F366629

General Info

Members Datasets Scaffolds Average Seq Length
256 177 252 168

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10709872|Ga0307414_107098721
Length 205
Sequence VRQPLGAAPRMRYKSGSLDAQPDRDKSVPTSAPYTAQNPSDAELDALAVRVGARLRALRQMLVTAESCTGGWIAKTVTDIAGSSDWFDCGMAAYSYEAKQAMLGVRAETLLEHGAVSRETVMEMVAGALVHSGASVAVAVTGIAGPSGGTPEKPVGSVWVAWKRRGGYPHAELFQFQGNRDAVRRQTVAVALDGLLKTLTTESAD

Samples

Sample ID Description Type Environment
1 2919675420 Luteimonas terrae 4099 Isolate Unclassified
2 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
3 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
102 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
103 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
104 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
105 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
106 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
107 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
108 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
109 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
110 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
113 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
114 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
117 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
118 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
119 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
152 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
164 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
165 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
166 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
167 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
168 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
176 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
177 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.44
Metatranscriptomes 0
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.31
Nodule 0.39
Rhizoplane 7.42
Rhizosphere 66.02
Stem 0
Stem Tuber 0
Unclassified 5.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000473 3300002773 Bacteria 23402
2 JGI25150J39212_1002148 3300002774 Bacteria 5085
3 JGI25151J46595_10000207 3300003187 Bacteria 71940
4 JGI25151J46595_10048717 3300003187 Bacteria 1461
5 JGI25153J46596_10000146 3300003215 Bacteria 71940
6 rootH2_10128899 3300003320 Bacteria 1250
7 JGI26143J51219_1000645 3300003502 Bacteria 1334
8 Ga0055526_1003663 3300003771 Bacteria 9612
9 Ga0055537_1001391 3300003773 Bacteria 9612
10 Ga0055524_1002744 3300003775 Bacteria 8885
11 Ga0055524_1025757 3300003775 Bacteria 1834
12 Ga0055524_1053901 3300003775 Bacteria 886
13 Ga0055536_1031165 3300003781 Bacteria 1400
14 Ga0055536_1040628 3300003781 Bacteria 1105
15 Ga0055534_1001405 3300003784 Bacteria 9612
16 Ga0055528_1002571 3300003790 Bacteria 9612
17 Ga0055530_10003846 3300003791 Bacteria 8228
18 Ga0055531_10027102 3300003794 Bacteria 2022
19 Ga0055531_10064121 3300003794 Bacteria 880
20 Ga0065714_10116058 3300005288 Bacteria 1408
21 Ga0065715_10005148 3300005293 Bacteria 6362
22 Ga0065715_10093422 3300005293 Bacteria 4688
23 Ga0070670_101098513 3300005331 Bacteria 725
24 Ga0068869_100315015 3300005334 Bacteria 1267
25 Ga0068868_100461806 3300005338 Bacteria 1106
26 Ga0070692_10243402 3300005345 Bacteria 1073
27 Ga0070669_100008137 3300005353 Bacteria 7489
28 Ga0070669_100259591 3300005353 Bacteria 1386
29 Ga0070671_100582017 3300005355 Bacteria 967
30 Ga0070667_100290052 3300005367 Bacteria 1471
31 Ga0068867_100346098 3300005459 Bacteria 1239
32 Ga0070679_100036169 3300005530 Bacteria 4900
33 Ga0070672_100031590 3300005543 Bacteria 3986
34 Ga0070696_100015298 3300005546 Bacteria 5152
35 Ga0070665_100382035 3300005548 Bacteria 1416
36 Ga0068857_100831703 3300005577 Bacteria 883
37 Ga0068852_100111956 3300005616 Bacteria 2483
38 Ga0075364_10007377 3300006051 Bacteria 6526
39 Ga0075364_10343973 3300006051 Bacteria 1016
40 Ga0068865_100137165 3300006881 Bacteria 1840
41 Ga0099826_10220995 3300006948 Bacteria 1020
42 Ga0105242_10738019 3300009176 Bacteria 968
43 Ga0105248_10015868 3300009177 Bacteria 8301
44 Ga0105239_10099711 3300010375 Bacteria 3212
45 Ga0157327_1009402 3300012512 Bacteria 900
46 Ga0157371_10122627 3300013102 Bacteria 1848
47 Ga0157378_10008402 3300013297 Bacteria 8994
48 Ga0163162_10752824 3300013306 Bacteria 1093
49 Ga0157372_10199011 3300013307 Bacteria 2321
50 Ga0157375_10001135 3300013308 Bacteria 23067
51 Ga0157375_10378681 3300013308 Bacteria 1582
52 Ga0157380_11389709 3300014326 Bacteria 752
53 Ga0183360_10001 3300015689 Bacteria 3943671
54 Ga0213876_10282232 3300021384 Bacteria 883
55 Ga0209565_1000001 3300025263 Bacteria 2950419
56 Ga0209673_1000001 3300025273 Bacteria 3176258
57 Ga0209673_1016502 3300025273 Bacteria 2757
58 Ga0209130_1017777 3300025284 Bacteria 1685
59 Ga0209675_1000001 3300025291 Bacteria 2950293
60 Ga0209675_1039508 3300025291 Bacteria 1044
61 Ga0209676_1001959 3300025292 Bacteria 16503
62 Ga0209676_1002221 3300025292 Bacteria 14420
63 Ga0209676_1005514 3300025292 Bacteria 6576
64 Ga0209676_1005762 3300025292 Bacteria 6346
65 Ga0209025_1003316 3300025294 Bacteria 15482
66 Ga0209025_1004873 3300025294 Bacteria 11315
67 Ga0209025_1125027 3300025294 Bacteria 759
68 Ga0209564_1000001 3300025295 Bacteria 3176258
69 Ga0209564_1015193 3300025295 Bacteria 3149
70 Ga0209564_1024724 3300025295 Bacteria 2045
71 Ga0209758_1028855 3300025297 Bacteria 2336
72 Ga0209050_1001726 3300025298 Bacteria 21753
73 Ga0209256_1000002 3300025299 Bacteria 1906740
74 Ga0209256_1002458 3300025299 Bacteria 15068
75 Ga0209256_1012336 3300025299 Bacteria 3292
76 Ga0209256_1023567 3300025299 Bacteria 1833
77 Ga0209051_1010157 3300025303 Bacteria 4786
78 Ga0209257_1000148 3300025304 Bacteria 193131
79 Ga0209257_1000243 3300025304 Bacteria 126291
80 Ga0209257_1000580 3300025304 Bacteria 61573
81 Ga0209257_1027316 3300025304 Bacteria 1902
82 Ga0209257_1028226 3300025304 Bacteria 1851
83 Ga0207652_10119941 3300025921 Bacteria 2339
84 Ga0207681_10005866 3300025923 Bacteria 7530
85 Ga0207681_10232217 3300025923 Bacteria 1432
86 Ga0207650_11169974 3300025925 Bacteria 655
87 Ga0207706_10247891 3300025933 Bacteria 1556
88 Ga0207709_10283893 3300025935 Bacteria 1224
89 Ga0207670_10220286 3300025936 Bacteria 1452
90 Ga0207704_10111728 3300025938 Bacteria 1849
91 Ga0207691_10014083 3300025940 Bacteria 7631
92 Ga0207711_10016272 3300025941 Bacteria 6176
93 Ga0207689_10323410 3300025942 Bacteria 1280
94 Ga0207640_10006775 3300025981 Bacteria 6303
95 Ga0207639_10413995 3300026041 Bacteria 1217
96 Ga0207648_10452949 3300026089 Bacteria 1169
97 Ga0207675_100868337 3300026118 Bacteria 918
98 Ga0207698_10121747 3300026142 Bacteria 2210
99 Ga0209969_1015055 3300027360 Bacteria 1129
100 Ga0209984_1024165 3300027424 Bacteria 842
101 Ga0210000_1008401 3300027462 Bacteria 1514
102 Ga0209999_1000163 3300027543 Bacteria 8816
103 Ga0209982_1001492 3300027552 Bacteria 3206
104 Ga0209970_1005255 3300027614 Bacteria 2138
105 Ga0210002_1053217 3300027617 Bacteria 700
106 Ga0209983_1002158 3300027665 Bacteria 4331
107 Ga0209971_1001646 3300027682 Bacteria 5525
108 Ga0209974_10046370 3300027876 Bacteria 1453
109 Ga0209974_10138135 3300027876 Bacteria 873
110 Ga0268266_10895013 3300028379 Bacteria 858
111 Ga0316575_10009054 3300031665 Bacteria 3640
112 Ga0307405_10379462 3300031731 Bacteria 1100
113 Ga0307413_10047172 3300031824 Bacteria 2567
114 Ga0307413_10146889 3300031824 Bacteria 1638
115 Ga0307413_10284241 3300031824 Bacteria 1246
116 Ga0307413_10357560 3300031824 Bacteria 1129
117 Ga0307410_10055360 3300031852 Bacteria 2692
118 Ga0307410_10303348 3300031852 Bacteria 1261
119 Ga0307412_10271952 3300031911 Bacteria 1326
120 Ga0307412_10347245 3300031911 Bacteria 1190
121 Ga0307412_10486934 3300031911 Bacteria 1024
122 Ga0307412_10529241 3300031911 Bacteria 986
123 Ga0307412_10732095 3300031911 Bacteria 852
124 Ga0307409_100329273 3300031995 Bacteria 1433
125 Ga0307409_100643053 3300031995 Bacteria 1053
126 Ga0307414_10004112 3300032004 Bacteria 7858
127 Ga0307414_10006987 3300032004 Bacteria 6326
128 Ga0307414_10061072 3300032004 Bacteria 2668
129 Ga0307414_10105629 3300032004 Bacteria 2129
130 Ga0307414_10107448 3300032004 Bacteria 2114
131 Ga0307414_10243397 3300032004 Bacteria 1490
132 Ga0307414_10395357 3300032004 Bacteria 1199
133 Ga0307414_10700243 3300032004 Bacteria 917
134 Ga0307414_10709872 3300032004 Bacteria 911
135 Ga0307414_11132846 3300032004 Bacteria 723
136 Ga0307414_11407316 3300032004 Bacteria 648
137 Ga0307411_10184965 3300032005 Bacteria 1585
138 Ga0307411_10494313 3300032005 Bacteria 1033
139 Ga0307415_100100734 3300032126 Bacteria 2118
140 Ga0307415_100573193 3300032126 Bacteria 1000
141 Ga0395900_0098070 3300037418 Bacteria 3011
142 Ga0395900_0115206 3300037418 Bacteria 2758
143 Ga0395898_0168879 3300037466 Bacteria 2091
144 Ga0395898_0177805 3300037466 Bacteria 2034
145 Ga0395898_0405794 3300037466 Bacteria 1299
146 Ga0395898_1461963 3300037466 Bacteria 610
147 Ga0395905_0004109 3300037471 Bacteria 15251
148 Ga0395905_0054021 3300037471 Bacteria 3760
149 Ga0395905_0065835 3300037471 Bacteria 3393
150 Ga0395905_0071842 3300037471 Bacteria 3244
151 Ga0395905_0804027 3300037471 Bacteria 843
152 Ga0395905_1324624 3300037471 Bacteria 624
153 Ga0395901_0002348 3300038443 Bacteria 19240
154 Ga0436365_1442156 3300039437 Bacteria 1756
155 Ga0439436_0004649 3300041404 Bacteria 4210
156 Ga0439436_0006144 3300041404 Bacteria 3688
157 Ga0439436_0011214 3300041404 Bacteria 2723
158 Ga0439439_0020663 3300041406 Bacteria 1638
159 Ga0439447_132115 3300041407 Bacteria 573
160 Ga0439453_0032064 3300041408 Bacteria 1000
161 Ga0439461_0178905 3300041410 Bacteria 561
162 Ga0439465_0169687 3300041413 Bacteria 786
163 Ga0439465_0187837 3300041413 Bacteria 749
164 Ga0451787_830539 3300041441 Bacteria 1981
165 Ga0451791_0095703 3300041451 Bacteria 3468
166 Ga0451791_0848590 3300041451 Bacteria 595
167 Ga0451797_0076851 3300041453 Bacteria 1642
168 Ga0451802_1056484 3300041460 Bacteria 3133
169 Ga0451807_0109105 3300041486 Bacteria 4280
170 Ga0451837_1564070 3300041494 Bacteria 2654
171 Ga0451851_0035125 3300041507 Bacteria 707
172 Ga0451843_0161141 3300041509 Bacteria 1419
173 Ga0451843_0285023 3300041509 Bacteria 4328
174 Ga0451843_0590293 3300041509 Bacteria 1349
175 Ga0451853_0128985 3300041512 Bacteria 1521
176 Ga0439433_0029027 3300041999 Bacteria 1261
177 Ga0439433_0034807 3300041999 Bacteria 1160
178 Ga0439445_0010779 3300042004 Bacteria 2170
179 Ga0439449_0014511 3300042007 Bacteria 2961
180 Ga0439449_0029288 3300042007 Bacteria 2052
181 Ga0439449_0348991 3300042007 Bacteria 560
182 Ga0439446_0129270 3300042156 Bacteria 818
183 Ga0439434_0079723 3300042435 Bacteria 1038
184 Ga0451577_0015521 3300042876 Bacteria 7084
185 Ga0451577_0940283 3300042876 Bacteria 777
186 Ga0439440_0010607 3300042993 Bacteria 1929
187 Ga0466972_0214458 3300044658 Bacteria 901
188 Ga0453684_0000449 3300044712 Bacteria 166164
189 Ga0466959_0017499 3300045049 Bacteria 5255
190 Ga0451576_0000167 3300045051 Bacteria 166164
191 Ga0466967_0202466 3300045976 Bacteria 1881
192 Ga0495627_086129 3300046453 Bacteria 906
193 Ga0495638_0014162 3300046460 Bacteria 5400
194 Ga0495638_0125357 3300046460 Bacteria 1514
195 Ga0495663_0015338 3300046525 Bacteria 2157
196 Ga0495654_0120381 3300046530 Bacteria 1189
197 Ga0495598_0286316 3300046537 Bacteria 620
198 Ga0495621_0017507 3300046539 Bacteria 2317
199 Ga0495621_0293119 3300046539 Bacteria 673
200 Ga0495633_0007145 3300046558 Bacteria 6478
201 Ga0495656_0005285 3300046615 Bacteria 4449
202 Ga0495656_0023647 3300046615 Bacteria 2420
203 Ga0495656_0171258 3300046615 Bacteria 1062
204 Ga0495625_0067054 3300046660 Bacteria 2527
205 Ga0495658_0183753 3300046683 Bacteria 1298
206 Ga0495671_0054353 3300046692 Bacteria 1985
207 Ga0495636_0008335 3300047318 Bacteria 4092
208 Ga0495636_0083224 3300047318 Bacteria 1381
209 Ga0495615_0014198 3300048090 Bacteria 1679
210 Ga0496101_0225522 3300048904 Bacteria 1455
211 Ga0496101_0553775 3300048904 Bacteria 909
212 Ga0496102_0115911 3300048905 Bacteria 2500
213 Ga0496106_0129284 3300048909 Bacteria 1980
214 Ga0496107_0098749 3300048910 Bacteria 2139
215 Ga0496108_1551323 3300048911 Bacteria 549
216 Ga0496109_0336078 3300048912 Bacteria 1426
217 Ga0496109_0885623 3300048912 Bacteria 830
218 Ga0496110_0645054 3300048913 Bacteria 958
219 Ga0496111_0341973 3300048914 Bacteria 1107
220 Ga0496111_0366096 3300048914 Bacteria 1067
221 Ga0496112_1324541 3300048915 Bacteria 635
222 Ga0496113_0146861 3300048916 Bacteria 1858
223 Ga0496117_0063564 3300048920 Bacteria 2522
224 Ga0496118_0020270 3300048921 Bacteria 5901
225 Ga0496121_0013633 3300048924 Bacteria 8715
226 Ga0501031_0721998 3300049568 Bacteria 639
227 Ga0501034_0011868 3300049571 Bacteria 9014
228 Ga0501037_0322492 3300049573 Bacteria 1069
229 Ga0501038_0455255 3300049574 Bacteria 983
230 Ga0501043_0005027 3300049579 Bacteria 10703
231 Ga0501043_0291689 3300049579 Bacteria 1248
232 Ga0501046_0057318 3300049580 Bacteria 3056
233 Ga0501047_0059405 3300049581 Bacteria 3691
234 Ga0501048_0473821 3300049582 Bacteria 897
235 Ga0501070_0079752 3300049586 Bacteria 2709
236 Ga0501070_0204844 3300049586 Bacteria 1620
237 Ga0501198_049501 3300049649 Bacteria 746
238 Ga0501239_019723 3300049672 Bacteria 819
239 Ga0501242_009864 3300049674 Bacteria 1135
240 Ga0501250_005524 3300049680 Bacteria 1302
241 Ga0501252_007209 3300049682 Bacteria 1255
242 Ga0501257_097871 3300049686 Bacteria 768
243 Ga0501257_130351 3300049686 Bacteria 680
244 Ga0501080_0195134 3300049742 Bacteria 1860
245 Ga0501266_003916 3300049763 Bacteria 1843
246 Ga0501035_0210726 3300049822 Bacteria 1662
247 Ga0501045_1027648 3300049824 Bacteria 604
248 nmdc:mga00v17_26941_c1 3300050491 Bacteria 3353
249 nmdc:mga00v17_8438_c1 3300050491 Bacteria 5545
250 nmdc:mga0yw44_713503_c1 3300050492 Bacteria 681
251 Ga0500646_0100600 3300053090 Bacteria 907
252 Ga0500634_0000146 3300053161 Bacteria 25568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10128899 rootH2_101288991 158
2 3300009176 Ga0105242_10738019 Ga0105242_107380192 161
3 3300013297 Ga0157378_10008402 Ga0157378_1000840214 161
4 3300025936 Ga0207670_10220286 Ga0207670_102202861 161
5 iso_pu_bacteria 2919675420 2919678633 161
6 iso_pu_bacteria 2941489479 2941489514 162
7 iso_pu_bacteria 2995948881 2995950959 162
8 3300002773 JGI25152J39213_1000473 JGI25152J39213_100047324 163
9 3300002774 JGI25150J39212_1002148 JGI25150J39212_10021483 163
10 3300003187 JGI25151J46595_10000207 JGI25151J46595_1000020744 163
11 3300003187 JGI25151J46595_10048717 JGI25151J46595_100487172 163
12 3300003215 JGI25153J46596_10000146 JGI25153J46596_1000014644 163
13 3300003502 JGI26143J51219_1000645 JGI26143J51219_10006452 163
14 3300003771 Ga0055526_1003663 Ga0055526_100366312 163
15 3300003773 Ga0055537_1001391 Ga0055537_100139112 163
16 3300003775 Ga0055524_1002744 Ga0055524_100274411 163
17 3300003775 Ga0055524_1025757 Ga0055524_10257572 163
18 3300003775 Ga0055524_1053901 Ga0055524_10539011 163
19 3300003781 Ga0055536_1031165 Ga0055536_10311652 163
20 3300003781 Ga0055536_1040628 Ga0055536_10406282 163
21 3300003784 Ga0055534_1001405 Ga0055534_100140512 163
22 3300003790 Ga0055528_1002571 Ga0055528_100257112 163
23 3300003791 Ga0055530_10003846 Ga0055530_100038466 163
24 3300003794 Ga0055531_10027102 Ga0055531_100271022 163
25 3300003794 Ga0055531_10064121 Ga0055531_100641211 163
26 3300005288 Ga0065714_10116058 Ga0065714_101160582 163
27 3300005293 Ga0065715_10005148 Ga0065715_100051487 163
28 3300005293 Ga0065715_10093422 Ga0065715_100934224 163
29 3300005331 Ga0070670_101098513 Ga0070670_1010985131 163
30 3300005334 Ga0068869_100315015 Ga0068869_1003150153 163
31 3300005338 Ga0068868_100461806 Ga0068868_1004618062 163
32 3300005345 Ga0070692_10243402 Ga0070692_102434021 163
33 3300005353 Ga0070669_100008137 Ga0070669_1000081378 163
34 3300005353 Ga0070669_100259591 Ga0070669_1002595912 163
35 3300005355 Ga0070671_100582017 Ga0070671_1005820172 163
36 3300005367 Ga0070667_100290052 Ga0070667_1002900521 163
37 3300005459 Ga0068867_100346098 Ga0068867_1003460982 163
38 3300005530 Ga0070679_100036169 Ga0070679_1000361693 163
39 3300005543 Ga0070672_100031590 Ga0070672_1000315903 163
40 3300005546 Ga0070696_100015298 Ga0070696_1000152982 163
41 3300005548 Ga0070665_100382035 Ga0070665_1003820352 163
42 3300005577 Ga0068857_100831703 Ga0068857_1008317032 163
43 3300005616 Ga0068852_100111956 Ga0068852_1001119562 163
44 3300006051 Ga0075364_10007377 Ga0075364_100073773 163
45 3300006051 Ga0075364_10343973 Ga0075364_103439732 163
46 3300006881 Ga0068865_100137165 Ga0068865_1001371652 163
47 3300006948 Ga0099826_10220995 Ga0099826_102209951 163
48 3300009177 Ga0105248_10015868 Ga0105248_100158685 163
49 3300010375 Ga0105239_10099711 Ga0105239_100997113 163
50 3300012512 Ga0157327_1009402 Ga0157327_10094022 163
51 3300013102 Ga0157371_10122627 Ga0157371_101226273 163
52 3300013306 Ga0163162_10752824 Ga0163162_107528241 163
53 3300013307 Ga0157372_10199011 Ga0157372_101990111 163
54 3300013308 Ga0157375_10001135 Ga0157375_100011355 163
55 3300013308 Ga0157375_10378681 Ga0157375_103786812 163
56 3300014326 Ga0157380_11389709 Ga0157380_113897091 163
57 3300015689 Ga0183360_10001 Ga0183360_100012163 163
58 3300021384 Ga0213876_10282232 Ga0213876_102822321 163
59 3300025263 Ga0209565_1000001 Ga0209565_10000011657 163
60 3300025273 Ga0209673_1000001 Ga0209673_10000011657 163
61 3300025273 Ga0209673_1016502 Ga0209673_10165022 163
62 3300025284 Ga0209130_1017777 Ga0209130_10177773 163
63 3300025291 Ga0209675_1000001 Ga0209675_1000001876 163
64 3300025291 Ga0209675_1039508 Ga0209675_10395081 163
65 3300025292 Ga0209676_1001959 Ga0209676_10019598 163
66 3300025292 Ga0209676_1002221 Ga0209676_100222114 163
67 3300025292 Ga0209676_1005514 Ga0209676_10055142 163
68 3300025292 Ga0209676_1005762 Ga0209676_10057624 163
69 3300025294 Ga0209025_1003316 Ga0209025_10033168 163
70 3300025294 Ga0209025_1004873 Ga0209025_10048738 163
71 3300025294 Ga0209025_1125027 Ga0209025_11250271 163
72 3300025295 Ga0209564_1000001 Ga0209564_10000011038 163
73 3300025295 Ga0209564_1015193 Ga0209564_10151932 163
74 3300025295 Ga0209564_1024724 Ga0209564_10247242 163
75 3300025297 Ga0209758_1028855 Ga0209758_10288552 163
76 3300025298 Ga0209050_1001726 Ga0209050_100172612 163
77 3300025299 Ga0209256_1000002 Ga0209256_1000002515 163
78 3300025299 Ga0209256_1002458 Ga0209256_10024588 163
79 3300025299 Ga0209256_1012336 Ga0209256_10123362 163
80 3300025299 Ga0209256_1023567 Ga0209256_10235672 163
81 3300025303 Ga0209051_1010157 Ga0209051_10101575 163
82 3300025304 Ga0209257_1000148 Ga0209257_1000148155 163
83 3300025304 Ga0209257_1000243 Ga0209257_1000243102 163
84 3300025304 Ga0209257_1000580 Ga0209257_10005808 163
85 3300025304 Ga0209257_1027316 Ga0209257_10273162 163
86 3300025304 Ga0209257_1028226 Ga0209257_10282261 163
87 3300025921 Ga0207652_10119941 Ga0207652_101199412 163
88 3300025923 Ga0207681_10005866 Ga0207681_100058667 163
89 3300025923 Ga0207681_10232217 Ga0207681_102322172 163
90 3300025925 Ga0207650_11169974 Ga0207650_111699741 163
91 3300025933 Ga0207706_10247891 Ga0207706_102478912 163
92 3300025935 Ga0207709_10283893 Ga0207709_102838932 163
93 3300025938 Ga0207704_10111728 Ga0207704_101117282 163
94 3300025940 Ga0207691_10014083 Ga0207691_100140839 163
95 3300025941 Ga0207711_10016272 Ga0207711_100162723 163
96 3300025942 Ga0207689_10323410 Ga0207689_103234101 163
97 3300025981 Ga0207640_10006775 Ga0207640_100067752 163
98 3300026041 Ga0207639_10413995 Ga0207639_104139952 163
99 3300026089 Ga0207648_10452949 Ga0207648_104529492 163
100 3300026118 Ga0207675_100868337 Ga0207675_1008683372 163
101 3300026142 Ga0207698_10121747 Ga0207698_101217473 163
102 3300027360 Ga0209969_1015055 Ga0209969_10150552 163
103 3300027424 Ga0209984_1024165 Ga0209984_10241651 163
104 3300027462 Ga0210000_1008401 Ga0210000_10084012 163
105 3300027543 Ga0209999_1000163 Ga0209999_10001639 163
106 3300027552 Ga0209982_1001492 Ga0209982_10014922 163
107 3300027614 Ga0209970_1005255 Ga0209970_10052552 163
108 3300027617 Ga0210002_1053217 Ga0210002_10532172 163
109 3300027665 Ga0209983_1002158 Ga0209983_10021583 163
110 3300027682 Ga0209971_1001646 Ga0209971_10016465 163
111 3300027876 Ga0209974_10046370 Ga0209974_100463702 163
112 3300027876 Ga0209974_10138135 Ga0209974_101381352 163
113 3300028379 Ga0268266_10895013 Ga0268266_108950132 163
114 3300031665 Ga0316575_10009054 Ga0316575_100090544 163
115 3300031731 Ga0307405_10379462 Ga0307405_103794622 163
116 3300031824 Ga0307413_10047172 Ga0307413_100471722 163
117 3300031824 Ga0307413_10146889 Ga0307413_101468892 163
118 3300031824 Ga0307413_10284241 Ga0307413_102842412 163
119 3300031824 Ga0307413_10357560 Ga0307413_103575601 163
120 3300031852 Ga0307410_10055360 Ga0307410_100553603 163
121 3300031852 Ga0307410_10303348 Ga0307410_103033482 163
122 3300031911 Ga0307412_10271952 Ga0307412_102719522 163
123 3300031911 Ga0307412_10347245 Ga0307412_103472452 163
124 3300031911 Ga0307412_10486934 Ga0307412_104869342 163
125 3300031911 Ga0307412_10529241 Ga0307412_105292412 163
126 3300031911 Ga0307412_10732095 Ga0307412_107320952 163
127 3300031995 Ga0307409_100329273 Ga0307409_1003292732 163
128 3300031995 Ga0307409_100643053 Ga0307409_1006430532 163
129 3300032004 Ga0307414_10004112 Ga0307414_100041124 163
130 3300032004 Ga0307414_10006987 Ga0307414_100069874 163
131 3300032004 Ga0307414_10061072 Ga0307414_100610723 163
132 3300032004 Ga0307414_10105629 Ga0307414_101056292 163
133 3300032004 Ga0307414_10107448 Ga0307414_101074482 163
134 3300032004 Ga0307414_10243397 Ga0307414_102433972 163
135 3300032004 Ga0307414_10395357 Ga0307414_103953572 163
136 3300032004 Ga0307414_10700243 Ga0307414_107002432 163
137 3300032004 Ga0307414_10709872 Ga0307414_107098721 163
138 3300032004 Ga0307414_11132846 Ga0307414_111328462 163
139 3300032004 Ga0307414_11407316 Ga0307414_114073161 163
140 3300032005 Ga0307411_10184965 Ga0307411_101849652 163
141 3300032005 Ga0307411_10494313 Ga0307411_104943132 163
142 3300032126 Ga0307415_100100734 Ga0307415_1001007342 163
143 3300032126 Ga0307415_100573193 Ga0307415_1005731932 163
144 3300037418 Ga0395900_0098070 Ga0395900_0098070_405_902 163
145 3300037418 Ga0395900_0115206 Ga0395900_0115206_1990_2487 163
146 3300037466 Ga0395898_0168879 Ga0395898_0168879_891_1388 163
147 3300037466 Ga0395898_0177805 Ga0395898_0177805_1035_1532 163
148 3300037466 Ga0395898_0405794 Ga0395898_0405794_219_716 163
149 3300037466 Ga0395898_1461963 Ga0395898_1461963_83_580 163
150 3300037471 Ga0395905_0004109 Ga0395905_0004109_6317_6814 163
151 3300037471 Ga0395905_0054021 Ga0395905_0054021_2438_2935 163
152 3300037471 Ga0395905_0065835 Ga0395905_0065835_2521_3018 163
153 3300037471 Ga0395905_0071842 Ga0395905_0071842_555_1052 163
154 3300037471 Ga0395905_0804027 Ga0395905_0804027_233_730 163
155 3300037471 Ga0395905_1324624 Ga0395905_1324624_106_603 163
156 3300038443 Ga0395901_0002348 Ga0395901_0002348_215_712 163
157 3300039437 Ga0436365_1442156 Ga0436365_1442156_721_1233 163
158 3300041404 Ga0439436_0004649 Ga0439436_0004649_1391_1891 163
159 3300041404 Ga0439436_0006144 Ga0439436_0006144_2669_3169 163
160 3300041404 Ga0439436_0011214 Ga0439436_0011214_947_1444 163
161 3300041406 Ga0439439_0020663 Ga0439439_0020663_132_629 163
162 3300041407 Ga0439447_132115 Ga0439447_132115_18_515 163
163 3300041408 Ga0439453_0032064 Ga0439453_0032064_65_562 163
164 3300041410 Ga0439461_0178905 Ga0439461_0178905_40_537 163
165 3300041413 Ga0439465_0169687 Ga0439465_0169687_62_562 163
166 3300041413 Ga0439465_0187837 Ga0439465_0187837_218_718 163
167 3300041441 Ga0451787_830539 Ga0451787_830539_1462_1959 163
168 3300041451 Ga0451791_0095703 Ga0451791_0095703_1009_1506 163
169 3300041451 Ga0451791_0848590 Ga0451791_0848590_14_517 163
170 3300041453 Ga0451797_0076851 Ga0451797_0076851_818_1315 163
171 3300041460 Ga0451802_1056484 Ga0451802_1056484_1000_1497 163
172 3300041486 Ga0451807_0109105 Ga0451807_0109105_1157_1654 163
173 3300041494 Ga0451837_1564070 Ga0451837_1564070_460_963 163
174 3300041507 Ga0451851_0035125 Ga0451851_0035125_106_603 163
175 3300041509 Ga0451843_0161141 Ga0451843_0161141_778_1275 163
176 3300041509 Ga0451843_0285023 Ga0451843_0285023_112_606 163
177 3300041509 Ga0451843_0590293 Ga0451843_0590293_102_599 163
178 3300041512 Ga0451853_0128985 Ga0451853_0128985_52_549 163
179 3300041999 Ga0439433_0029027 Ga0439433_0029027_126_725 163
180 3300041999 Ga0439433_0034807 Ga0439433_0034807_365_862 163
181 3300042004 Ga0439445_0010779 Ga0439445_0010779_315_914 163
182 3300042007 Ga0439449_0014511 Ga0439449_0014511_1737_2234 163
183 3300042007 Ga0439449_0029288 Ga0439449_0029288_679_1191 163
184 3300042007 Ga0439449_0348991 Ga0439449_0348991_47_544 163
185 3300042156 Ga0439446_0129270 Ga0439446_0129270_41_562 163
186 3300042435 Ga0439434_0079723 Ga0439434_0079723_78_575 163
187 3300042876 Ga0451577_0015521 Ga0451577_0015521_5561_6064 163
188 3300042876 Ga0451577_0940283 Ga0451577_0940283_25_534 163
189 3300042993 Ga0439440_0010607 Ga0439440_0010607_1205_1705 163
190 3300044658 Ga0466972_0214458 Ga0466972_0214458_382_879 163
191 3300044712 Ga0453684_0000449 Ga0453684_0000449_9888_10397 163
192 3300045049 Ga0466959_0017499 Ga0466959_0017499_528_1046 163
193 3300045051 Ga0451576_0000167 Ga0451576_0000167_9888_10397 163
194 3300045976 Ga0466967_0202466 Ga0466967_0202466_197_697 163
195 3300046453 Ga0495627_086129 Ga0495627_086129_346_840 163
196 3300046460 Ga0495638_0014162 Ga0495638_0014162_1093_1590 163
197 3300046460 Ga0495638_0125357 Ga0495638_0125357_242_742 163
198 3300046525 Ga0495663_0015338 Ga0495663_0015338_409_978 163
199 3300046530 Ga0495654_0120381 Ga0495654_0120381_287_856 163
200 3300046537 Ga0495598_0286316 Ga0495598_0286316_84_581 163
201 3300046539 Ga0495621_0017507 Ga0495621_0017507_714_1211 163
202 3300046539 Ga0495621_0293119 Ga0495621_0293119_23_529 163
203 3300046558 Ga0495633_0007145 Ga0495633_0007145_5602_6096 163
204 3300046615 Ga0495656_0005285 Ga0495656_0005285_3432_3932 163
205 3300046615 Ga0495656_0023647 Ga0495656_0023647_1418_1930 163
206 3300046615 Ga0495656_0171258 Ga0495656_0171258_295_792 163
207 3300046660 Ga0495625_0067054 Ga0495625_0067054_1826_2395 163
208 3300046683 Ga0495658_0183753 Ga0495658_0183753_55_564 163
209 3300046692 Ga0495671_0054353 Ga0495671_0054353_532_1101 163
210 3300047318 Ga0495636_0008335 Ga0495636_0008335_2709_3209 163
211 3300047318 Ga0495636_0083224 Ga0495636_0083224_84_596 163
212 3300048090 Ga0495615_0014198 Ga0495615_0014198_664_1161 163
213 3300048904 Ga0496101_0225522 Ga0496101_0225522_392_904 163
214 3300048904 Ga0496101_0553775 Ga0496101_0553775_140_637 163
215 3300048905 Ga0496102_0115911 Ga0496102_0115911_1821_2333 163
216 3300048909 Ga0496106_0129284 Ga0496106_0129284_280_792 163
217 3300048910 Ga0496107_0098749 Ga0496107_0098749_311_823 163
218 3300048911 Ga0496108_1551323 Ga0496108_1551323_20_532 163
219 3300048912 Ga0496109_0336078 Ga0496109_0336078_760_1263 163
220 3300048912 Ga0496109_0885623 Ga0496109_0885623_258_770 163
221 3300048913 Ga0496110_0645054 Ga0496110_0645054_202_714 163
222 3300048914 Ga0496111_0341973 Ga0496111_0341973_216_728 163
223 3300048914 Ga0496111_0366096 Ga0496111_0366096_408_905 163
224 3300048915 Ga0496112_1324541 Ga0496112_1324541_48_545 163
225 3300048916 Ga0496113_0146861 Ga0496113_0146861_761_1258 163
226 3300048920 Ga0496117_0063564 Ga0496117_0063564_710_1231 163
227 3300048921 Ga0496118_0020270 Ga0496118_0020270_2819_3340 163
228 3300048924 Ga0496121_0013633 Ga0496121_0013633_194_718 163
229 3300049568 Ga0501031_0721998 Ga0501031_0721998_113_619 163
230 3300049571 Ga0501034_0011868 Ga0501034_0011868_1175_1669 163
231 3300049573 Ga0501037_0322492 Ga0501037_0322492_550_1044 163
232 3300049574 Ga0501038_0455255 Ga0501038_0455255_65_571 163
233 3300049579 Ga0501043_0005027 Ga0501043_0005027_9448_9948 163
234 3300049579 Ga0501043_0291689 Ga0501043_0291689_259_765 163
235 3300049580 Ga0501046_0057318 Ga0501046_0057318_2482_2988 163
236 3300049581 Ga0501047_0059405 Ga0501047_0059405_1132_1638 163
237 3300049582 Ga0501048_0473821 Ga0501048_0473821_71_577 163
238 3300049586 Ga0501070_0079752 Ga0501070_0079752_749_1264 163
239 3300049586 Ga0501070_0204844 Ga0501070_0204844_495_1004 163
240 3300049649 Ga0501198_049501 Ga0501198_049501_181_678 163
241 3300049672 Ga0501239_019723 Ga0501239_019723_236_733 163
242 3300049674 Ga0501242_009864 Ga0501242_009864_60_557 163
243 3300049680 Ga0501250_005524 Ga0501250_005524_47_589 163
244 3300049682 Ga0501252_007209 Ga0501252_007209_40_537 163
245 3300049686 Ga0501257_097871 Ga0501257_097871_253_750 163
246 3300049686 Ga0501257_130351 Ga0501257_130351_66_572 163
247 3300049742 Ga0501080_0195134 Ga0501080_0195134_630_1145 163
248 3300049763 Ga0501266_003916 Ga0501266_003916_151_648 163
249 3300049822 Ga0501035_0210726 Ga0501035_0210726_324_830 163
250 3300049824 Ga0501045_1027648 Ga0501045_1027648_93_593 163
251 3300050491 nmdc:mga00v17_26941_c1 nmdc:mga00v17_26941_c1_319_831 163
252 3300050491 nmdc:mga00v17_8438_c1 nmdc:mga00v17_8438_c1_414_914 163
253 3300050492 nmdc:mga0yw44_713503_c1 nmdc:mga0yw44_713503_c1_93_605 163
254 3300053090 Ga0500646_0100600 Ga0500646_0100600_395_892 163
255 3300053161 Ga0500634_0000146 Ga0500634_0000146_16660_17154 163
256 iso_pu_bacteria 8002869464 8002872646 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02464

CinA

Competence-damaged protein

44

199

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kvk-assembly1.cif.gz_A-2 crystal structure of the competence-damaged protein (cina) superfamily protein kp700603 from klebsiella pneumoniae 700603 0.9732 8 161
5v01-assembly1.cif.gz_B crystal structure of the competence damage-inducible protein a (coma) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9725 8 161
5vu3-assembly3.cif.gz_E crystal structure of the competence-damaged protein (cina) superfamily protein ecl_02051 from enterobacter cloacae 0.9657 8 161
6l19-assembly1.cif.gz_B the crystal structure of competence or damage-inducible protein from enterobacter asburiae 0.9534 8 163
2a9s-assembly1.cif.gz_B the crystal structure of competence/damage inducible protein ciha from agrobacterium tumefaciens 0.9462 1 162
ID Description Score Start End Superfamily
af_P0A6G3_1_161_3.90.950.20 Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like 0.9826 3 163 3.90.950.20
af_P0A6G3_1_161_3.90.950.20 Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like 0.9766 3 163 3.90.950.20
af_P9WPE3_267_424_3.90.950.20 Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like 0.961 12 159 3.90.950.20
5vu3A00 Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like 0.95 8 163 3.90.950.20
2a9sB00 Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like 0.9462 1 162 3.90.950.20
ID Description Score Start End GO Terms
AF-A0A7G3F4D3-F1-model_v4 deleted 0.9971 8 105
AF-A0A7V5G4W5-F1-model_v4 CinA family protein 0.9947 8 88
AF-A0A522RSE5-F1-model_v4 CinA family protein 0.9938 1 159
AF-A0A0H4T861-F1-model_v4 CinA-like protein 0.9931 3 162
AF-A0A3D0SRQ1-F1-model_v4 Nicotinamide-nucleotide amidase 0.9928 1 161

Feature Viewer

pLDDT pTM Quality
95.06 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map