396
58 Ga0075431_100238944 3300006847 Bacteria 1848
59 Ga0075431_100332479 3300006847 Bacteria 1530
60 Ga0075431_100443809 3300006847 Bacteria 1294
61 Ga0075431_100464137 3300006847 Bacteria 1261
62 Ga0075431_100777197 3300006847 Bacteria 932
63 Ga0075431_100856385 3300006847 Bacteria 880
64 Ga0075433_10187866 3300006852 Bacteria 1838
65 Ga0075433_10631224 3300006852 Bacteria 940
66 Ga0075429_100001858 3300006880 Bacteria 17483
67 Ga0075429_100004143 3300006880 Bacteria 12407
68 Ga0075429_100027177 3300006880 Bacteria 4967
69 Ga0075429_100316061 3300006880 Bacteria 1367
70 Ga0075429_100629889 3300006880 Bacteria 940
71 Ga0097620_100027844 3300006931 Bacteria 5668
72 Ga0105250_10201793 3300009092 Bacteria 839
73 Ga0111539_10226921 3300009094 Bacteria 2175
74 Ga0105247_10213144 3300009101 Bacteria 1304
75 Ga0114129_10000522 3300009147 Bacteria 46865
76 Ga0114129_10000597 3300009147 Bacteria 44562
77 Ga0114129_10017102 3300009147 Bacteria 10327
78 Ga0114129_10025207 3300009147 Bacteria 8427
79 Ga0114129_10682622 3300009147 Bacteria 1322
80 Ga0114129_10828518 3300009147 Bacteria 1178
81 Ga0105241_11421641 3300009174 Bacteria 665
82 Ga0105237_10555202 3300009545 Bacteria 1155
83 Ga0105239_10114856 3300010375 Bacteria 2986
84 Ga0105246_10168471 3300011119 Bacteria 1675
85 Ga0105246_11932108 3300011119 Bacteria 567
86 Ga0157370_11207601 3300013104 Bacteria 682
87 Ga0157369_10091636 3300013105 Bacteria 3244
88 Ga0157374_11069575 3300013296 Bacteria 827
89 Ga0157372_10093485 3300013307 Bacteria 3422
90 Ga0163163_10161987 3300014325 Bacteria 2282
91 Ga0157377_10763002 3300014745 Bacteria 709
92 Ga0197907_11482871 3300020069 Bacteria 1350
93 Ga0206356_10871774 3300020070 Bacteria 4662
94 Ga0206356_11121887 3300020070 Bacteria 512
95 Ga0206349_1797302 3300020075 Bacteria 947
96 Ga0206355_1238223 3300020076 Bacteria 574
97 Ga0206352_10266037 3300020078 Bacteria 954
98 Ga0206350_10949361 3300020080 Bacteria 1465
99 Ga0206354_11050729 3300020081 Bacteria 3419
100 Ga0206353_11801033 3300020082 Bacteria 4896
101 Ga0224712_10359500 3300022467 Bacteria 689
102 Ga0207643_10383063 3300025908 Bacteria 887
103 Ga0207705_10039769 3300025909 Bacteria 3371
104 Ga0207654_10799916 3300025911 Bacteria 681
105 Ga0207707_10037536 3300025912 Bacteria 4234
106 Ga0207671_11019254 3300025914 Bacteria 652
107 Ga0207660_10381905 3300025917 Bacteria 1132
108 Ga0207662_10659562 3300025918 Bacteria 731
109 Ga0207657_10242267 3300025919 Bacteria 1439
110 Ga0207649_10088347 3300025920 Bacteria 2024
111 Ga0207649_10238270 3300025920 Bacteria 1305
112 Ga0207652_11100664 3300025921 Bacteria 695
113 Ga0207694_10442884 3300025924 Bacteria 1084
114 Ga0207700_10312534 3300025928 Bacteria 1360
115 Ga0207700_11025807 3300025928 Bacteria 738
116 Ga0207689_10127862 3300025942 Bacteria 2090
117 Ga0207661_10001724 3300025944 Bacteria 14963
118 Ga0207661_10015872 3300025944 Bacteria 5548
119 Ga0207661_10363832 3300025944 Bacteria 1307
120 Ga0207679_10024354 3300025945 Bacteria 4149
121 Ga0207679_10419238 3300025945 Bacteria 1181
122 Ga0207703_10197080 3300026035 Bacteria 1787
123 Ga0207678_10211012 3300026067 Bacteria 1661
124 Ga0207702_10168430 3300026078 Bacteria 2006
125 Ga0207702_11697507 3300026078 Bacteria 624
126 Ga0207641_10052488 3300026088 Bacteria 3453
127 Ga0207676_10508192 3300026095 Bacteria 1145
128 Ga0207676_11248129 3300026095 Bacteria 737
129 Ga0207674_10208817 3300026116 Bacteria 1902
130 Ga0207674_10308496 3300026116 Bacteria 1532
131 Ga0268266_10082559 3300028379 Bacteria 2804
132 Ga0268266_11348410 3300028379 Bacteria 689
133 Ga0307513_10022502 3300031456 Bacteria 7404
134 Ga0307408_101234825 3300031548 Bacteria 698
135 Ga0307508_10032473 3300031616 Bacteria 4716
136 Ga0307413_10119163 3300031824 Bacteria 1784
137 Ga0307410_10050358 3300031852 Bacteria 2800
138 Ga0307406_10128088 3300031901 Bacteria 1777
139 Ga0307406_10381870 3300031901 Bacteria 1111
140 Ga0307406_10395893 3300031901 Bacteria 1093
141 Ga0307412_10469178 3300031911 Bacteria 1041
142 Ga0307409_100002584 3300031995 Bacteria 9516
143 Ga0307409_100328934 3300031995 Bacteria 1433
144 Ga0307409_100686342 3300031995 Bacteria 1022
145 Ga0307409_102399210 3300031995 Bacteria 556
146 Ga0307416_100176392 3300032002 Bacteria 1997
147 Ga0307416_101285036 3300032002 Bacteria 838
148 Ga0307411_10224848 3300032005 Bacteria 1459
149 Ga0307411_10407461 3300032005 Bacteria 1126
150 Ga0307415_100000070 3300032126 Bacteria 42627
151 Ga0307415_100112738 3300032126 Bacteria 2021
152 Ga0307415_100669386 3300032126 Bacteria 933
153 Ga0307415_101341306 3300032126 Bacteria 679
154 Ga0307415_101434629 3300032126 Bacteria 658
155 Ga0395899_0029906 3300037312 Bacteria 4099
156 Ga0395900_0097326 3300037418 Bacteria 3023
157 Ga0395905_1128103 3300037471 Bacteria 687
158 Ga0395901_0296286 3300038443 Bacteria 1677
159 Ga0451802_0623892 3300041460 Bacteria 1290
160 Ga0451843_0004400 3300041509 Bacteria 708
161 Ga0466957_0039338 3300044842 Bacteria 2853
162 Ga0466960_0588205 3300044901 Bacteria 660
163 Ga0495629_0071465 3300046459 Bacteria 2422
164 Ga0495594_0003873 3300046499 Bacteria 7693
165 Ga0495594_0132520 3300046499 Bacteria 1412
166 Ga0495606_0006826 3300046507 Bacteria 10420
167 Ga0495668_0001729 3300046616 Bacteria 20118
168 Ga0495625_0005690 3300046660 Bacteria 11289
169 Ga0495658_0700130 3300046683 Bacteria 649
170 Ga0495581_0568060 3300047315 Bacteria 658
171 Ga0495626_0001543 3300048091 Bacteria 18096
172 Ga0496105_1031147 3300048908 Bacteria 614
173 Ga0496108_1252775 3300048911 Bacteria 625
174 Ga0496109_0514140 3300048912 Bacteria 1130
175 Ga0496109_1002842 3300048912 Bacteria 773
176 Ga0496112_0212458 3300048915 Bacteria 1891
177 Ga0496112_0318288 3300048915 Bacteria 1500
178 Ga0496113_0335227 3300048916 Bacteria 1213
179 Ga0501034_0368314 3300049571 Bacteria 1363
180 Ga0501038_0350245 3300049574 Bacteria 1150
181 Ga0501047_0142515 3300049581 Bacteria 2274
182 Ga0501048_0535675 3300049582 Bacteria 840
183 Ga0501068_0163789 3300049584 Bacteria 1402
184 Ga0501074_0228500 3300049590 Bacteria 1325
185 Ga0501075_1418641 3300049591 Bacteria 526
186 Ga0501076_1273829 3300049592 Bacteria 605
187 Ga0501044_0274708 3300049823 Bacteria 1620
188 Ga0501045_1167924 3300049824 Bacteria 562
189 nmdc:mga00v17_412590_c1 3300050491 Bacteria 877
190 nmdc:mga05p37_373546_c1 3300050507 Bacteria 1673
191 nmdc:mga05p37_414444_c1 3300050507 Bacteria 1569
192 nmdc:mga05p37_86_c1 3300050507 Bacteria 81974
193 nmdc:mga05p37_924216_c1 3300050507 Bacteria 937
194 nmdc:mga09592_157269_c1 3300050508 Bacteria 1962
195 nmdc:mga09592_158914_c1 3300050508 Bacteria 1952
196 nmdc:mga09592_211659_c1 3300050508 Bacteria 1680
197 nmdc:mga09592_25_c1 3300050508 Bacteria 44492
198 nmdc:mga0qj67_164_c1 3300050509 Bacteria 44665
199 nmdc:mga0qj67_63155_c1 3300050509 Bacteria 2945
200 nmdc:mga0qj67_925271_c1 3300050509 Bacteria 686
201 nmdc:mga06r32_251073_c1 3300050510 Bacteria 1756
202 nmdc:mga06r32_251948_c1 3300050510 Bacteria 1753
203 nmdc:mga06r32_281_c1 3300050510 Bacteria 42391
204 nmdc:mga06r32_335994_c1 3300050510 Bacteria 1496
205 nmdc:mga06r32_401811_c1 3300050510 Bacteria 1352
206 nmdc:mga06r32_44384_c1 3300050510 Bacteria 4233
207 nmdc:mga06r32_450793_c1 3300050510 Bacteria 1266
208 nmdc:mga06r32_529182_c1 3300050510 Bacteria 1154
209 nmdc:mga08y16_949268_c1 3300050511 Bacteria 843
210 nmdc:mga0n895_587999_c1 3300050512 Bacteria 1116
211 nmdc:mga0a205_517709_c1 3300050515 Bacteria 1049
212 2501943081 2501939600 Bacteria 6907073
213 2515497460 2515154088 Bacteria 5526283
214 2515722195 2515154129 Bacteria 5584369
215 2515756082 2515154137 Bacteria 5711575
216 2516084709 2515154202 Bacteria 5471270
217 2516091460 2515154203 Bacteria 5458536
218 2623585978 2622736626 Bacteria 7181580
219 2676482786 2675903059 Bacteria 8644972
220 2772646781 2772190715 Bacteria 6959372
221 2831940846 2831935698 Bacteria 5963223
222 2832005724 2832004796 Bacteria 6538017
223 2855671834 2855670206 Bacteria 7120389
224 2855676918 2855676851 Bacteria 7063653
225 2855685555 2855683550 Bacteria 7134265
226 2856859858 2856858025 Bacteria 7255264
227 2857289762 2857288857 Bacteria 7189066
228 2858852480 2858848962 Bacteria 6963058
229 2858869593 2858868258 Bacteria 7683772
230 2858887770 2858882152 Bacteria 7230291
231 2858895257 2858888857 Bacteria 7060307
232 2858898748 2858895516 Bacteria 7378898
233 2858904732 2858902515 Bacteria 7086037
234 2866070223 2866065130 Bacteria 6518152
235 2867304516 2867302475 Bacteria 7087181
236 2867319067 2867312974 Bacteria 7058875
237 2867324631 2867319477 Bacteria 7069771
238 2867510197 2867507094 Bacteria 6506033
239 2869049736 2869048445 Bacteria 6875584
240 2869064689 2869061728 Bacteria 7112407
241 2869070976 2869068681 Bacteria 7205615
242 2880494294 2880489317 Bacteria 7096270
243 2880498032 2880495981 Bacteria 7340502
244 2887484565 2887478801 Bacteria 8972725
245 2902587670 2902582711 Bacteria 6187705
246 2929220075 2929219909 Bacteria 6984360
247 2929226594 2929226422 Bacteria 7248583
248 2996226050 2996221748 Bacteria 6799777
249 649810344 649633069 Bacteria 6962533
250 8001789543 8001781756 Bacteria 9586736
251 8003832194 8003830390 Bacteria 6541657
252 8003860003 8003856774 Bacteria 7675274
253 8003870662 8003870546 Bacteria 7396674
254 8054705574 8054704163 Bacteria 7247792
255 8054733446 8054727385 Bacteria 7558670
256 8054737130 8054734606 Bacteria 6947278
257 8055416292 8055412473 Bacteria 6257500
258 Ga0307415_100857915
259 JGI25406J46586_10025315
260 JGI25404J52841_10042830
261 JGI25404J52841_10071800
262 Ga0070658_10001441
263 Ga0070683_100354574
264 Ga0068869_100117517
265 Ga0070680_100106388
266 Ga0070682_100288243
267 Ga0070660_100278567
268 Ga0070689_100526147
269 Ga0070689_100997051
270 Ga0070661_100249343
271 Ga0070661_100768351
272 Ga0070669_101437449
273 Ga0070659_100541533
274 Ga0070714_100462911
275 Ga0070713_100265941
276 Ga0070710_10533617
277 Ga0070681_10188311
278 Ga0070681_10440607
279 Ga0070679_100356241
280 Ga0070679_101621988
281 Ga0070684_100026966
282 Ga0068853_100224185
283 Ga0070672_102116915
284 Ga0070665_100128292
285 Ga0068855_100115236
286 Ga0070664_100029761
287 Ga0070664_100236035
288 Ga0068857_100279984
289 Ga0068857_101506368
290 Ga0068856_100125442
291 Ga0068859_100027844
292 Ga0068864_100084761
293 Ga0068864_100210990
294 Ga0068863_100033278
295 Ga0068863_100264005
296 Ga0068863_100705737
297 Ga0068862_100120584
298 Ga0081540_1070452
299 Ga0081539_10000143
300 Ga0070716_101155217
301 Ga0097621_101646269
302 Ga0075428_100000203
303 Ga0075428_100002783
304 Ga0075428_100013585
305 Ga0075428_100368884
306 Ga0075428_100589128
307 Ga0075428_100590159
308 Ga0075428_100956013
309 Ga0075430_100000155
310 Ga0075430_100004182
311 Ga0075430_100017715
312 Ga0075431_100033847
313 Ga0075431_100096089
314 Ga0075431_100150495
315 Ga0075431_100238944
316 Ga0075431_100332479
317 Ga0075431_100443809
318 Ga0075431_100464137
319 Ga0075431_100777197
320 Ga0075431_100856385
321 Ga0075433_10187866
322 Ga0075433_10631224
323 Ga0075429_100001858
324 Ga0075429_100004143
325 Ga0075429_100027177
326 Ga0075429_100316061
327 Ga0075429_100629889
328 Ga0097620_100027844
329 Ga0105250_10201793
330 Ga0111539_10226921
331 Ga0105247_10213144
332 Ga0114129_10000522
333 Ga0114129_10000597
334 Ga0114129_10017102
335 Ga0114129_10025207
336 Ga0114129_10682622
337 Ga0114129_10828518
338 Ga0105241_11421641
339 Ga0105237_10555202
340 Ga0105239_10114856
341 Ga0105246_10168471
342 Ga0105246_11932108
343 Ga0157370_11207601
344 Ga0157369_10091636
345 Ga0157374_11069575
346 Ga0157372_10093485
347 Ga0163163_10161987
348 Ga0157377_10763002
349 Ga0197907_11482871
350 Ga0206356_10871774
351 Ga0206356_11121887
352 Ga0206349_1797302
353 Ga0206355_1238223
354 Ga0206352_10266037
355 Ga0206350_10949361
356 Ga0206354_11050729
357 Ga0206353_11801033
358 Ga0224712_10359500
359 Ga0207643_10383063
360 Ga0207705_10039769
361 Ga0207654_10799916
362 Ga0207707_10037536
363 Ga0207671_11019254
364 Ga0207660_10381905
365 Ga0207662_10659562
366 Ga0207657_10242267
367 Ga0207649_10088347
368 Ga0207649_10238270
369 Ga0207652_11100664
370 Ga0207694_10442884
371 Ga0207700_10312534
372 Ga0207700_11025807
373 Ga0207689_10127862
374 Ga0207661_10001724
375 Ga0207661_10015872
376 Ga0207661_10363832
377 Ga0207679_10024354
378 Ga0207679_10419238
379 Ga0207703_10197080
380 Ga0207678_10211012
381 Ga0207702_10168430
382 Ga0207702_11697507
383 Ga0207641_10052488
384 Ga0207676_10508192
385 Ga0207676_11248129
386 Ga0207674_10208817
387 Ga0207674_10308496
388 Ga0268266_10082559
389 Ga0268266_11348410
390 Ga0307513_10022502
391 Ga0307408_101234825
392 Ga0307508_10032473
393 Ga0307413_10119163
394 Ga0307410_10050358
395 Ga0307406_10128088
396 Ga0307406_10381870
397 Ga0307406_10395893
398 Ga0307412_10469178
399 Ga0307409_100002584
400 Ga0307409_100328934
401 Ga0307409_100686342
402 Ga0307409_102399210
403 Ga0307416_100176392
404 Ga0307416_101285036
405 Ga0307411_10224848
406 Ga0307411_10407461
407 Ga0307415_100000070
408 Ga0307415_100112738
409 Ga0307415_100669386
410 Ga0307415_101341306
411 Ga0307415_101434629
412 Ga0395899_0029906
413 Ga0395900_0097326
414 Ga0395905_1128103
415 Ga0395901_0296286
416 Ga0451802_0623892
417 Ga0451843_0004400
418 Ga0466957_0039338
419 Ga0466960_0588205
420 Ga0495629_0071465
421 Ga0495594_0003873
422 Ga0495594_0132520
423 Ga0495606_0006826
424 Ga0495668_0001729
425 Ga0495625_0005690
426 Ga0495658_0700130
427 Ga0495581_0568060
428 Ga0495626_0001543
429 Ga0496105_1031147
430 Ga0496108_1252775
431 Ga0496109_0514140
432 Ga0496109_1002842
433 Ga0496112_0212458
434 Ga0496112_0318288
435 Ga0496113_0335227
436 Ga0501034_0368314
437 Ga0501038_0350245
438 Ga0501047_0142515
439 Ga0501048_0535675
440 Ga0501068_0163789
441 Ga0501074_0228500
442 Ga0501075_1418641
443 Ga0501076_1273829
444 Ga0501044_0274708
445 Ga0501045_1167924
446 nmdc:mga00v17_412590_c1
447 nmdc:mga05p37_373546_c1
448 nmdc:mga05p37_414444_c1
449 nmdc:mga05p37_86_c1
450 nmdc:mga05p37_924216_c1
451 nmdc:mga09592_157269_c1
452 nmdc:mga09592_158914_c1
453 nmdc:mga09592_211659_c1
454 nmdc:mga09592_25_c1
455 nmdc:mga0qj67_164_c1
456 nmdc:mga0qj67_63155_c1
457 nmdc:mga0qj67_925271_c1
458 nmdc:mga06r32_251073_c1
459 nmdc:mga06r32_251948_c1
460 nmdc:mga06r32_281_c1
461 nmdc:mga06r32_335994_c1
462 nmdc:mga06r32_401811_c1
463 nmdc:mga06r32_44384_c1
464 nmdc:mga06r32_450793_c1
465 nmdc:mga06r32_529182_c1
466 nmdc:mga08y16_949268_c1
467 nmdc:mga0n895_587999_c1
468 nmdc:mga0a205_517709_c1
469 2501943081
470 2515497460
471 2515722195
472 2515756082
473 2516084709
474 2516091460
475 2623585978
476 2676482786
477 2772646781
478 2831940846
479 2832005724
480 2855671834
481 2855676918
482 2855685555
483 2856859858
484 2857289762
485 2858852480
486 2858869593
487 2858887770
488 2858895257
489 2858898748
490 2858904732
491 2866070223
492 2867304516
493 2867319067
494 2867324631
495 2867510197
496 2869049736
497 2869064689
498 2869070976
499 2880494294
500 2880498032
501 2887484565
502 2902587670
503 2929220075
504 2929226594
505 2996226050
506 649810344
507 8001789543
508 8003832194
509 8003860003
510 8003870662
511 8054705574
512 8054733446
513 8054737130
514 8055416292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02036

SCP2

SCP-2 sterol transfer family

43

146

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yhe-assembly3.cif.gz_C structure determination of the stereoselective inverting sec- alkylsulfatase pisa1 from pseudomonas sp. 0.8009 37 149
2cg2-assembly1.cif.gz_A-2 crystal structure of sdsa1, an alkylsulfatase from pseudomonas aeruginosa, in complex with sulfate 0.7868 45 145
4nur-assembly1.cif.gz_B crystal structure of thermostable alkylsulfatase sdsap from pseudomonas sp. s9 0.7868 42 149
2nbn-assembly1.cif.gz_A solution nmr structure of palmitated scp2l2 from aedes aegypti 0.7647 42 143
4pdx-assembly1.cif.gz_B crystal structure of escherchia coli uncharacterized protein yjcs 0.7499 42 149
ID Description Score Start End Superfamily
af_Q7KPQ9_334_441_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8447 42 144 3.30.1050.10
af_F1Q9K0_294_407_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8241 42 144 3.30.1050.10
af_Q9UBI4_290_397_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8231 42 144 3.30.1050.10
af_Q9VB10_297_412_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8016 42 144 3.30.1050.10
af_Q6YN16_304_418_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.7996 42 144 3.30.1050.10
ID Description Score Start End GO Terms
AF-A0A3N9WKP2-F1-model_v4 Acyl-CoA synthase 0.9699 13 150
AF-A0A2T3VPP5-F1-model_v4 deleted 0.9661 13 150
AF-A0A849DLJ6-F1-model_v4 Acyl-CoA synthase 0.9594 1 150
AF-A0A2W5XXQ8-F1-model_v4 Acyl-CoA synthase 0.9594 12 149
AF-A0A537X9W6-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.9593 11 149

Map