F366648

General Info

Members Datasets Scaffolds Average Seq Length
256 125 256 102

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0127629|Ga0316574_0127629_91_456
Length 121
Sequence LFLNDSIGRIYDDKHEGGVKMKILMNVRIPHEPFNTLVREGKVGEIIQKIIKELKPEMIYFTEQGGTRGAVAIVNINDSSQIPSFSEPFFLNFNADCEFRIAMSPEDLAKSGLDELGKKWR

Samples

Sample ID Description Type Environment
1 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
20 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
41 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
42 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
46 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
58 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
64 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
71 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
72 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
73 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
91 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
108 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
109 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
119 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
123 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.02
Metatranscriptomes 8.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.52
Nodule 0
Rhizoplane 0
Rhizosphere 96.09
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25163J39215_1000297 3300002771 Bacteria 16793
2 JGI25164J39214_1000147 3300002772 Bacteria 67564
3 JGI25165J46597_1000086 3300003214 Bacteria 170731
4 Ga0070658_10268803 3300005327 Unclassified 1450
5 Ga0070668_100632245 3300005347 Unclassified 939
6 Ga0070675_100114425 3300005354 Bacteria 2286
7 Ga0070674_101918751 3300005356 Unclassified 538
8 Ga0070708_100068282 3300005445 Bacteria 3195
9 Ga0070678_101417683 3300005456 Unclassified 649
10 Ga0070681_11499828 3300005458 Bacteria 599
11 Ga0068867_100463523 3300005459 Unclassified 1082
12 Ga0070706_100075098 3300005467 Bacteria 3128
13 Ga0070706_100813433 3300005467 Unclassified 865
14 Ga0070698_100827486 3300005471 Unclassified 870
15 Ga0070698_101834076 3300005471 Bacteria 559
16 Ga0070699_100215219 3300005518 Archaea 1711
17 Ga0070699_100871688 3300005518 Bacteria 824
18 Ga0068855_100021521 3300005563 Bacteria 7733
19 Ga0068852_100238624 3300005616 Bacteria 1736
20 Ga0068864_101586406 3300005618 Unclassified 658
21 Ga0068860_100169264 3300005843 Bacteria 2110
22 Ga0075432_10086049 3300006058 Bacteria 1145
23 Ga0075427_10045794 3300006194 Bacteria 745
24 Ga0075428_100021201 3300006844 Bacteria 7196
25 Ga0075428_100063688 3300006844 Bacteria 4037
26 Ga0075430_100091078 3300006846 Bacteria 2550
27 Ga0075431_100440801 3300006847 Bacteria 1299
28 Ga0075433_10092545 3300006852 Bacteria 2674
29 Ga0075433_10472849 3300006852 Bacteria 1104
30 Ga0075434_100043483 3300006871 Unclassified 4456
31 Ga0075429_100062316 3300006880 Bacteria 3249
32 Ga0075436_100031685 3300006914 Bacteria 3642
33 Ga0075435_100250190 3300007076 Bacteria 1509
34 Ga0105240_12346116 3300009093 Unclassified 552
35 Ga0111539_10076717 3300009094 Bacteria 3935
36 Ga0111539_12766474 3300009094 Unclassified 568
37 Ga0114129_10110700 3300009147 Bacteria 3790
38 Ga0114129_10831568 3300009147 Unclassified 1175
39 Ga0114129_12864537 3300009147 Unclassified 571
40 Ga0105242_10149492 3300009176 Bacteria 2035
41 Ga0157373_10505981 3300013100 Unclassified 873
42 Ga0157370_10217296 3300013104 Bacteria 1771
43 Ga0157369_10024806 3300013105 Bacteria 6662
44 Ga0157369_10259885 3300013105 Bacteria 1811
45 Ga0157372_10266859 3300013307 Unclassified 1988
46 Ga0157375_10300461 3300013308 Bacteria 1769
47 Ga0157379_11098291 3300014968 Unclassified 762
48 Ga0157376_10662079 3300014969 Unclassified 1046
49 Ga0182007_10004812 3300015262 Bacteria 6056
50 Ga0206355_1265375 3300020076 Bacteria 610
51 Ga0224712_10072661 3300022467 Bacteria 1401
52 Ga0209760_100019 3300025207 Bacteria 170806
53 Ga0207427_100011 3300025231 Bacteria 640076
54 Ga0209437_100044 3300025233 Bacteria 430619
55 Ga0209233_1000057 3300025261 Bacteria 430619
56 Ga0207684_10070907 3300025910 Bacteria 2961
57 Ga0207707_10570749 3300025912 Bacteria 960
58 Ga0207695_11417653 3300025913 Unclassified 575
59 Ga0207669_11679631 3300025937 Unclassified 542
60 Ga0207661_10228266 3300025944 Bacteria 1648
61 Ga0207667_10092133 3300025949 Bacteria 3130
62 Ga0207667_10121447 3300025949 Unclassified 2692
63 Ga0207668_10377925 3300025972 Unclassified 1192
64 Ga0207698_10502980 3300026142 Bacteria 1180
65 Ga0207428_10001189 3300027907 Bacteria 28012
66 Ga0268264_10144402 3300028381 Bacteria 2126
67 Ga0268264_11716086 3300028381 Unclassified 638
68 Ga0265323_10006070 3300028653 Bacteria 5099
69 Ga0265322_10080138 3300028654 Bacteria 926
70 Ga0265338_10298142 3300028800 Bacteria 1173
71 Ga0265332_10129460 3300031238 Bacteria 1059
72 Ga0265316_10081729 3300031344 Bacteria 2476
73 Ga0307408_100904783 3300031548 Unclassified 808
74 Ga0316575_10000493 3300031665 Bacteria 11407
75 Ga0316575_10002755 3300031665 Bacteria 5938
76 Ga0316575_10003224 3300031665 Bacteria 5597
77 Ga0316575_10042577 3300031665 Bacteria 1798
78 Ga0316575_10069220 3300031665 Bacteria 1416
79 Ga0316575_10091925 3300031665 Bacteria 1229
80 Ga0316575_10092594 3300031665 Bacteria 1225
81 Ga0316575_10104116 3300031665 Bacteria 1155
82 Ga0316575_10142583 3300031665 Bacteria 986
83 Ga0316575_10171263 3300031665 Bacteria 900
84 Ga0316579_10014293 3300031691 Bacteria 3429
85 Ga0316579_10043132 3300031691 Bacteria 2097
86 Ga0316579_10052400 3300031691 Bacteria 1910
87 Ga0316579_10074906 3300031691 Bacteria 1607
88 Ga0316579_10101845 3300031691 Unclassified 1376
89 Ga0316579_10429863 3300031691 Bacteria 639
90 Ga0265342_10165283 3300031712 Bacteria 1221
91 Ga0316576_10000386 3300031727 Bacteria 20203
92 Ga0316576_10003913 3300031727 Bacteria 8831
93 Ga0316576_10005139 3300031727 Bacteria 7948
94 Ga0316576_10010825 3300031727 Bacteria 5945
95 Ga0316576_10053283 3300031727 Bacteria 2948
96 Ga0316576_10131446 3300031727 Bacteria 1883
97 Ga0316576_10140083 3300031727 Bacteria 1821
98 Ga0316576_10155548 3300031727 Bacteria 1723
99 Ga0316576_10259410 3300031727 Bacteria 1304
100 Ga0316576_10365922 3300031727 Unclassified 1072
101 Ga0316576_10983800 3300031727 Bacteria 602
102 Ga0316576_11007336 3300031727 Unclassified 593
103 Ga0316578_10000222 3300031728 Bacteria 16537
104 Ga0316578_10025812 3300031728 Bacteria 3307
105 Ga0316578_10071439 3300031728 Bacteria 2055
106 Ga0316578_10081244 3300031728 Bacteria 1928
107 Ga0316578_10102728 3300031728 Unclassified 1714
108 Ga0316578_10105738 3300031728 Bacteria 1689
109 Ga0316578_10167907 3300031728 Bacteria 1322
110 Ga0316578_10311097 3300031728 Bacteria 941
111 Ga0316577_10006603 3300031733 Bacteria 6140
112 Ga0316577_10027454 3300031733 Bacteria 3174
113 Ga0316577_10073503 3300031733 Bacteria 1909
114 Ga0316577_10104665 3300031733 Bacteria 1587
115 Ga0316577_10208245 3300031733 Unclassified 1105
116 Ga0316577_10234698 3300031733 Bacteria 1037
117 Ga0316577_10239570 3300031733 Unclassified 1026
118 Ga0316577_10484686 3300031733 Unclassified 703
119 Ga0307416_100102985 3300032002 Bacteria 2491
120 Ga0316583_10004738 3300032133 Bacteria 4859
121 Ga0316583_10006453 3300032133 Bacteria 4213
122 Ga0316583_10007709 3300032133 Bacteria 3881
123 Ga0316583_10012508 3300032133 Bacteria 3063
124 Ga0316583_10023064 3300032133 Bacteria 2225
125 Ga0316583_10028026 3300032133 Bacteria 2009
126 Ga0316583_10099537 3300032133 Bacteria 1014
127 Ga0316583_10242291 3300032133 Unclassified 625
128 Ga0316583_10269061 3300032133 Unclassified 590
129 Ga0316585_10000485 3300032137 Bacteria 9379
130 Ga0316585_10025447 3300032137 Bacteria 1836
131 Ga0316585_10028831 3300032137 Bacteria 1737
132 Ga0316585_10082515 3300032137 Bacteria 1047
133 Ga0316585_10192931 3300032137 Unclassified 673
134 Ga0316580_10005318 3300032139 Unclassified 3753
135 Ga0316580_10007237 3300032139 Bacteria 3299
136 Ga0316580_10064632 3300032139 Bacteria 1122
137 Ga0316580_10164489 3300032139 Bacteria 681
138 Ga0316593_10014804 3300032168 Bacteria 2335
139 Ga0316593_10029500 3300032168 Bacteria 1775
140 Ga0316593_10041245 3300032168 Bacteria 1536
141 Ga0316593_10051566 3300032168 Bacteria 1391
142 Ga0316593_10087051 3300032168 Bacteria 1096
143 Ga0316593_10300199 3300032168 Unclassified 608
144 Ga0316593_10330259 3300032168 Unclassified 581
145 Ga0316593_10375270 3300032168 Unclassified 547
146 Ga0316593_10410876 3300032168 Unclassified 524
147 Ga0316592_1009480 3300033524 Bacteria 1949
148 Ga0316592_1010351 3300033524 Bacteria 1880
149 Ga0316592_1044882 3300033524 Bacteria 983
150 Ga0316592_1089920 3300033524 Bacteria 702
151 Ga0316586_1090429 3300033527 Bacteria 578
152 Ga0316588_1033360 3300033528 Unclassified 1214
153 Ga0316588_1067215 3300033528 Bacteria 878
154 Ga0316587_1099635 3300033529 Bacteria 559
155 Ga0316596_1047188 3300033541 Bacteria 1138
156 Ga0316596_1048010 3300033541 Bacteria 1128
157 Ga0316596_1119322 3300033541 Unclassified 717
158 Ga0316596_1197503 3300033541 Bacteria 559
159 Ga0316574_0001915 3300035398 Bacteria 10190
160 Ga0316574_0004420 3300035398 Bacteria 7363
161 Ga0316574_0015144 3300035398 Unclassified 4472
162 Ga0316574_0016409 3300035398 Bacteria 4316
163 Ga0316574_0024311 3300035398 Unclassified 3624
164 Ga0316574_0049297 3300035398 Bacteria 2618
165 Ga0316574_0083425 3300035398 Bacteria 2031
166 Ga0316574_0092864 3300035398 Bacteria 1926
167 Ga0316574_0096956 3300035398 Bacteria 1884
168 Ga0316574_0115227 3300035398 Bacteria 1723
169 Ga0316574_0127629 3300035398 Bacteria 1635
170 Ga0316574_0132779 3300035398 Bacteria 1602
171 Ga0316574_0178509 3300035398 Bacteria 1366
172 Ga0316574_0182425 3300035398 Bacteria 1350
173 Ga0316574_0250970 3300035398 Bacteria 1130
174 Ga0316574_0280103 3300035398 Unclassified 1062
175 Ga0316574_0309212 3300035398 Bacteria 1004
176 Ga0316574_0387564 3300035398 Bacteria 881
177 Ga0316574_0493528 3300035398 Unclassified 764
178 Ga0316574_0851336 3300035398 Bacteria 553
179 Ga0316574_0953590 3300035398 Unclassified 517
180 Ga0373927_0408268 3300035695 Bacteria 896
181 Ga0316582_0003088 3300036647 Bacteria 8052
182 Ga0316582_0004500 3300036647 Bacteria 7056
183 Ga0316582_0022506 3300036647 Unclassified 3742
184 Ga0316582_0025894 3300036647 Bacteria 3527
185 Ga0316582_0050846 3300036647 Bacteria 2627
186 Ga0316582_0071773 3300036647 Bacteria 2243
187 Ga0316582_0214932 3300036647 Bacteria 1314
188 Ga0316582_0335788 3300036647 Unclassified 1039
189 Ga0316582_0457531 3300036647 Unclassified 880
190 Ga0316582_0654545 3300036647 Bacteria 722
191 Ga0316582_0721925 3300036647 Bacteria 684
192 Ga0316582_0735869 3300036647 Unclassified 677
193 Ga0316584_0011140 3300036712 Bacteria 6310
194 Ga0316584_0041623 3300036712 Unclassified 3424
195 Ga0316584_0043776 3300036712 Bacteria 3339
196 Ga0316584_0120952 3300036712 Bacteria 1956
197 Ga0316584_0209918 3300036712 Unclassified 1433
198 Ga0316584_0316536 3300036712 Unclassified 1127
199 Ga0316584_0354201 3300036712 Bacteria 1053
200 Ga0316584_0365618 3300036712 Bacteria 1033
201 Ga0316584_0384749 3300036712 Unclassified 1002
202 Ga0316584_0444397 3300036712 Bacteria 918
203 Ga0316584_0449516 3300036712 Bacteria 911
204 Ga0316584_0471692 3300036712 Bacteria 885
205 Ga0373925_0964355 3300037068 Bacteria 702
206 Ga0395900_0492509 3300037418 Unclassified 1177
207 Ga0395898_0575459 3300037466 Bacteria 1069
208 Ga0395905_0119298 3300037471 Bacteria 2479
209 Ga0395905_0516544 3300037471 Bacteria 1095
210 Ga0316581_0031162 3300037588 Bacteria 1607
211 Ga0316581_0191283 3300037588 Unclassified 630
212 Ga0436364_1276286 3300037853 Unclassified 667
213 Ga0395901_1860564 3300038443 Unclassified 550
214 Ga0439453_0020652 3300041408 Bacteria 1182
215 Ga0439437_059119 3300042000 Unclassified 518
216 Ga0451577_0147709 3300042876 Bacteria 2114
217 Ga0453683_0312538 3300044673 Bacteria 1006
218 Ga0453684_0000348 3300044712 Bacteria 192530
219 Ga0451576_0009818 3300045051 Bacteria 11061
220 Ga0495591_000702 3300046458 Bacteria 24358
221 Ga0495585_0128143 3300046492 Bacteria 1338
222 Ga0495628_1072697 3300046516 Unclassified 551
223 Ga0495652_0844584 3300046529 Bacteria 607
224 Ga0495609_0134615 3300046538 Bacteria 1057
225 Ga0495645_0561143 3300046543 Bacteria 706
226 Ga0495622_0000358 3300046557 Bacteria 32254
227 Ga0495657_0852119 3300046675 Unclassified 519
228 Ga0495599_0351677 3300046678 Bacteria 883
229 Ga0495670_0021241 3300046691 Bacteria 3201
230 Ga0495604_0978709 3300047317 Unclassified 525
231 Ga0495672_0523057 3300047320 Unclassified 524
232 Ga0495687_059160 3300047443 Bacteria 1587
233 Ga0495675_0177847 3300047444 Bacteria 1304
234 Ga0501048_1339265 3300049582 Unclassified 515
235 Ga0501076_0940812 3300049592 Bacteria 712
236 Ga0501080_0180759 3300049742 Bacteria 1941
237 Ga0501081_0870846 3300049743 Unclassified 679
238 Ga0501045_0778433 3300049824 Unclassified 705
239 nmdc:mga0k408_474879_c1 3300050493 Unclassified 742
240 nmdc:mga05p37_1733748_c1 3300050507 Unclassified 607
241 nmdc:mga05p37_76691_c1 3300050507 Bacteria 4115
242 nmdc:mga05p37_771839_c1 3300050507 Unclassified 1056
243 nmdc:mga09592_78780_c1 3300050508 Bacteria 2805
244 nmdc:mga0qj67_39490_c1 3300050509 Bacteria 3707
245 nmdc:mga06r32_479771_c1 3300050510 Bacteria 1222
246 nmdc:mga06r32_991590_c1 3300050510 Bacteria 793
247 nmdc:mga08y16_139758_c1 3300050511 Bacteria 2518
248 nmdc:mga08y16_1741443_c1 3300050511 Unclassified 577
249 nmdc:mga0n895_290474_c1 3300050512 Bacteria 1658
250 nmdc:mga0n895_37040_c1 3300050512 Unclassified 4715
251 nmdc:mga0a205_108198_c1 3300050515 Bacteria 2678
252 nmdc:mga0a205_335432_c1 3300050515 Bacteria 1381
253 Ga0500590_132698 3300053148 Unclassified 1150
254 Ga0501082_0705667 3300060353 Unclassified 883
255 Ga0501082_1187679 3300060353 Unclassified 667
256 Ga0530510_0452265 3300061734 Unclassified 971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031727 Ga0316576_10259410 Ga0316576_102594102 97
2 3300031733 Ga0316577_10239570 Ga0316577_102395702 97
3 3300032133 Ga0316583_10242291 Ga0316583_102422911 97
4 3300033541 Ga0316596_1119322 Ga0316596_11193221 97
5 3300035398 Ga0316574_0004420 Ga0316574_0004420_1889_2182 97
6 3300035398 Ga0316574_0015144 Ga0316574_0015144_3824_4117 97
7 3300036647 Ga0316582_0004500 Ga0316582_0004500_4639_4932 97
8 3300036647 Ga0316582_0457531 Ga0316582_0457531_439_732 97
9 3300036647 Ga0316582_0735869 Ga0316582_0735869_368_661 97
10 3300036712 Ga0316584_0209918 Ga0316584_0209918_590_883 97
11 3300009094 Ga0111539_10076717 Ga0111539_100767172 99
12 3300009147 Ga0114129_10110700 Ga0114129_101107003 99
13 3300009147 Ga0114129_10831568 Ga0114129_108315681 99
14 3300009147 Ga0114129_12864537 Ga0114129_128645371 99
15 3300013105 Ga0157369_10024806 Ga0157369_100248062 99
16 3300032168 Ga0316593_10410876 Ga0316593_104108761 99
17 3300035398 Ga0316574_0280103 Ga0316574_0280103_287_586 99
18 3300036712 Ga0316584_0354201 Ga0316584_0354201_160_459 99
19 3300041408 Ga0439453_0020652 Ga0439453_0020652_350_649 99
20 3300042000 Ga0439437_059119 Ga0439437_059119_105_404 99
21 3300046516 Ga0495628_1072697 Ga0495628_1072697_208_507 99
22 3300046675 Ga0495657_0852119 Ga0495657_0852119_171_470 99
23 3300047443 Ga0495687_059160 Ga0495687_059160_1122_1421 99
24 3300049582 Ga0501048_1339265 Ga0501048_1339265_17_316 99
25 3300049743 Ga0501081_0870846 Ga0501081_0870846_323_622 99
26 3300049824 Ga0501045_0778433 Ga0501045_0778433_23_322 99
27 3300050493 nmdc:mga0k408_474879_c1 nmdc:mga0k408_474879_c1_147_476 99
28 3300050507 nmdc:mga05p37_1733748_c1 nmdc:mga05p37_1733748_c1_176_475 99
29 3300050507 nmdc:mga05p37_76691_c1 nmdc:mga05p37_76691_c1_3516_3815 99
30 3300050507 nmdc:mga05p37_771839_c1 nmdc:mga05p37_771839_c1_621_920 99
31 3300050508 nmdc:mga09592_78780_c1 nmdc:mga09592_78780_c1_1396_1695 99
32 3300050509 nmdc:mga0qj67_39490_c1 nmdc:mga0qj67_39490_c1_2127_2426 99
33 3300050510 nmdc:mga06r32_479771_c1 nmdc:mga06r32_479771_c1_121_420 99
34 3300050511 nmdc:mga08y16_139758_c1 nmdc:mga08y16_139758_c1_1438_1737 99
35 3300050512 nmdc:mga0n895_290474_c1 nmdc:mga0n895_290474_c1_486_785 99
36 3300050512 nmdc:mga0n895_37040_c1 nmdc:mga0n895_37040_c1_263_562 99
37 3300050515 nmdc:mga0a205_108198_c1 nmdc:mga0a205_108198_c1_1609_1908 99
38 3300050515 nmdc:mga0a205_335432_c1 nmdc:mga0a205_335432_c1_581_880 99
39 3300060353 Ga0501082_0705667 Ga0501082_0705667_194_493 99
40 3300002771 JGI25163J39215_1000297 JGI25163J39215_10002976 101
41 3300002772 JGI25164J39214_1000147 JGI25164J39214_100014719 101
42 3300003214 JGI25165J46597_1000086 JGI25165J46597_100008652 101
43 3300005327 Ga0070658_10268803 Ga0070658_102688032 101
44 3300005347 Ga0070668_100632245 Ga0070668_1006322451 101
45 3300005354 Ga0070675_100114425 Ga0070675_1001144251 101
46 3300005356 Ga0070674_101918751 Ga0070674_1019187511 101
47 3300005445 Ga0070708_100068282 Ga0070708_1000682821 101
48 3300005456 Ga0070678_101417683 Ga0070678_1014176832 101
49 3300005458 Ga0070681_11499828 Ga0070681_114998281 101
50 3300005459 Ga0068867_100463523 Ga0068867_1004635232 101
51 3300005467 Ga0070706_100075098 Ga0070706_1000750981 101
52 3300005467 Ga0070706_100813433 Ga0070706_1008134331 101
53 3300005471 Ga0070698_100827486 Ga0070698_1008274862 101
54 3300005471 Ga0070698_101834076 Ga0070698_1018340762 101
55 3300005518 Ga0070699_100215219 Ga0070699_1002152192 101
56 3300005518 Ga0070699_100871688 Ga0070699_1008716882 101
57 3300005563 Ga0068855_100021521 Ga0068855_1000215218 101
58 3300005616 Ga0068852_100238624 Ga0068852_1002386241 101
59 3300005618 Ga0068864_101586406 Ga0068864_1015864062 101
60 3300005843 Ga0068860_100169264 Ga0068860_1001692644 101
61 3300006058 Ga0075432_10086049 Ga0075432_100860492 101
62 3300006194 Ga0075427_10045794 Ga0075427_100457942 101
63 3300006844 Ga0075428_100021201 Ga0075428_1000212016 101
64 3300006844 Ga0075428_100063688 Ga0075428_1000636884 101
65 3300006846 Ga0075430_100091078 Ga0075430_1000910783 101
66 3300006847 Ga0075431_100440801 Ga0075431_1004408012 101
67 3300006852 Ga0075433_10092545 Ga0075433_100925453 101
68 3300006852 Ga0075433_10472849 Ga0075433_104728492 101
69 3300006871 Ga0075434_100043483 Ga0075434_1000434831 101
70 3300006880 Ga0075429_100062316 Ga0075429_1000623163 101
71 3300006914 Ga0075436_100031685 Ga0075436_1000316856 101
72 3300007076 Ga0075435_100250190 Ga0075435_1002501903 101
73 3300009093 Ga0105240_12346116 Ga0105240_123461161 101
74 3300009094 Ga0111539_12766474 Ga0111539_127664741 101
75 3300009176 Ga0105242_10149492 Ga0105242_101494922 101
76 3300013100 Ga0157373_10505981 Ga0157373_105059812 101
77 3300013104 Ga0157370_10217296 Ga0157370_102172963 101
78 3300013105 Ga0157369_10259885 Ga0157369_102598853 101
79 3300013307 Ga0157372_10266859 Ga0157372_102668592 101
80 3300013308 Ga0157375_10300461 Ga0157375_103004612 101
81 3300014968 Ga0157379_11098291 Ga0157379_110982912 101
82 3300014969 Ga0157376_10662079 Ga0157376_106620793 101
83 3300015262 Ga0182007_10004812 Ga0182007_100048128 101
84 3300020076 Ga0206355_1265375 Ga0206355_12653751 101
85 3300022467 Ga0224712_10072661 Ga0224712_100726613 101
86 3300025207 Ga0209760_100019 Ga0209760_100019117 101
87 3300025231 Ga0207427_100011 Ga0207427_100011117 101
88 3300025233 Ga0209437_100044 Ga0209437_100044117 101
89 3300025261 Ga0209233_1000057 Ga0209233_1000057117 101
90 3300025910 Ga0207684_10070907 Ga0207684_100709075 101
91 3300025912 Ga0207707_10570749 Ga0207707_105707491 101
92 3300025913 Ga0207695_11417653 Ga0207695_114176531 101
93 3300025937 Ga0207669_11679631 Ga0207669_116796311 101
94 3300025944 Ga0207661_10228266 Ga0207661_102282662 101
95 3300025949 Ga0207667_10092133 Ga0207667_100921333 101
96 3300025949 Ga0207667_10121447 Ga0207667_101214473 101
97 3300025972 Ga0207668_10377925 Ga0207668_103779253 101
98 3300026142 Ga0207698_10502980 Ga0207698_105029801 101
99 3300027907 Ga0207428_10001189 Ga0207428_1000118920 101
100 3300028381 Ga0268264_10144402 Ga0268264_101444021 101
101 3300028381 Ga0268264_11716086 Ga0268264_117160861 101
102 3300028653 Ga0265323_10006070 Ga0265323_100060707 101
103 3300028654 Ga0265322_10080138 Ga0265322_100801381 101
104 3300028800 Ga0265338_10298142 Ga0265338_102981422 101
105 3300031238 Ga0265332_10129460 Ga0265332_101294601 101
106 3300031344 Ga0265316_10081729 Ga0265316_100817294 101
107 3300031548 Ga0307408_100904783 Ga0307408_1009047832 101
108 3300031665 Ga0316575_10000493 Ga0316575_100004937 101
109 3300031665 Ga0316575_10002755 Ga0316575_100027552 101
110 3300031665 Ga0316575_10003224 Ga0316575_100032243 101
111 3300031665 Ga0316575_10042577 Ga0316575_100425772 101
112 3300031665 Ga0316575_10069220 Ga0316575_100692202 101
113 3300031665 Ga0316575_10091925 Ga0316575_100919252 101
114 3300031665 Ga0316575_10092594 Ga0316575_100925942 101
115 3300031665 Ga0316575_10104116 Ga0316575_101041162 101
116 3300031665 Ga0316575_10142583 Ga0316575_101425832 101
117 3300031665 Ga0316575_10171263 Ga0316575_101712631 101
118 3300031691 Ga0316579_10014293 Ga0316579_100142932 101
119 3300031691 Ga0316579_10043132 Ga0316579_100431322 101
120 3300031691 Ga0316579_10052400 Ga0316579_100524002 101
121 3300031691 Ga0316579_10074906 Ga0316579_100749062 101
122 3300031691 Ga0316579_10101845 Ga0316579_101018452 101
123 3300031691 Ga0316579_10429863 Ga0316579_104298631 101
124 3300031712 Ga0265342_10165283 Ga0265342_101652833 101
125 3300031727 Ga0316576_10000386 Ga0316576_1000038610 101
126 3300031727 Ga0316576_10003913 Ga0316576_100039133 101
127 3300031727 Ga0316576_10005139 Ga0316576_100051393 101
128 3300031727 Ga0316576_10010825 Ga0316576_100108254 101
129 3300031727 Ga0316576_10053283 Ga0316576_100532834 101
130 3300031727 Ga0316576_10131446 Ga0316576_101314462 101
131 3300031727 Ga0316576_10140083 Ga0316576_101400832 101
132 3300031727 Ga0316576_10155548 Ga0316576_101555482 101
133 3300031727 Ga0316576_10365922 Ga0316576_103659222 101
134 3300031727 Ga0316576_10983800 Ga0316576_109838001 101
135 3300031727 Ga0316576_11007336 Ga0316576_110073361 101
136 3300031728 Ga0316578_10000222 Ga0316578_1000022213 101
137 3300031728 Ga0316578_10025812 Ga0316578_100258122 101
138 3300031728 Ga0316578_10071439 Ga0316578_100714394 101
139 3300031728 Ga0316578_10081244 Ga0316578_100812442 101
140 3300031728 Ga0316578_10102728 Ga0316578_101027282 101
141 3300031728 Ga0316578_10105738 Ga0316578_101057383 101
142 3300031728 Ga0316578_10167907 Ga0316578_101679072 101
143 3300031728 Ga0316578_10311097 Ga0316578_103110971 101
144 3300031733 Ga0316577_10006603 Ga0316577_100066034 101
145 3300031733 Ga0316577_10027454 Ga0316577_100274541 101
146 3300031733 Ga0316577_10073503 Ga0316577_100735032 101
147 3300031733 Ga0316577_10104665 Ga0316577_101046652 101
148 3300031733 Ga0316577_10208245 Ga0316577_102082452 101
149 3300031733 Ga0316577_10234698 Ga0316577_102346982 101
150 3300031733 Ga0316577_10484686 Ga0316577_104846861 101
151 3300032002 Ga0307416_100102985 Ga0307416_1001029853 101
152 3300032133 Ga0316583_10004738 Ga0316583_100047384 101
153 3300032133 Ga0316583_10006453 Ga0316583_100064533 101
154 3300032133 Ga0316583_10007709 Ga0316583_100077092 101
155 3300032133 Ga0316583_10012508 Ga0316583_100125083 101
156 3300032133 Ga0316583_10023064 Ga0316583_100230643 101
157 3300032133 Ga0316583_10028026 Ga0316583_100280263 101
158 3300032133 Ga0316583_10099537 Ga0316583_100995371 101
159 3300032133 Ga0316583_10269061 Ga0316583_102690611 101
160 3300032137 Ga0316585_10000485 Ga0316585_100004856 101
161 3300032137 Ga0316585_10025447 Ga0316585_100254472 101
162 3300032137 Ga0316585_10028831 Ga0316585_100288312 101
163 3300032137 Ga0316585_10082515 Ga0316585_100825151 101
164 3300032137 Ga0316585_10192931 Ga0316585_101929311 101
165 3300032139 Ga0316580_10005318 Ga0316580_100053183 101
166 3300032139 Ga0316580_10007237 Ga0316580_100072373 101
167 3300032139 Ga0316580_10064632 Ga0316580_100646321 101
168 3300032139 Ga0316580_10164489 Ga0316580_101644891 101
169 3300032168 Ga0316593_10014804 Ga0316593_100148042 101
170 3300032168 Ga0316593_10029500 Ga0316593_100295003 101
171 3300032168 Ga0316593_10041245 Ga0316593_100412453 101
172 3300032168 Ga0316593_10051566 Ga0316593_100515662 101
173 3300032168 Ga0316593_10087051 Ga0316593_100870511 101
174 3300032168 Ga0316593_10300199 Ga0316593_103001992 101
175 3300032168 Ga0316593_10330259 Ga0316593_103302591 101
176 3300032168 Ga0316593_10375270 Ga0316593_103752701 101
177 3300033524 Ga0316592_1009480 Ga0316592_10094802 101
178 3300033524 Ga0316592_1010351 Ga0316592_10103511 101
179 3300033524 Ga0316592_1044882 Ga0316592_10448823 101
180 3300033524 Ga0316592_1089920 Ga0316592_10899202 101
181 3300033527 Ga0316586_1090429 Ga0316586_10904291 101
182 3300033528 Ga0316588_1033360 Ga0316588_10333602 101
183 3300033528 Ga0316588_1067215 Ga0316588_10672152 101
184 3300033529 Ga0316587_1099635 Ga0316587_10996352 101
185 3300033541 Ga0316596_1047188 Ga0316596_10471882 101
186 3300033541 Ga0316596_1048010 Ga0316596_10480102 101
187 3300033541 Ga0316596_1197503 Ga0316596_11975032 101
188 3300035398 Ga0316574_0001915 Ga0316574_0001915_5743_6048 101
189 3300035398 Ga0316574_0016409 Ga0316574_0016409_3754_4080 101
190 3300035398 Ga0316574_0024311 Ga0316574_0024311_955_1260 101
191 3300035398 Ga0316574_0049297 Ga0316574_0049297_1539_1844 101
192 3300035398 Ga0316574_0083425 Ga0316574_0083425_1215_1520 101
193 3300035398 Ga0316574_0092864 Ga0316574_0092864_108_437 101
194 3300035398 Ga0316574_0096956 Ga0316574_0096956_1149_1454 101
195 3300035398 Ga0316574_0115227 Ga0316574_0115227_1197_1502 101
196 3300035398 Ga0316574_0127629 Ga0316574_0127629_91_456 101
197 3300035398 Ga0316574_0132779 Ga0316574_0132779_65_430 101
198 3300035398 Ga0316574_0178509 Ga0316574_0178509_90_446 101
199 3300035398 Ga0316574_0182425 Ga0316574_0182425_19_324 101
200 3300035398 Ga0316574_0250970 Ga0316574_0250970_128_433 101
201 3300035398 Ga0316574_0309212 Ga0316574_0309212_33_338 101
202 3300035398 Ga0316574_0387564 Ga0316574_0387564_330_668 101
203 3300035398 Ga0316574_0493528 Ga0316574_0493528_102_407 101
204 3300035398 Ga0316574_0851336 Ga0316574_0851336_167_472 101
205 3300035398 Ga0316574_0953590 Ga0316574_0953590_113_439 101
206 3300035695 Ga0373927_0408268 Ga0373927_0408268_160_465 101
207 3300036647 Ga0316582_0003088 Ga0316582_0003088_4305_4631 101
208 3300036647 Ga0316582_0022506 Ga0316582_0022506_321_677 101
209 3300036647 Ga0316582_0025894 Ga0316582_0025894_1463_1792 101
210 3300036647 Ga0316582_0050846 Ga0316582_0050846_231_536 101
211 3300036647 Ga0316582_0071773 Ga0316582_0071773_1540_1866 101
212 3300036647 Ga0316582_0214932 Ga0316582_0214932_298_618 101
213 3300036647 Ga0316582_0335788 Ga0316582_0335788_688_1014 101
214 3300036647 Ga0316582_0654545 Ga0316582_0654545_363_668 101
215 3300036647 Ga0316582_0721925 Ga0316582_0721925_123_449 101
216 3300036712 Ga0316584_0011140 Ga0316584_0011140_5534_5860 101
217 3300036712 Ga0316584_0041623 Ga0316584_0041623_577_933 101
218 3300036712 Ga0316584_0043776 Ga0316584_0043776_2856_3176 101
219 3300036712 Ga0316584_0120952 Ga0316584_0120952_448_753 101
220 3300036712 Ga0316584_0316536 Ga0316584_0316536_122_427 101
221 3300036712 Ga0316584_0365618 Ga0316584_0365618_405_734 101
222 3300036712 Ga0316584_0384749 Ga0316584_0384749_170_475 101
223 3300036712 Ga0316584_0444397 Ga0316584_0444397_230_556 101
224 3300036712 Ga0316584_0449516 Ga0316584_0449516_42_407 101
225 3300036712 Ga0316584_0471692 Ga0316584_0471692_258_584 101
226 3300037068 Ga0373925_0964355 Ga0373925_0964355_13_318 101
227 3300037418 Ga0395900_0492509 Ga0395900_0492509_609_914 101
228 3300037466 Ga0395898_0575459 Ga0395898_0575459_439_744 101
229 3300037471 Ga0395905_0119298 Ga0395905_0119298_112_417 101
230 3300037471 Ga0395905_0516544 Ga0395905_0516544_105_410 101
231 3300037588 Ga0316581_0031162 Ga0316581_0031162_514_840 101
232 3300037588 Ga0316581_0191283 Ga0316581_0191283_261_566 101
233 3300037853 Ga0436364_1276286 Ga0436364_1276286_339_644 101
234 3300038443 Ga0395901_1860564 Ga0395901_1860564_117_422 101
235 3300042876 Ga0451577_0147709 Ga0451577_0147709_1185_1490 101
236 3300044673 Ga0453683_0312538 Ga0453683_0312538_579_884 101
237 3300044712 Ga0453684_0000348 Ga0453684_0000348_58681_58986 101
238 3300045051 Ga0451576_0009818 Ga0451576_0009818_10353_10658 101
239 3300046458 Ga0495591_000702 Ga0495591_000702_21120_21431 101
240 3300046492 Ga0495585_0128143 Ga0495585_0128143_157_468 101
241 3300046529 Ga0495652_0844584 Ga0495652_0844584_92_397 101
242 3300046538 Ga0495609_0134615 Ga0495609_0134615_257_568 101
243 3300046543 Ga0495645_0561143 Ga0495645_0561143_291_596 101
244 3300046557 Ga0495622_0000358 Ga0495622_0000358_20989_21294 101
245 3300046678 Ga0495599_0351677 Ga0495599_0351677_480_785 101
246 3300046691 Ga0495670_0021241 Ga0495670_0021241_2460_2771 101
247 3300047317 Ga0495604_0978709 Ga0495604_0978709_131_436 101
248 3300047320 Ga0495672_0523057 Ga0495672_0523057_70_375 101
249 3300047444 Ga0495675_0177847 Ga0495675_0177847_650_955 101
250 3300049592 Ga0501076_0940812 Ga0501076_0940812_283_588 101
251 3300049742 Ga0501080_0180759 Ga0501080_0180759_393_698 101
252 3300050510 nmdc:mga06r32_991590_c1 nmdc:mga06r32_991590_c1_458_763 101
253 3300050511 nmdc:mga08y16_1741443_c1 nmdc:mga08y16_1741443_c1_178_483 101
254 3300053148 Ga0500590_132698 Ga0500590_132698_446_883 101
255 3300060353 Ga0501082_1187679 Ga0501082_1187679_255_560 101
256 3300061734 Ga0530510_0452265 Ga0530510_0452265_508_828 101

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jzx-assembly1.cif.gz_A pcbp2 kh1-kh2 domains 0.7026 1 69
2cfx-assembly1.cif.gz_C structure of b.subtilis lrpc 0.686 2 84
2qz8-assembly1.cif.gz_B-2 crystal structure of mycobacterium tuberculosis leucine response regulatory protein (lrpa) 0.6826 2 84
3jb9-assembly1.cif.gz_B cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution 0.6761 2 83
8ceh-assembly1.cif.gz_Aa translocation intermediate 4 (ti-4) of 80s s. cerevisiae ribosome with ligands and eef2 in the presence of sordarin 0.6736 2 83
ID Description Score Start End Superfamily
2cfxA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7151 2 84 3.30.70.920
af_Q86KZ5_171_252_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7045 3 85 3.30.70.240
af_Q8I335_822_963_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6841 2 80 3.30.70.240
2w24A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6708 2 82 3.30.70.920
3zz0B05 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6696 1 82 3.30.70.240
ID Description Score Start End GO Terms
AF-L8PF79-F1-model_v4 Uncharacterized protein 0.9771 1 91
AF-F6G5V2-F1-model_v4 Panthothenate synthetase 0.9763 1 101
AF-A0A0F8ZSZ3-F1-model_v4 Uncharacterized protein 0.9726 1 92
AF-F6G5V2-F1-model_v4 Panthothenate synthetase 0.9669 1 101
AF-A0A358SS01-F1-model_v4 Panthothenate synthetase 0.9624 1 96

Feature Viewer

pLDDT pTM Quality
96.51 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map