F367357

General Info

Members Datasets Scaffolds Average Seq Length
257 195 514 157

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10680280|Ga0207664_106802801
Length 184
Sequence MNTETPQLVVSRVFDAPRELVYRAFTDPDHLAAWWGPIGNSLPRDEIEFDVRPGGYQRWTEVNASDPGLRVHIHIDLTDVTDGELLEGVMHVSGRLQEGIEPFETRLRVEFHDEADGRTRLEIRQWLPEHLAHPSQEGWRQAVLASSCPAAAPKALAVRSWLTKSRIPYRVYQASLIANRWLES

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
98 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
99 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
174 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
175 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
176 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
177 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
178 2858868258 Micromonospora sp. MH33 Isolate Unclassified
179 2858882152 Micromonospora noduli MED15 Isolate Nodule
180 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
181 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
182 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
183 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
184 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
185 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
186 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
187 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
188 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
189 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
190 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
191 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
192 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
193 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
194 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
195 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.66
Metatranscriptomes 0.39
Isolates 8.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 2.33
Rhizoplane 4.28
Rhizosphere 86.77
Stem 0
Stem Tuber 0
Unclassified 5.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10680280 3300025929 Bacteria 925
2 JGI25406J46586_10019474 3300003203 Bacteria 2765
3 Ga0065707_10157671 3300005295 Bacteria 1593
4 Ga0070683_100055712 3300005329 Bacteria 3670
5 Ga0070683_100421273 3300005329 Bacteria 1274
6 Ga0070670_100407723 3300005331 Bacteria 1201
7 Ga0068869_100109362 3300005334 Bacteria 2101
8 Ga0070680_100084227 3300005336 Bacteria 2626
9 Ga0070680_100321358 3300005336 Bacteria 1314
10 Ga0068868_100035693 3300005338 Bacteria 3844
11 Ga0070660_100049150 3300005339 Bacteria 3241
12 Ga0070660_100491356 3300005339 Bacteria 1021
13 Ga0070689_100423995 3300005340 Bacteria 1128
14 Ga0070687_100587442 3300005343 Bacteria 763
15 Ga0070661_100115939 3300005344 Bacteria 2003
16 Ga0070692_10115161 3300005345 Bacteria 1492
17 Ga0070668_100383035 3300005347 Bacteria 1197
18 Ga0070675_100025553 3300005354 Bacteria 4734
19 Ga0070659_100391930 3300005366 Bacteria 1171
20 Ga0070703_10319668 3300005406 Bacteria 653
21 Ga0070713_101068036 3300005436 Bacteria 780
22 Ga0070700_100018767 3300005441 Bacteria 3981
23 Ga0070708_100099987 3300005445 Bacteria 2654
24 Ga0070663_100015353 3300005455 Bacteria 4941
25 Ga0070678_100909181 3300005456 Bacteria 805
26 Ga0070662_100199848 3300005457 Bacteria 1585
27 Ga0070681_10053689 3300005458 Bacteria 4016
28 Ga0070681_10275865 3300005458 Bacteria 1592
29 Ga0070706_100266828 3300005467 Bacteria 1598
30 Ga0070707_100070593 3300005468 Bacteria 3364
31 Ga0070698_100057756 3300005471 Bacteria 3925
32 Ga0070699_100092892 3300005518 Bacteria 2640
33 Ga0070699_100409409 3300005518 Bacteria 1227
34 Ga0070679_100113797 3300005530 Bacteria 2691
35 Ga0070684_100289537 3300005535 Bacteria 1502
36 Ga0070697_100306516 3300005536 Bacteria 1366
37 Ga0068853_100809928 3300005539 Bacteria 897
38 Ga0070672_100063853 3300005543 Bacteria 2908
39 Ga0070693_100296486 3300005547 Bacteria 1088
40 Ga0070704_101359910 3300005549 Bacteria 651
41 Ga0068855_101059002 3300005563 Bacteria 850
42 Ga0070664_100086603 3300005564 Bacteria 2706
43 Ga0068857_100240128 3300005577 Bacteria 1659
44 Ga0068854_100173128 3300005578 Bacteria 1681
45 Ga0070702_100068572 3300005615 Bacteria 2088
46 Ga0068864_100087307 3300005618 Bacteria 2746
47 Ga0068861_100811313 3300005719 Bacteria 879
48 Ga0068870_10450254 3300005840 Bacteria 848
49 Ga0081455_10118607 3300005937 Bacteria 2089
50 Ga0081455_10377134 3300005937 Bacteria 992
51 Ga0081540_1072637 3300005983 Bacteria 1584
52 Ga0081539_10002690 3300005985 Bacteria 24116
53 Ga0070717_11294435 3300006028 Bacteria 663
54 Ga0097621_100504396 3300006237 Bacteria 1096
55 Ga0075430_101161886 3300006846 Bacteria 635
56 Ga0075431_100198656 3300006847 Bacteria 2052
57 Ga0075431_100887451 3300006847 Bacteria 862
58 Ga0075429_100450706 3300006880 Bacteria 1127
59 Ga0068865_101219567 3300006881 Bacteria 666
60 Ga0075435_100382486 3300007076 Bacteria 1209
61 Ga0099794_10343180 3300007265 Bacteria 776
62 Ga0111539_10021907 3300009094 Bacteria 7855
63 Ga0111539_11022648 3300009094 Bacteria 961
64 Ga0111539_12494242 3300009094 Bacteria 600
65 Ga0105245_10034130 3300009098 Bacteria 4511
66 Ga0105245_10857115 3300009098 Bacteria 949
67 Ga0114129_10106205 3300009147 Bacteria 3879
68 Ga0114129_10153658 3300009147 Bacteria 3149
69 Ga0114129_10959015 3300009147 Bacteria 1080
70 Ga0114129_10993282 3300009147 Bacteria 1057
71 Ga0114129_11084702 3300009147 Bacteria 1003
72 Ga0114129_12628234 3300009147 Bacteria 600
73 Ga0105241_11560159 3300009174 Bacteria 637
74 Ga0105237_11530394 3300009545 Bacteria 674
75 Ga0105238_10644755 3300009551 Bacteria 1069
76 Ga0105249_11464584 3300009553 Bacteria 755
77 Ga0105246_10040292 3300011119 Bacteria 3152
78 Ga0157371_10357053 3300013102 Bacteria 1064
79 Ga0157377_10437531 3300014745 Bacteria 900
80 Ga0207688_10451747 3300025901 Bacteria 801
81 Ga0207643_10651507 3300025908 Bacteria 679
82 Ga0207684_10043466 3300025910 Bacteria 3810
83 Ga0207654_10278605 3300025911 Bacteria 1130
84 Ga0207654_10940536 3300025911 Bacteria 627
85 Ga0207707_10053667 3300025912 Bacteria 3509
86 Ga0207707_10351932 3300025912 Bacteria 1269
87 Ga0207693_10158799 3300025915 Bacteria 1779
88 Ga0207660_10129034 3300025917 Bacteria 1923
89 Ga0207662_10018467 3300025918 Bacteria 3958
90 Ga0207662_10154639 3300025918 Bacteria 1461
91 Ga0207657_10053616 3300025919 Bacteria 3493
92 Ga0207657_10418170 3300025919 Bacteria 1054
93 Ga0207649_10381292 3300025920 Bacteria 1051
94 Ga0207652_10190343 3300025921 Bacteria 1845
95 Ga0207694_11193692 3300025924 Bacteria 644
96 Ga0207659_10253416 3300025926 Bacteria 1429
97 Ga0207687_10194457 3300025927 Bacteria 1581
98 Ga0207687_10908857 3300025927 Bacteria 753
99 Ga0207690_10314794 3300025932 Bacteria 1228
100 Ga0207706_10259481 3300025933 Bacteria 1517
101 Ga0207665_10076342 3300025939 Bacteria 2297
102 Ga0207691_10406935 3300025940 Bacteria 1160
103 Ga0207689_10184516 3300025942 Bacteria 1721
104 Ga0207661_10298743 3300025944 Bacteria 1443
105 Ga0207679_10287130 3300025945 Bacteria 1413
106 Ga0207668_10288523 3300025972 Bacteria 1349
107 Ga0207640_10121750 3300025981 Bacteria 1870
108 Ga0207703_10449461 3300026035 Bacteria 1203
109 Ga0207639_10937515 3300026041 Bacteria 810
110 Ga0207678_10062337 3300026067 Bacteria 3205
111 Ga0207708_10401043 3300026075 Bacteria 1134
112 Ga0207676_10069304 3300026095 Bacteria 2824
113 Ga0207676_10378080 3300026095 Bacteria 1318
114 Ga0207674_10049408 3300026116 Bacteria 4302
115 Ga0207674_10145142 3300026116 Bacteria 2332
116 Ga0207674_10320143 3300026116 Bacteria 1500
117 Ga0207675_100086909 3300026118 Bacteria 2936
118 Ga0209974_10001840 3300027876 Bacteria 7740
119 Ga0207428_10540419 3300027907 Bacteria 843
120 Ga0265354_1011664 3300028016 Unclassified 835
121 Ga0307512_10315924 3300030522 Bacteria 715
122 Ga0265760_10002830 3300031090 Bacteria 5064
123 Ga0307508_10219144 3300031616 Bacteria 1503
124 Ga0307405_10329879 3300031731 Bacteria 1169
125 Ga0307413_10512770 3300031824 Bacteria 965
126 Ga0307407_10013943 3300031903 Bacteria 3918
127 Ga0307412_10141317 3300031911 Bacteria 1764
128 Ga0307409_100178961 3300031995 Bacteria 1875
129 Ga0307416_100051545 3300032002 Bacteria 3288
130 Ga0307415_100093832 3300032126 Bacteria 2180
131 Ga0307415_100363362 3300032126 Bacteria 1223
132 Ga0307415_101010810 3300032126 Bacteria 773
133 Ga0373924_0291121 3300035410 Bacteria 725
134 Ga0373937_0098668 3300036401 Unclassified 2709
135 Ga0395899_0386353 3300037312 Bacteria 929
136 Ga0395900_0051252 3300037418 Bacteria 4252
137 Ga0395900_0114524 3300037418 Bacteria 2767
138 Ga0395898_0249957 3300037466 Bacteria 1691
139 Ga0395898_0402856 3300037466 Bacteria 1304
140 Ga0395898_0417163 3300037466 Bacteria 1279
141 Ga0395898_0833769 3300037466 Bacteria 862
142 Ga0395898_1249213 3300037466 Bacteria 673
143 Ga0395905_0168225 3300037471 Bacteria 2060
144 Ga0395905_0307578 3300037471 Bacteria 1473
145 Ga0395905_0356983 3300037471 Bacteria 1354
146 Ga0395901_0058456 3300038443 Bacteria 4010
147 Ga0395901_0229908 3300038443 Bacteria 1936
148 Ga0439450_116192 3300042008 Bacteria 687
149 Ga0451577_0239739 3300042876 Bacteria 1641
150 Ga0439440_0262095 3300042993 Bacteria 529
151 Ga0453683_0162288 3300044673 Bacteria 1414
152 Ga0453683_0591452 3300044673 Bacteria 723
153 Ga0451576_0017634 3300045051 Bacteria 7846
154 Ga0451576_0398729 3300045051 Bacteria 1442
155 Ga0495592_0599194 3300046454 Bacteria 672
156 Ga0495629_0768101 3300046459 Unclassified 637
157 Ga0495641_0512046 3300046461 Bacteria 547
158 Ga0495651_0056568 3300046462 Unclassified 3012
159 Ga0495651_0247372 3300046462 Bacteria 1220
160 Ga0495653_0058555 3300046463 Bacteria 2928
161 Ga0495653_0266488 3300046463 Bacteria 1130
162 Ga0495664_0147528 3300046477 Bacteria 1427
163 Ga0495584_0241360 3300046491 Bacteria 919
164 Ga0495618_0596779 3300046514 Bacteria 657
165 Ga0495628_0746015 3300046516 Unclassified 688
166 Ga0495630_0063007 3300046517 Bacteria 2786
167 Ga0495652_0019331 3300046529 Bacteria 6068
168 Ga0495652_0230130 3300046529 Bacteria 1387
169 Ga0495652_0301955 3300046529 Bacteria 1163
170 Ga0495640_0059993 3300046533 Bacteria 2589
171 Ga0495587_0112806 3300046536 Bacteria 1560
172 Ga0495667_0017083 3300046559 Bacteria 4900
173 Ga0495667_0455699 3300046559 Unclassified 803
174 Ga0495667_0574790 3300046559 Bacteria 703
175 Ga0495634_0039971 3300046642 Bacteria 3192
176 Ga0495634_0174193 3300046642 Bacteria 1351
177 Ga0495657_0028648 3300046675 Bacteria 3914
178 Ga0495599_0042236 3300046678 Bacteria 2861
179 Ga0495623_0054470 3300046679 Bacteria 2523
180 Ga0495658_0083726 3300046683 Bacteria 1877
181 Ga0495624_0286766 3300046690 Bacteria 994
182 Ga0495600_0059899 3300046809 Unclassified 2486
183 Ga0495600_0617235 3300046809 Unclassified 658
184 Ga0495604_0056909 3300047317 Bacteria 3007
185 Ga0495674_0594298 3300047319 Bacteria 877
186 Ga0495680_0089847 3300047322 Bacteria 2305
187 Ga0495680_0175065 3300047322 Bacteria 1552
188 Ga0495675_0073744 3300047444 Bacteria 2152
189 Ga0495675_0498764 3300047444 Unclassified 699
190 Ga0495684_0064343 3300047471 Bacteria 2787
191 Ga0495684_0212030 3300047471 Bacteria 1424
192 Ga0495684_0304884 3300047471 Bacteria 1143
193 Ga0495602_0046311 3300048088 Bacteria 3929
194 Ga0496103_0072303 3300048906 Bacteria 2160
195 Ga0496105_0505066 3300048908 Unclassified 949
196 Ga0496105_0555012 3300048908 Bacteria 896
197 Ga0496105_0731253 3300048908 Unclassified 757
198 Ga0496112_0021950 3300048915 Bacteria 6075
199 Ga0496112_0062785 3300048915 Bacteria 3665
200 Ga0496112_0084623 3300048915 Bacteria 3137
201 Ga0496113_0274862 3300048916 Unclassified 1347
202 Ga0496114_1096396 3300048917 Bacteria 681
203 Ga0496114_1291726 3300048917 Unclassified 616
204 Ga0496115_0128553 3300048918 Unclassified 2087
205 Ga0501034_0207190 3300049571 Bacteria 1917
206 Ga0501036_0117339 3300049572 Bacteria 2248
207 Ga0501039_0495584 3300049575 Bacteria 959
208 Ga0501040_0546317 3300049576 Bacteria 836
209 Ga0501067_0481550 3300049583 Bacteria 694
210 Ga0501071_0144101 3300049587 Bacteria 1775
211 Ga0501072_0219623 3300049588 Bacteria 1515
212 Ga0501075_0439048 3300049591 Bacteria 995
213 Ga0501076_0167482 3300049592 Bacteria 1791
214 Ga0501225_0175243 3300049705 Bacteria 667
215 nmdc:mga05p37_2067881_c1 3300050507 Unclassified 535
216 nmdc:mga05p37_24172_c1 3300050507 Bacteria 7382
217 nmdc:mga05p37_327904_c2 3300050507 Bacteria 969
218 nmdc:mga05p37_343057_c1 3300050507 Bacteria 1761
219 nmdc:mga05p37_817134_c1 3300050507 Bacteria 1017
220 nmdc:mga09592_813083_c1 3300050508 Bacteria 790
221 nmdc:mga0qj67_334001_c1 3300050509 Bacteria 1226
222 nmdc:mga08y16_47395_c1 3300050511 Bacteria 4498
223 nmdc:mga08y16_937531_c1 3300050511 Bacteria 850
224 nmdc:mga0n895_1120718_c1 3300050512 Bacteria 763
225 nmdc:mga0a205_659307_c1 3300050515 Bacteria 897
226 Ga0495601_0001693 3300053077 Bacteria 12180
227 Ga0495601_0012468 3300053077 Bacteria 5099
228 Ga0495601_0303487 3300053077 Bacteria 1040
229 Ga0495595_0024731 3300053084 Bacteria 2654
230 Ga0495595_0036651 3300053084 Bacteria 2226
231 Ga0495595_0103399 3300053084 Bacteria 1376
232 Ga0495619_0050026 3300053085 Bacteria 2757
233 Ga0495619_0073029 3300053085 Bacteria 2298
234 Ga0501084_0552316 3300054114 Bacteria 973
235 2832010016 2832004796 Bacteria 6538017
236 2855670451 2855670206 Bacteria 7120389
237 2855682629 2855676851 Bacteria 7063653
238 2857293339 2857288857 Bacteria 7189066
239 2858849194 2858848962 Bacteria 6963058
240 2858874648 2858868258 Bacteria 7683772
241 2858884283 2858882152 Bacteria 7230291
242 2858892351 2858888857 Bacteria 7060307
243 2858895963 2858895516 Bacteria 7378898
244 2858908449 2858902515 Bacteria 7086037
245 2866067229 2866065130 Bacteria 6518152
246 2868091198 2868088558 Bacteria 7609351
247 2869053427 2869048445 Bacteria 6875584
248 2869062134 2869061728 Bacteria 7112407
249 2869071658 2869068681 Bacteria 7205615
250 2880491235 2880489317 Bacteria 7096270
251 2880501243 2880495981 Bacteria 7340502
252 2929229741 2929226422 Bacteria 7248583
253 8003835410 8003830390 Bacteria 6541657
254 8054704726 8054704163 Bacteria 7247792
255 8054729382 8054727385 Bacteria 7558670
256 8054737512 8054734606 Bacteria 6947278
257 8055412784 8055412473 Bacteria 6257500
258 Ga0207664_10680280
259 JGI25406J46586_10019474
260 Ga0065707_10157671
261 Ga0070683_100055712
262 Ga0070683_100421273
263 Ga0070670_100407723
264 Ga0068869_100109362
265 Ga0070680_100084227
266 Ga0070680_100321358
267 Ga0068868_100035693
268 Ga0070660_100049150
269 Ga0070660_100491356
270 Ga0070689_100423995
271 Ga0070687_100587442
272 Ga0070661_100115939
273 Ga0070692_10115161
274 Ga0070668_100383035
275 Ga0070675_100025553
276 Ga0070659_100391930
277 Ga0070703_10319668
278 Ga0070713_101068036
279 Ga0070700_100018767
280 Ga0070708_100099987
281 Ga0070663_100015353
282 Ga0070678_100909181
283 Ga0070662_100199848
284 Ga0070681_10053689
285 Ga0070681_10275865
286 Ga0070706_100266828
287 Ga0070707_100070593
288 Ga0070698_100057756
289 Ga0070699_100092892
290 Ga0070699_100409409
291 Ga0070679_100113797
292 Ga0070684_100289537
293 Ga0070697_100306516
294 Ga0068853_100809928
295 Ga0070672_100063853
296 Ga0070693_100296486
297 Ga0070704_101359910
298 Ga0068855_101059002
299 Ga0070664_100086603
300 Ga0068857_100240128
301 Ga0068854_100173128
302 Ga0070702_100068572
303 Ga0068864_100087307
304 Ga0068861_100811313
305 Ga0068870_10450254
306 Ga0081455_10118607
307 Ga0081455_10377134
308 Ga0081540_1072637
309 Ga0081539_10002690
310 Ga0070717_11294435
311 Ga0097621_100504396
312 Ga0075430_101161886
313 Ga0075431_100198656
314 Ga0075431_100887451
315 Ga0075429_100450706
316 Ga0068865_101219567
317 Ga0075435_100382486
318 Ga0099794_10343180
319 Ga0111539_10021907
320 Ga0111539_11022648
321 Ga0111539_12494242
322 Ga0105245_10034130
323 Ga0105245_10857115
324 Ga0114129_10106205
325 Ga0114129_10153658
326 Ga0114129_10959015
327 Ga0114129_10993282
328 Ga0114129_11084702
329 Ga0114129_12628234
330 Ga0105241_11560159
331 Ga0105237_11530394
332 Ga0105238_10644755
333 Ga0105249_11464584
334 Ga0105246_10040292
335 Ga0157371_10357053
336 Ga0157377_10437531
337 Ga0207688_10451747
338 Ga0207643_10651507
339 Ga0207684_10043466
340 Ga0207654_10278605
341 Ga0207654_10940536
342 Ga0207707_10053667
343 Ga0207707_10351932
344 Ga0207693_10158799
345 Ga0207660_10129034
346 Ga0207662_10018467
347 Ga0207662_10154639
348 Ga0207657_10053616
349 Ga0207657_10418170
350 Ga0207649_10381292
351 Ga0207652_10190343
352 Ga0207694_11193692
353 Ga0207659_10253416
354 Ga0207687_10194457
355 Ga0207687_10908857
356 Ga0207690_10314794
357 Ga0207706_10259481
358 Ga0207665_10076342
359 Ga0207691_10406935
360 Ga0207689_10184516
361 Ga0207661_10298743
362 Ga0207679_10287130
363 Ga0207668_10288523
364 Ga0207640_10121750
365 Ga0207703_10449461
366 Ga0207639_10937515
367 Ga0207678_10062337
368 Ga0207708_10401043
369 Ga0207676_10069304
370 Ga0207676_10378080
371 Ga0207674_10049408
372 Ga0207674_10145142
373 Ga0207674_10320143
374 Ga0207675_100086909
375 Ga0209974_10001840
376 Ga0207428_10540419
377 Ga0265354_1011664
378 Ga0307512_10315924
379 Ga0265760_10002830
380 Ga0307508_10219144
381 Ga0307405_10329879
382 Ga0307413_10512770
383 Ga0307407_10013943
384 Ga0307412_10141317
385 Ga0307409_100178961
386 Ga0307416_100051545
387 Ga0307415_100093832
388 Ga0307415_100363362
389 Ga0307415_101010810
390 Ga0373924_0291121
391 Ga0373937_0098668
392 Ga0395899_0386353
393 Ga0395900_0051252
394 Ga0395900_0114524
395 Ga0395898_0249957
396 Ga0395898_0402856
397 Ga0395898_0417163
398 Ga0395898_0833769
399 Ga0395898_1249213
400 Ga0395905_0168225
401 Ga0395905_0307578
402 Ga0395905_0356983
403 Ga0395901_0058456
404 Ga0395901_0229908
405 Ga0439450_116192
406 Ga0451577_0239739
407 Ga0439440_0262095
408 Ga0453683_0162288
409 Ga0453683_0591452
410 Ga0451576_0017634
411 Ga0451576_0398729
412 Ga0495592_0599194
413 Ga0495629_0768101
414 Ga0495641_0512046
415 Ga0495651_0056568
416 Ga0495651_0247372
417 Ga0495653_0058555
418 Ga0495653_0266488
419 Ga0495664_0147528
420 Ga0495584_0241360
421 Ga0495618_0596779
422 Ga0495628_0746015
423 Ga0495630_0063007
424 Ga0495652_0019331
425 Ga0495652_0230130
426 Ga0495652_0301955
427 Ga0495640_0059993
428 Ga0495587_0112806
429 Ga0495667_0017083
430 Ga0495667_0455699
431 Ga0495667_0574790
432 Ga0495634_0039971
433 Ga0495634_0174193
434 Ga0495657_0028648
435 Ga0495599_0042236
436 Ga0495623_0054470
437 Ga0495658_0083726
438 Ga0495624_0286766
439 Ga0495600_0059899
440 Ga0495600_0617235
441 Ga0495604_0056909
442 Ga0495674_0594298
443 Ga0495680_0089847
444 Ga0495680_0175065
445 Ga0495675_0073744
446 Ga0495675_0498764
447 Ga0495684_0064343
448 Ga0495684_0212030
449 Ga0495684_0304884
450 Ga0495602_0046311
451 Ga0496103_0072303
452 Ga0496105_0505066
453 Ga0496105_0555012
454 Ga0496105_0731253
455 Ga0496112_0021950
456 Ga0496112_0062785
457 Ga0496112_0084623
458 Ga0496113_0274862
459 Ga0496114_1096396
460 Ga0496114_1291726
461 Ga0496115_0128553
462 Ga0501034_0207190
463 Ga0501036_0117339
464 Ga0501039_0495584
465 Ga0501040_0546317
466 Ga0501067_0481550
467 Ga0501071_0144101
468 Ga0501072_0219623
469 Ga0501075_0439048
470 Ga0501076_0167482
471 Ga0501225_0175243
472 nmdc:mga05p37_2067881_c1
473 nmdc:mga05p37_24172_c1
474 nmdc:mga05p37_327904_c2
475 nmdc:mga05p37_343057_c1
476 nmdc:mga05p37_817134_c1
477 nmdc:mga09592_813083_c1
478 nmdc:mga0qj67_334001_c1
479 nmdc:mga08y16_47395_c1
480 nmdc:mga08y16_937531_c1
481 nmdc:mga0n895_1120718_c1
482 nmdc:mga0a205_659307_c1
483 Ga0495601_0001693
484 Ga0495601_0012468
485 Ga0495601_0303487
486 Ga0495595_0024731
487 Ga0495595_0036651
488 Ga0495595_0103399
489 Ga0495619_0050026
490 Ga0495619_0073029
491 Ga0501084_0552316
492 2832010016
493 2855670451
494 2855682629
495 2857293339
496 2858849194
497 2858874648
498 2858884283
499 2858892351
500 2858895963
501 2858908449
502 2866067229
503 2868091198
504 2869053427
505 2869062134
506 2869071658
507 2880491235
508 2880501243
509 2929229741
510 8003835410
511 8054704726
512 8054729382
513 8054737512
514 8055412784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

15

146

0.83

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

5

147

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lcg-assembly1.cif.gz_A solution nmr structure of protein rmet_5065 from ralstonia metallidurans, northeast structural genomics consortium target crr115 0.8969 8 152
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8906 8 150
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8802 8 150
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8597 8 150
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8493 8 151
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8809 8 150 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8613 8 151 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8392 8 150 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.833 9 153 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8281 9 150 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A246RK02-F1-model_v4 ATPase 1.001 1 158
AF-A0A246RK02-F1-model_v4 ATPase 0.9881 1 158
AF-A0A1A0IJV8-F1-model_v4 ATPase 0.983 1 152
AF-A0A7Y5ZEN4-F1-model_v4 SRPBCC domain-containing protein 0.9649 4 154
AF-H5U2M7-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9543 1 108

Map