F367055

General Info

Members Datasets Scaffolds Average Seq Length
257 170 514 269

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100223637|Ga0068868_1002236372
Length 294
Sequence MLGSISNRHLFWPRSLTDALRMLRDEGPLVPMAGCTDLYVALNFGTLKDTRFLNLWPLDALRRIETRGDLLSIGALATYTDIRRSPLVQKRLPMLVAAASEIGGVQIQNRGTLGGNVANGSPAGDTLPVLAAADAVVVLRSAVATRRVPFGEYYTGYRSSVIRPDELIAAFEFRKLDGRQWFRKVGTRAAQAISKVVMAGVAGDPPRIAIGSVAPTVIRLPSTEAALGRGASSDEAAQILVKEIAPIDDVRSTAEYRRRVAANLLARFWNDSQKRSHPFFADQGRKRGTTPFAR

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.11
Rhizosphere 96.89
Stem 0
Stem Tuber 0
Unclassified 4.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100223637 3300005338 Bacteria 1577
2 CNBas_1001460 3300000531 Bacteria 1246
3 Ga0070676_10121838 3300005328 Bacteria 1638
4 Ga0070690_100116180 3300005330 Bacteria 1791
5 Ga0070670_100007580 3300005331 Bacteria 9213
6 Ga0068868_100036984 3300005338 Bacteria 3782
7 Ga0068868_100177025 3300005338 Bacteria 1768
8 Ga0070689_100008774 3300005340 Bacteria 7135
9 Ga0070689_100009882 3300005340 Bacteria 6785
10 Ga0070687_100010230 3300005343 Bacteria 4047
11 Ga0070661_100015812 3300005344 Bacteria 5326
12 Ga0070692_10011267 3300005345 Bacteria 4100
13 Ga0070668_100019827 3300005347 Bacteria 5066
14 Ga0070669_100013423 3300005353 Bacteria 5825
15 Ga0070675_100026092 3300005354 Bacteria 4687
16 Ga0070673_100040549 3300005364 Bacteria 3573
17 Ga0070688_100006782 3300005365 Bacteria 6140
18 Ga0070659_100287552 3300005366 Bacteria 1368
19 Ga0070667_100162543 3300005367 Unclassified 1967
20 Ga0070713_100158808 3300005436 Unclassified 2017
21 Ga0070701_10013768 3300005438 Bacteria 3689
22 Ga0070701_10014774 3300005438 Bacteria 3588
23 Ga0070701_10026754 3300005438 Unclassified 2817
24 Ga0070701_10312863 3300005438 Bacteria 969
25 Ga0070694_100126408 3300005444 Bacteria 1841
26 Ga0070708_100017270 3300005445 Bacteria 6013
27 Ga0070708_100154427 3300005445 Unclassified 2136
28 Ga0070708_100398575 3300005445 Bacteria 1298
29 Ga0070662_100011999 3300005457 Bacteria 5733
30 Ga0070662_100046100 3300005457 Bacteria 3132
31 Ga0068867_100190869 3300005459 Bacteria 1635
32 Ga0068867_100220667 3300005459 Bacteria 1528
33 Ga0070685_10104232 3300005466 Bacteria 1736
34 Ga0070706_100010431 3300005467 Bacteria 8625
35 Ga0070706_100023452 3300005467 Bacteria 5682
36 Ga0070706_100139415 3300005467 Bacteria 2263
37 Ga0070707_100002705 3300005468 Bacteria 16857
38 Ga0070707_100060842 3300005468 Bacteria 3622
39 Ga0070698_100000837 3300005471 Bacteria 33661
40 Ga0070698_100163679 3300005471 Bacteria 2168
41 Ga0070698_100423397 3300005471 Bacteria 1266
42 Ga0070699_100059378 3300005518 Bacteria 3313
43 Ga0070699_100182182 3300005518 Bacteria 1864
44 Ga0070684_100027488 3300005535 Bacteria 4803
45 Ga0070684_100089342 3300005535 Bacteria 2738
46 Ga0070697_100002771 3300005536 Bacteria 13494
47 Ga0068853_100065305 3300005539 Bacteria 3158
48 Ga0070672_100024273 3300005543 Bacteria 4478
49 Ga0070672_100120230 3300005543 Bacteria 2149
50 Ga0070686_100171189 3300005544 Bacteria 1536
51 Ga0070695_100031181 3300005545 Bacteria 3323
52 Ga0070696_100000474 3300005546 Bacteria 25182
53 Ga0070665_100000588 3300005548 Bacteria 50690
54 Ga0070665_100375490 3300005548 Bacteria 1429
55 Ga0070704_100103959 3300005549 Bacteria 2147
56 Ga0070664_100127899 3300005564 Bacteria 2230
57 Ga0068857_100050114 3300005577 Bacteria 3704
58 Ga0068854_100163298 3300005578 Bacteria 1727
59 Ga0068864_100021798 3300005618 Bacteria 5368
60 Ga0068861_100019729 3300005719 Bacteria 4817
61 Ga0068861_100037665 3300005719 Bacteria 3596
62 Ga0068870_10001099 3300005840 Bacteria 10755
63 Ga0068863_100466384 3300005841 Bacteria 1241
64 Ga0068863_100574095 3300005841 Bacteria 1115
65 Ga0068858_100067256 3300005842 Bacteria 3318
66 Ga0068860_100070160 3300005843 Bacteria 3331
67 Ga0068862_100004676 3300005844 Bacteria 11527
68 Ga0097621_100004564 3300006237 Bacteria 9665
69 Ga0097621_100077837 3300006237 Bacteria 2754
70 Ga0068871_100093332 3300006358 Bacteria 2511
71 Ga0068871_100264218 3300006358 Bacteria 1502
72 Ga0075428_100231259 3300006844 Bacteria 1995
73 Ga0075430_100040805 3300006846 Bacteria 3928
74 Ga0075431_100072811 3300006847 Bacteria 3545
75 Ga0075431_100075710 3300006847 Bacteria 3473
76 Ga0075431_100208843 3300006847 Unclassified 1995
77 Ga0075433_10272918 3300006852 Bacteria 1499
78 Ga0075433_10616074 3300006852 Bacteria 952
79 Ga0075434_100009642 3300006871 Bacteria 9020
80 Ga0075434_100022271 3300006871 Bacteria 6171
81 Ga0068865_100004153 3300006881 Bacteria 8710
82 Ga0068865_100015353 3300006881 Bacteria 4883
83 Ga0075435_100024064 3300007076 Bacteria 4720
84 Ga0105240_10005973 3300009093 Bacteria 18011
85 Ga0111539_10254589 3300009094 Bacteria 2044
86 Ga0105245_10023706 3300009098 Bacteria 5387
87 Ga0114129_10070303 3300009147 Bacteria 4881
88 Ga0114129_10464261 3300009147 Bacteria 1659
89 Ga0114129_10525949 3300009147 Bacteria 1541
90 Ga0114129_10604738 3300009147 Bacteria 1420
91 Ga0105242_10000795 3300009176 Bacteria 24463
92 Ga0105249_10000293 3300009553 Bacteria 51433
93 Ga0105249_10001680 3300009553 Bacteria 19407
94 Ga0105249_10204865 3300009553 Bacteria 1932
95 Ga0105239_10038646 3300010375 Bacteria 5230
96 Ga0157371_10027120 3300013102 Unclassified 4157
97 Ga0157374_10002043 3300013296 Bacteria 16962
98 Ga0157374_10026275 3300013296 Bacteria 5238
99 Ga0157378_10074416 3300013297 Bacteria 3056
100 Ga0163162_10001103 3300013306 Bacteria 25047
101 Ga0163162_10031940 3300013306 Bacteria 5226
102 Ga0157372_10389742 3300013307 Bacteria 1623
103 Ga0157375_10049213 3300013308 Bacteria 4128
104 Ga0157375_10350615 3300013308 Bacteria 1642
105 Ga0163163_10069977 3300014325 Bacteria 3494
106 Ga0157380_10032245 3300014326 Bacteria 4029
107 Ga0157380_10091746 3300014326 Bacteria 2508
108 Ga0157380_10126641 3300014326 Bacteria 2172
109 Ga0157380_10462373 3300014326 Bacteria 1222
110 Ga0157379_10007727 3300014968 Bacteria 9309
111 Ga0157376_10151174 3300014969 Bacteria 2094
112 Ga0207656_10005736 3300025321 Bacteria 4414
113 Ga0207645_10006603 3300025907 Bacteria 8294
114 Ga0207645_10009141 3300025907 Bacteria 6872
115 Ga0207643_10004504 3300025908 Bacteria 7490
116 Ga0207684_10014492 3300025910 Bacteria 6796
117 Ga0207684_10031129 3300025910 Bacteria 4541
118 Ga0207684_10226861 3300025910 Bacteria 1612
119 Ga0207695_10043306 3300025913 Bacteria 4799
120 Ga0207662_10008124 3300025918 Bacteria 5735
121 Ga0207662_10132353 3300025918 Bacteria 1574
122 Ga0207657_10035885 3300025919 Bacteria 4441
123 Ga0207646_10062061 3300025922 Bacteria 3336
124 Ga0207646_10233697 3300025922 Bacteria 1661
125 Ga0207646_10322404 3300025922 Bacteria 1396
126 Ga0207646_10429717 3300025922 Bacteria 1192
127 Ga0207650_10035019 3300025925 Bacteria 3643
128 Ga0207659_10147013 3300025926 Bacteria 1836
129 Ga0207687_10005749 3300025927 Bacteria 8206
130 Ga0207687_10142077 3300025927 Bacteria 1822
131 Ga0207644_10107069 3300025931 Bacteria 2109
132 Ga0207690_10098660 3300025932 Bacteria 2081
133 Ga0207706_10000450 3300025933 Bacteria 43972
134 Ga0207706_10029382 3300025933 Bacteria 4907
135 Ga0207686_10017558 3300025934 Bacteria 4035
136 Ga0207670_10006233 3300025936 Bacteria 6603
137 Ga0207669_10181551 3300025937 Bacteria 1509
138 Ga0207704_10114893 3300025938 Unclassified 1828
139 Ga0207691_10000588 3300025940 Bacteria 36277
140 Ga0207691_10033808 3300025940 Bacteria 4760
141 Ga0207711_10291011 3300025941 Bacteria 1505
142 Ga0207661_10309515 3300025944 Bacteria 1418
143 Ga0207667_10156353 3300025949 Bacteria 2346
144 Ga0207712_10005875 3300025961 Bacteria 7736
145 Ga0207712_10007037 3300025961 Bacteria 7097
146 Ga0207712_10169494 3300025961 Bacteria 1705
147 Ga0207712_10310503 3300025961 Bacteria 1297
148 Ga0207668_10335431 3300025972 Bacteria 1259
149 Ga0207640_10032204 3300025981 Bacteria 3249
150 Ga0207677_10023549 3300026023 Bacteria 3807
151 Ga0207677_10155544 3300026023 Bacteria 1770
152 Ga0207703_10006991 3300026035 Bacteria 8980
153 Ga0207703_10081809 3300026035 Bacteria 2693
154 Ga0207639_10092697 3300026041 Bacteria 2421
155 Ga0207678_10053070 3300026067 Bacteria 3494
156 Ga0207708_10007906 3300026075 Bacteria 7882
157 Ga0207648_10028430 3300026089 Bacteria 4957
158 Ga0207648_10275787 3300026089 Bacteria 1503
159 Ga0207676_10127650 3300026095 Bacteria 2157
160 Ga0207676_10129629 3300026095 Bacteria 2142
161 Ga0207674_10001939 3300026116 Bacteria 26283
162 Ga0207675_100002081 3300026118 Bacteria 19886
163 Ga0207675_100048609 3300026118 Bacteria 3960
164 Ga0207698_10102954 3300026142 Bacteria 2371
165 Ga0209981_1005830 3300027378 Unclassified 1644
166 Ga0209995_1017831 3300027471 Bacteria 1169
167 Ga0209968_1001225 3300027526 Bacteria 3918
168 Ga0209999_1001770 3300027543 Bacteria 3745
169 Ga0209970_1002531 3300027614 Bacteria 3098
170 Ga0209983_1002557 3300027665 Bacteria 3964
171 Ga0209971_1000313 3300027682 Bacteria 13501
172 Ga0209998_10005572 3300027717 Bacteria 2632
173 Ga0209974_10001387 3300027876 Bacteria 8740
174 Ga0268266_10009334 3300028379 Bacteria 8648
175 Ga0268266_10505580 3300028379 Bacteria 1154
176 Ga0268265_10002397 3300028380 Bacteria 14167
177 Ga0268265_10794504 3300028380 Bacteria 922
178 Ga0268264_10261529 3300028381 Bacteria 1612
179 Ga0373923_0018536 3300035111 Bacteria 2681
180 Ga0373943_0078262 3300035170 Bacteria 1690
181 Ga0373955_0139786 3300035172 Bacteria 1419
182 Ga0373937_0068730 3300036401 Bacteria 3266
183 Ga0373925_0004115 3300037068 Bacteria 11040
184 Ga0373925_0182765 3300037068 Unclassified 1661
185 Ga0373925_0317971 3300037068 Bacteria 1259
186 Ga0395905_0635319 3300037471 Bacteria 969
187 Ga0395901_0733945 3300038443 Bacteria 982
188 Ga0439435_0007347 3300042436 Unclassified 2518
189 Ga0466969_0119211 3300044656 Bacteria 1230
190 Ga0466961_0001767 3300044693 Bacteria 13407
191 Ga0453684_0007533 3300044712 Bacteria 19967
192 Ga0453684_0054978 3300044712 Bacteria 5179
193 Ga0451576_0096440 3300045051 Bacteria 3076
194 Ga0451576_0639992 3300045051 Bacteria 1117
195 Ga0495629_0085696 3300046459 Bacteria 2198
196 Ga0495580_0289074 3300046472 Bacteria 1117
197 Ga0495582_0043372 3300046473 Bacteria 2478
198 Ga0495582_0117428 3300046473 Bacteria 1497
199 Ga0495628_0358624 3300046516 Bacteria 1071
200 Ga0495586_0168770 3300046535 Bacteria 1236
201 Ga0495586_0195224 3300046535 Bacteria 1147
202 Ga0495647_0000973 3300046681 Bacteria 8671
203 Ga0495669_0034080 3300046684 Bacteria 2244
204 Ga0495624_0118849 3300046690 Bacteria 1624
205 Ga0495602_0032453 3300048088 Bacteria 4916
206 Ga0496102_0022695 3300048905 Bacteria 5562
207 Ga0496103_0111011 3300048906 Bacteria 1742
208 Ga0496103_0322166 3300048906 Bacteria 994
209 Ga0496106_0148561 3300048909 Bacteria 1847
210 Ga0496108_0169156 3300048911 Bacteria 1891
211 Ga0496109_0077265 3300048912 Bacteria 3064
212 Ga0496113_0099628 3300048916 Bacteria 2251
213 Ga0496115_0033340 3300048918 Bacteria 4066
214 Ga0501040_0005749 3300049576 Bacteria 8025
215 Ga0501041_0098645 3300049577 Bacteria 1807
216 Ga0501046_0085006 3300049580 Bacteria 2440
217 Ga0501046_0133331 3300049580 Bacteria 1883
218 Ga0501048_0065559 3300049582 Bacteria 2568
219 Ga0501048_0131529 3300049582 Bacteria 1769
220 Ga0501072_0118110 3300049588 Bacteria 2113
221 Ga0501074_0153315 3300049590 Bacteria 1647
222 Ga0501076_0122895 3300049592 Bacteria 2102
223 Ga0501077_0156690 3300049593 Bacteria 1445
224 Ga0501079_0097998 3300049741 Bacteria 2273
225 Ga0501079_0106947 3300049741 Bacteria 2171
226 Ga0501079_0302587 3300049741 Bacteria 1251
227 Ga0501080_0312619 3300049742 Bacteria 1424
228 Ga0501035_0330271 3300049822 Unclassified 1280
229 nmdc:mga05p37_51803_c1 3300050507 Bacteria 5048
230 nmdc:mga05p37_54599_c1 3300050507 Bacteria 2774
231 nmdc:mga05p37_689982_c1 3300050507 Bacteria 1136
232 nmdc:mga05p37_76148_c1 3300050507 Bacteria 4131
233 nmdc:mga09592_517864_c1 3300050508 Bacteria 1026
234 nmdc:mga0qj67_13166_c1 3300050509 Bacteria 6245
235 nmdc:mga0qj67_185144_c1 3300050509 Unclassified 1691
236 nmdc:mga06r32_66854_c1 3300050510 Bacteria 3469
237 nmdc:mga08y16_375867_c1 3300050511 Bacteria 1457
238 nmdc:mga0n895_114981_c1 3300050512 Bacteria 2709
239 nmdc:mga0n895_15367_c1 3300050512 Bacteria 6977
240 nmdc:mga0n895_37411_c1 3300050512 Bacteria 4694
241 nmdc:mga0n895_622333_c1 3300050512 Bacteria 1080
242 nmdc:mga0n895_857678_c1 3300050512 Bacteria 896
243 nmdc:mga0n895_9076_c1 3300050512 Bacteria 8673
244 nmdc:mga0rr50_130123_c1 3300050513 Bacteria 2014
245 nmdc:mga0rr50_6464_c1 3300050513 Bacteria 7138
246 nmdc:mga08x19_25307_c1 3300050514 Bacteria 3696
247 nmdc:mga0a205_112252_c1 3300050515 Bacteria 2625
248 nmdc:mga0a205_122318_c1 3300050515 Bacteria 2502
249 nmdc:mga0a205_339619_c1 3300050515 Bacteria 1370
250 nmdc:mga0a205_51626_c1 3300050515 Bacteria 3970
251 nmdc:mga0a205_523064_c1 3300050515 Bacteria 1043
252 nmdc:mga0a205_55168_c1 3300050515 Bacteria 3839
253 nmdc:mga0a205_76797_c1 3300050515 Bacteria 3228
254 Ga0501084_0111694 3300054114 Bacteria 2297
255 Ga0501082_0261986 3300060353 Bacteria 1504
256 Ga0501082_0289413 3300060353 Bacteria 1426
257 Ga0530510_0331370 3300061734 Bacteria 1142
258 Ga0068868_100223637
259 CNBas_1001460
260 Ga0070676_10121838
261 Ga0070690_100116180
262 Ga0070670_100007580
263 Ga0068868_100036984
264 Ga0068868_100177025
265 Ga0070689_100008774
266 Ga0070689_100009882
267 Ga0070687_100010230
268 Ga0070661_100015812
269 Ga0070692_10011267
270 Ga0070668_100019827
271 Ga0070669_100013423
272 Ga0070675_100026092
273 Ga0070673_100040549
274 Ga0070688_100006782
275 Ga0070659_100287552
276 Ga0070667_100162543
277 Ga0070713_100158808
278 Ga0070701_10013768
279 Ga0070701_10014774
280 Ga0070701_10026754
281 Ga0070701_10312863
282 Ga0070694_100126408
283 Ga0070708_100017270
284 Ga0070708_100154427
285 Ga0070708_100398575
286 Ga0070662_100011999
287 Ga0070662_100046100
288 Ga0068867_100190869
289 Ga0068867_100220667
290 Ga0070685_10104232
291 Ga0070706_100010431
292 Ga0070706_100023452
293 Ga0070706_100139415
294 Ga0070707_100002705
295 Ga0070707_100060842
296 Ga0070698_100000837
297 Ga0070698_100163679
298 Ga0070698_100423397
299 Ga0070699_100059378
300 Ga0070699_100182182
301 Ga0070684_100027488
302 Ga0070684_100089342
303 Ga0070697_100002771
304 Ga0068853_100065305
305 Ga0070672_100024273
306 Ga0070672_100120230
307 Ga0070686_100171189
308 Ga0070695_100031181
309 Ga0070696_100000474
310 Ga0070665_100000588
311 Ga0070665_100375490
312 Ga0070704_100103959
313 Ga0070664_100127899
314 Ga0068857_100050114
315 Ga0068854_100163298
316 Ga0068864_100021798
317 Ga0068861_100019729
318 Ga0068861_100037665
319 Ga0068870_10001099
320 Ga0068863_100466384
321 Ga0068863_100574095
322 Ga0068858_100067256
323 Ga0068860_100070160
324 Ga0068862_100004676
325 Ga0097621_100004564
326 Ga0097621_100077837
327 Ga0068871_100093332
328 Ga0068871_100264218
329 Ga0075428_100231259
330 Ga0075430_100040805
331 Ga0075431_100072811
332 Ga0075431_100075710
333 Ga0075431_100208843
334 Ga0075433_10272918
335 Ga0075433_10616074
336 Ga0075434_100009642
337 Ga0075434_100022271
338 Ga0068865_100004153
339 Ga0068865_100015353
340 Ga0075435_100024064
341 Ga0105240_10005973
342 Ga0111539_10254589
343 Ga0105245_10023706
344 Ga0114129_10070303
345 Ga0114129_10464261
346 Ga0114129_10525949
347 Ga0114129_10604738
348 Ga0105242_10000795
349 Ga0105249_10000293
350 Ga0105249_10001680
351 Ga0105249_10204865
352 Ga0105239_10038646
353 Ga0157371_10027120
354 Ga0157374_10002043
355 Ga0157374_10026275
356 Ga0157378_10074416
357 Ga0163162_10001103
358 Ga0163162_10031940
359 Ga0157372_10389742
360 Ga0157375_10049213
361 Ga0157375_10350615
362 Ga0163163_10069977
363 Ga0157380_10032245
364 Ga0157380_10091746
365 Ga0157380_10126641
366 Ga0157380_10462373
367 Ga0157379_10007727
368 Ga0157376_10151174
369 Ga0207656_10005736
370 Ga0207645_10006603
371 Ga0207645_10009141
372 Ga0207643_10004504
373 Ga0207684_10014492
374 Ga0207684_10031129
375 Ga0207684_10226861
376 Ga0207695_10043306
377 Ga0207662_10008124
378 Ga0207662_10132353
379 Ga0207657_10035885
380 Ga0207646_10062061
381 Ga0207646_10233697
382 Ga0207646_10322404
383 Ga0207646_10429717
384 Ga0207650_10035019
385 Ga0207659_10147013
386 Ga0207687_10005749
387 Ga0207687_10142077
388 Ga0207644_10107069
389 Ga0207690_10098660
390 Ga0207706_10000450
391 Ga0207706_10029382
392 Ga0207686_10017558
393 Ga0207670_10006233
394 Ga0207669_10181551
395 Ga0207704_10114893
396 Ga0207691_10000588
397 Ga0207691_10033808
398 Ga0207711_10291011
399 Ga0207661_10309515
400 Ga0207667_10156353
401 Ga0207712_10005875
402 Ga0207712_10007037
403 Ga0207712_10169494
404 Ga0207712_10310503
405 Ga0207668_10335431
406 Ga0207640_10032204
407 Ga0207677_10023549
408 Ga0207677_10155544
409 Ga0207703_10006991
410 Ga0207703_10081809
411 Ga0207639_10092697
412 Ga0207678_10053070
413 Ga0207708_10007906
414 Ga0207648_10028430
415 Ga0207648_10275787
416 Ga0207676_10127650
417 Ga0207676_10129629
418 Ga0207674_10001939
419 Ga0207675_100002081
420 Ga0207675_100048609
421 Ga0207698_10102954
422 Ga0209981_1005830
423 Ga0209995_1017831
424 Ga0209968_1001225
425 Ga0209999_1001770
426 Ga0209970_1002531
427 Ga0209983_1002557
428 Ga0209971_1000313
429 Ga0209998_10005572
430 Ga0209974_10001387
431 Ga0268266_10009334
432 Ga0268266_10505580
433 Ga0268265_10002397
434 Ga0268265_10794504
435 Ga0268264_10261529
436 Ga0373923_0018536
437 Ga0373943_0078262
438 Ga0373955_0139786
439 Ga0373937_0068730
440 Ga0373925_0004115
441 Ga0373925_0182765
442 Ga0373925_0317971
443 Ga0395905_0635319
444 Ga0395901_0733945
445 Ga0439435_0007347
446 Ga0466969_0119211
447 Ga0466961_0001767
448 Ga0453684_0007533
449 Ga0453684_0054978
450 Ga0451576_0096440
451 Ga0451576_0639992
452 Ga0495629_0085696
453 Ga0495580_0289074
454 Ga0495582_0043372
455 Ga0495582_0117428
456 Ga0495628_0358624
457 Ga0495586_0168770
458 Ga0495586_0195224
459 Ga0495647_0000973
460 Ga0495669_0034080
461 Ga0495624_0118849
462 Ga0495602_0032453
463 Ga0496102_0022695
464 Ga0496103_0111011
465 Ga0496103_0322166
466 Ga0496106_0148561
467 Ga0496108_0169156
468 Ga0496109_0077265
469 Ga0496113_0099628
470 Ga0496115_0033340
471 Ga0501040_0005749
472 Ga0501041_0098645
473 Ga0501046_0085006
474 Ga0501046_0133331
475 Ga0501048_0065559
476 Ga0501048_0131529
477 Ga0501072_0118110
478 Ga0501074_0153315
479 Ga0501076_0122895
480 Ga0501077_0156690
481 Ga0501079_0097998
482 Ga0501079_0106947
483 Ga0501079_0302587
484 Ga0501080_0312619
485 Ga0501035_0330271
486 nmdc:mga05p37_51803_c1
487 nmdc:mga05p37_54599_c1
488 nmdc:mga05p37_689982_c1
489 nmdc:mga05p37_76148_c1
490 nmdc:mga09592_517864_c1
491 nmdc:mga0qj67_13166_c1
492 nmdc:mga0qj67_185144_c1
493 nmdc:mga06r32_66854_c1
494 nmdc:mga08y16_375867_c1
495 nmdc:mga0n895_114981_c1
496 nmdc:mga0n895_15367_c1
497 nmdc:mga0n895_37411_c1
498 nmdc:mga0n895_622333_c1
499 nmdc:mga0n895_857678_c1
500 nmdc:mga0n895_9076_c1
501 nmdc:mga0rr50_130123_c1
502 nmdc:mga0rr50_6464_c1
503 nmdc:mga08x19_25307_c1
504 nmdc:mga0a205_112252_c1
505 nmdc:mga0a205_122318_c1
506 nmdc:mga0a205_339619_c1
507 nmdc:mga0a205_51626_c1
508 nmdc:mga0a205_523064_c1
509 nmdc:mga0a205_55168_c1
510 nmdc:mga0a205_76797_c1
511 Ga0501084_0111694
512 Ga0501082_0261986
513 Ga0501082_0289413
514 Ga0530510_0331370

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

5

173

0.98

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

181

272

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.9494 6 283
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9479 6 283
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.9475 8 280
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9442 8 280
4zoh-assembly1.cif.gz_B-2 crystal structure of glyceraldehyde oxidoreductase 0.9267 6 280
ID Description Score Start End Superfamily
af_Q46800_56_173_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9712 61 175 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9693 62 175 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9611 62 175 3.30.465.10
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9593 67 175 3.30.465.10
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9508 67 175 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A7C5W2F0-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9723 9 283 GO:0016491
GO:0071949
AF-A0A7V8WBX9-F1-model_v4 FAD binding domain-containing protein 0.9719 12 195 GO:0016491
GO:0071949
AF-A0A7C5W2F0-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9619 9 283 GO:0016491
GO:0071949
AF-A0A523WRJ8-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9605 8 284 GO:0016491
GO:0071949
AF-A0A7J3SMS2-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9578 6 195 GO:0016491
GO:0071949

Map