F366518

General Info

Members Datasets Scaffolds Average Seq Length
256 164 512 140

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10041075|Ga0157380_100410754
Length 151
Sequence MIGMEILKPVVVLAAWTMVMWVWMYATRIPAMNRAKIDTNSLTGGTGKNLDDVLEPSVQWKAHNYNHLHEAPTVFYAVAIVLAILGAGDGVNTLLGWIYVGLRVLHSLIQATVNRVMVRFLVFALSSIVLMVLIFHAAIGVFDMHAVMVDR

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
113 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
116 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
117 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
118 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
119 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
162 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 2895880812 Frankia sp. BMG5.11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.64
Nodule 0
Rhizoplane 1.17
Rhizosphere 89.84
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10041075 3300014326 Bacteria 3608
2 JGI24751J29686_10000356 3300002459 Bacteria 16145
3 JGI24751J29686_10006020 3300002459 Bacteria 2471
4 JGI24751J29686_10041944 3300002459 Bacteria 946
5 Ga0070658_10002463 3300005327 Bacteria 15467
6 Ga0070658_10127411 3300005327 Bacteria 2120
7 Ga0070658_10521691 3300005327 Bacteria 1027
8 Ga0070683_100100452 3300005329 Bacteria 2723
9 Ga0068869_100584483 3300005334 Bacteria 942
10 Ga0070666_10025859 3300005335 Bacteria 3829
11 Ga0070666_10345414 3300005335 Bacteria 1064
12 Ga0070680_100011723 3300005336 Bacteria 6795
13 Ga0070680_100126413 3300005336 Bacteria 2136
14 Ga0070680_100552653 3300005336 Unclassified 987
15 Ga0070660_100168229 3300005339 Bacteria 1769
16 Ga0070689_100354879 3300005340 Bacteria 1231
17 Ga0070661_100098741 3300005344 Bacteria 2169
18 Ga0070661_100407061 3300005344 Bacteria 1076
19 Ga0070668_101776623 3300005347 Bacteria 567
20 Ga0070659_100058895 3300005366 Bacteria 3032
21 Ga0070659_100414156 3300005366 Bacteria 1139
22 Ga0070659_101079877 3300005366 Bacteria 707
23 Ga0070701_10010513 3300005438 Bacteria 4094
24 Ga0070701_10935132 3300005438 Bacteria 601
25 Ga0070705_100191665 3300005440 Bacteria 1394
26 Ga0070705_100792393 3300005440 Unclassified 753
27 Ga0070700_100067540 3300005441 Bacteria 2271
28 Ga0070700_100176862 3300005441 Unclassified 1482
29 Ga0070700_101076314 3300005441 Bacteria 665
30 Ga0070694_100029787 3300005444 Bacteria 3565
31 Ga0070708_100465080 3300005445 Bacteria 1193
32 Ga0070678_100651044 3300005456 Bacteria 945
33 Ga0070662_100036616 3300005457 Bacteria 3472
34 Ga0070662_100041180 3300005457 Bacteria 3294
35 Ga0070681_10021444 3300005458 Bacteria 6477
36 Ga0070681_10710617 3300005458 Bacteria 921
37 Ga0070706_100154113 3300005467 Bacteria 2145
38 Ga0070679_100009662 3300005530 Bacteria 9124
39 Ga0070679_100932867 3300005530 Bacteria 812
40 Ga0070679_101402517 3300005530 Bacteria 645
41 Ga0070684_100102658 3300005535 Bacteria 2557
42 Ga0068853_100007079 3300005539 Bacteria 8972
43 Ga0068853_101370869 3300005539 Bacteria 684
44 Ga0070686_100061645 3300005544 Bacteria 2424
45 Ga0070696_101758344 3300005546 Unclassified 535
46 Ga0070665_100127708 3300005548 Bacteria 2545
47 Ga0070704_100046663 3300005549 Bacteria 3023
48 Ga0068855_100019437 3300005563 Bacteria 8162
49 Ga0068855_100042642 3300005563 Bacteria 5376
50 Ga0068855_100352239 3300005563 Bacteria 1622
51 Ga0070664_100493933 3300005564 Bacteria 1127
52 Ga0068857_100027663 3300005577 Bacteria 5002
53 Ga0068857_100031565 3300005577 Bacteria 4682
54 Ga0068857_100183356 3300005577 Bacteria 1905
55 Ga0068854_100001993 3300005578 Bacteria 12497
56 Ga0068854_100002051 3300005578 Bacteria 12337
57 Ga0068854_100827562 3300005578 Bacteria 809
58 Ga0068856_100012926 3300005614 Bacteria 8081
59 Ga0068852_100097085 3300005616 Bacteria 2650
60 Ga0068852_100563300 3300005616 Bacteria 1141
61 Ga0068859_100028875 3300005617 Bacteria 5563
62 Ga0068859_101030824 3300005617 Bacteria 904
63 Ga0068864_100893406 3300005618 Bacteria 877
64 Ga0068864_100950691 3300005618 Bacteria 850
65 Ga0068861_100112788 3300005719 Bacteria 2181
66 Ga0068863_100016336 3300005841 Bacteria 7122
67 Ga0068863_100283091 3300005841 Bacteria 1607
68 Ga0068858_100000279 3300005842 Bacteria 55120
69 Ga0075364_10165224 3300006051 Bacteria 1495
70 Ga0075362_10000093 3300006177 Bacteria 24981
71 Ga0075362_10010961 3300006177 Bacteria 3559
72 Ga0075369_10061121 3300006186 Bacteria 1644
73 Ga0075369_10094105 3300006186 Bacteria 1339
74 Ga0075366_10608004 3300006195 Bacteria 678
75 Ga0075370_10000056 3300006353 Bacteria 33386
76 Ga0075428_100032267 3300006844 Bacteria 5784
77 Ga0075428_100376035 3300006844 Bacteria 1523
78 Ga0075430_100070781 3300006846 Bacteria 2925
79 Ga0068865_100135966 3300006881 Bacteria 1847
80 Ga0097620_100028875 3300006931 Bacteria 5563
81 Ga0097620_101030982 3300006931 Bacteria 904
82 Ga0111539_10009104 3300009094 Bacteria 12568
83 Ga0111539_10336061 3300009094 Bacteria 1758
84 Ga0111539_12332065 3300009094 Bacteria 621
85 Ga0114129_10889723 3300009147 Bacteria 1129
86 Ga0105241_10019609 3300009174 Bacteria 4988
87 Ga0105242_10140581 3300009176 Bacteria 2094
88 Ga0105249_10413988 3300009553 Bacteria 1380
89 Ga0105246_10000210 3300011119 Bacteria 29575
90 Ga0157373_10002823 3300013100 Bacteria 13139
91 Ga0157373_10034952 3300013100 Bacteria 3610
92 Ga0157371_10071658 3300013102 Bacteria 2453
93 Ga0157371_10075532 3300013102 Bacteria 2386
94 Ga0157370_10006455 3300013104 Bacteria 12938
95 Ga0157370_11126679 3300013104 Bacteria 709
96 Ga0157369_10003247 3300013105 Bacteria 19370
97 Ga0157369_10737435 3300013105 Bacteria 1014
98 Ga0163162_10058271 3300013306 Bacteria 3891
99 Ga0157372_10092518 3300013307 Bacteria 3440
100 Ga0157372_10099666 3300013307 Bacteria 3314
101 Ga0157375_11691576 3300013308 Bacteria 749
102 Ga0157380_10096866 3300014326 Bacteria 2447
103 Ga0157377_10892592 3300014745 Archaea 664
104 Ga0207653_10109066 3300025885 Bacteria 987
105 Ga0207680_10480351 3300025903 Bacteria 884
106 Ga0207647_10114812 3300025904 Bacteria 1591
107 Ga0207705_10307744 3300025909 Bacteria 1216
108 Ga0207684_10295055 3300025910 Bacteria 1398
109 Ga0207707_10175296 3300025912 Bacteria 1873
110 Ga0207707_11104503 3300025912 Bacteria 646
111 Ga0207660_10151326 3300025917 Bacteria 1783
112 Ga0207660_10382653 3300025917 Bacteria 1131
113 Ga0207660_10402260 3300025917 Bacteria 1103
114 Ga0207657_10000081 3300025919 Bacteria 90714
115 Ga0207649_10434608 3300025920 Bacteria 988
116 Ga0207649_10487963 3300025920 Bacteria 935
117 Ga0207649_10674368 3300025920 Bacteria 800
118 Ga0207652_10571422 3300025921 Bacteria 1015
119 Ga0207652_10805461 3300025921 Bacteria 834
120 Ga0207650_10719670 3300025925 Bacteria 844
121 Ga0207690_10139193 3300025932 Bacteria 1786
122 Ga0207690_10214491 3300025932 Bacteria 1469
123 Ga0207706_10000735 3300025933 Bacteria 34128
124 Ga0207706_10020092 3300025933 Bacteria 6002
125 Ga0207686_10208104 3300025934 Bacteria 1405
126 Ga0207670_10291172 3300025936 Bacteria 1276
127 Ga0207704_10107642 3300025938 Bacteria 1876
128 Ga0207711_10948961 3300025941 Bacteria 799
129 Ga0207689_10335332 3300025942 Bacteria 1256
130 Ga0207689_10370393 3300025942 Bacteria 1192
131 Ga0207679_10191589 3300025945 Bacteria 1700
132 Ga0207667_10029818 3300025949 Bacteria 5910
133 Ga0207667_10033799 3300025949 Bacteria 5495
134 Ga0207667_10243285 3300025949 Bacteria 1841
135 Ga0207667_10530673 3300025949 Bacteria 1192
136 Ga0207667_11547594 3300025949 Bacteria 633
137 Ga0207668_11371892 3300025972 Bacteria 637
138 Ga0207640_10003032 3300025981 Bacteria 9041
139 Ga0207640_10114477 3300025981 Bacteria 1919
140 Ga0207703_10002076 3300026035 Bacteria 17618
141 Ga0207639_10064788 3300026041 Bacteria 2834
142 Ga0207639_11059665 3300026041 Bacteria 760
143 Ga0207708_10109306 3300026075 Bacteria 2145
144 Ga0207702_10033118 3300026078 Bacteria 4315
145 Ga0207641_10000179 3300026088 Bacteria 88061
146 Ga0207676_11090042 3300026095 Bacteria 789
147 Ga0207674_10102278 3300026116 Bacteria 2845
148 Ga0207674_10185388 3300026116 Bacteria 2031
149 Ga0207674_10291060 3300026116 Bacteria 1582
150 Ga0207675_100007804 3300026118 Bacteria 10096
151 Ga0207675_100853275 3300026118 Bacteria 926
152 Ga0207683_10625361 3300026121 Bacteria 997
153 Ga0207698_10140981 3300026142 Bacteria 2077
154 Ga0207698_10192856 3300026142 Bacteria 1817
155 Ga0209974_10325500 3300027876 Bacteria 592
156 Ga0268266_10130851 3300028379 Bacteria 2244
157 Ga0268265_10077336 3300028380 Bacteria 2613
158 Ga0307408_100099291 3300031548 Bacteria 2215
159 Ga0307408_100550870 3300031548 Bacteria 1018
160 Ga0307508_10079875 3300031616 Bacteria 2852
161 Ga0307516_10344331 3300031730 Bacteria 1157
162 Ga0307405_10000597 3300031731 Bacteria 13860
163 Ga0307405_10091489 3300031731 Bacteria 2016
164 Ga0307405_10148958 3300031731 Bacteria 1643
165 Ga0307413_10029573 3300031824 Bacteria 3067
166 Ga0307413_10178363 3300031824 Bacteria 1512
167 Ga0307413_10245454 3300031824 Bacteria 1325
168 Ga0307413_10643461 3300031824 Bacteria 873
169 Ga0307413_10676899 3300031824 Bacteria 854
170 Ga0307410_10123124 3300031852 Bacteria 1894
171 Ga0307410_10175505 3300031852 Bacteria 1618
172 Ga0307410_10238115 3300031852 Bacteria 1409
173 Ga0307406_10075394 3300031901 Bacteria 2225
174 Ga0307406_11845322 3300031901 Bacteria 538
175 Ga0307407_10147822 3300031903 Bacteria 1523
176 Ga0307412_10155683 3300031911 Bacteria 1691
177 Ga0307409_100260762 3300031995 Bacteria 1590
178 Ga0307409_100432040 3300031995 Bacteria 1266
179 Ga0307409_100485517 3300031995 Bacteria 1200
180 Ga0307416_100170637 3300032002 Bacteria 2024
181 Ga0307416_100468371 3300032002 Bacteria 1317
182 Ga0307414_10124622 3300032004 Bacteria 1988
183 Ga0307414_10127070 3300032004 Bacteria 1972
184 Ga0307414_10499936 3300032004 Bacteria 1075
185 Ga0307414_10595249 3300032004 Bacteria 991
186 Ga0307411_10095650 3300032005 Bacteria 2086
187 Ga0307411_10180760 3300032005 Bacteria 1600
188 Ga0307411_10381102 3300032005 Bacteria 1160
189 Ga0307415_100288877 3300032126 Bacteria 1353
190 Ga0307415_100483656 3300032126 Bacteria 1078
191 Ga0307415_101036562 3300032126 Bacteria 765
192 Ga0316583_10014145 3300032133 Bacteria 2878
193 Ga0373960_0052643 3300035121 Bacteria 1212
194 Ga0373935_0673376 3300035692 Bacteria 760
195 Ga0316582_0135775 3300036647 Bacteria 1655
196 Ga0316584_0425058 3300036712 Bacteria 943
197 Ga0316581_0100617 3300037588 Bacteria 890
198 Ga0439436_0157332 3300041404 Bacteria 642
199 Ga0451802_1182914 3300041460 Bacteria 762
200 Ga0451807_0927190 3300041486 Bacteria 832
201 Ga0451833_0426322 3300041491 Bacteria 657
202 Ga0451853_2887821 3300041512 Bacteria 1503
203 Ga0453684_0217302 3300044712 Bacteria 2217
204 Ga0451576_0000007 3300045051 Bacteria 782228
205 Ga0451576_0024319 3300045051 Bacteria 6543
206 Ga0495643_0041110 3300046522 Bacteria 2522
207 Ga0495643_0186787 3300046522 Bacteria 1003
208 Ga0495598_0096510 3300046537 Bacteria 972
209 Ga0495621_0047355 3300046539 Bacteria 1528
210 Ga0495656_0746638 3300046615 Bacteria 528
211 Ga0495636_0534581 3300047318 Bacteria 569
212 Ga0495615_0012140 3300048090 Bacteria 1769
213 Ga0496114_0041029 3300048917 Unclassified 3835
214 Ga0496126_0046792 3300048929 Bacteria 3964
215 Ga0501032_0011153 3300049569 Bacteria 6458
216 Ga0501032_0804657 3300049569 Bacteria 593
217 Ga0501033_0005387 3300049570 Bacteria 10138
218 Ga0501033_0050717 3300049570 Bacteria 3077
219 Ga0501034_0015835 3300049571 Bacteria 7743
220 Ga0501036_0215374 3300049572 Bacteria 1613
221 Ga0501036_1004601 3300049572 Bacteria 683
222 Ga0501036_1047998 3300049572 Bacteria 667
223 Ga0501038_0034876 3300049574 Bacteria 4421
224 Ga0501039_0052083 3300049575 Bacteria 3167
225 Ga0501043_0068445 3300049579 Bacteria 2787
226 Ga0501043_0503043 3300049579 Bacteria 905
227 Ga0501046_1247072 3300049580 Bacteria 509
228 Ga0501047_0510214 3300049581 Bacteria 1029
229 Ga0501047_0518628 3300049581 Bacteria 1018
230 Ga0501048_0395973 3300049582 Bacteria 987
231 Ga0501071_0179245 3300049587 Bacteria 1587
232 Ga0501072_1507286 3300049588 Bacteria 519
233 Ga0501074_0686455 3300049590 Bacteria 723
234 Ga0501075_1039815 3300049591 Bacteria 622
235 Ga0501076_0371489 3300049592 Bacteria 1175
236 Ga0501081_0182340 3300049743 Unclassified 1519
237 Ga0501035_0005118 3300049822 Bacteria 12415
238 Ga0501044_0006703 3300049823 Bacteria 12701
239 Ga0501044_0239069 3300049823 Bacteria 1760
240 nmdc:mga03683_37032_c1 3300050489 Bacteria 1987
241 nmdc:mga03683_64_c1 3300050489 Bacteria 40516
242 nmdc:mga03n38_162081_c1 3300050490 Bacteria 1133
243 nmdc:mga00v17_34701_c1 3300050491 Bacteria 2998
244 nmdc:mga0k408_150477_c1 3300050493 Bacteria 715
245 nmdc:mga06z11_15514_c1 3300050494 Bacteria 3402
246 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
247 nmdc:mga09592_72371_c1 3300050508 Bacteria 2927
248 nmdc:mga0qj67_62010_c1 3300050509 Bacteria 2970
249 nmdc:mga08y16_1156988_c1 3300050511 Bacteria 746
250 nmdc:mga08y16_267430_c1 3300050511 Unclassified 1765
251 nmdc:mga0a205_565318_c1 3300050515 Bacteria 992
252 nmdc:mga0sz30_144393_c1 3300050516 Bacteria 1051
253 nmdc:mga0sz30_83916_c1 3300050516 Bacteria 1381
254 Ga0500627_0000005 3300053158 Bacteria 167950
255 Ga0501082_0875205 3300060353 Unclassified 786
256 2895886005 2895880812 Bacteria 11255272
257 Ga0157380_10041075
258 JGI24751J29686_10000356
259 JGI24751J29686_10006020
260 JGI24751J29686_10041944
261 Ga0070658_10002463
262 Ga0070658_10127411
263 Ga0070658_10521691
264 Ga0070683_100100452
265 Ga0068869_100584483
266 Ga0070666_10025859
267 Ga0070666_10345414
268 Ga0070680_100011723
269 Ga0070680_100126413
270 Ga0070680_100552653
271 Ga0070660_100168229
272 Ga0070689_100354879
273 Ga0070661_100098741
274 Ga0070661_100407061
275 Ga0070668_101776623
276 Ga0070659_100058895
277 Ga0070659_100414156
278 Ga0070659_101079877
279 Ga0070701_10010513
280 Ga0070701_10935132
281 Ga0070705_100191665
282 Ga0070705_100792393
283 Ga0070700_100067540
284 Ga0070700_100176862
285 Ga0070700_101076314
286 Ga0070694_100029787
287 Ga0070708_100465080
288 Ga0070678_100651044
289 Ga0070662_100036616
290 Ga0070662_100041180
291 Ga0070681_10021444
292 Ga0070681_10710617
293 Ga0070706_100154113
294 Ga0070679_100009662
295 Ga0070679_100932867
296 Ga0070679_101402517
297 Ga0070684_100102658
298 Ga0068853_100007079
299 Ga0068853_101370869
300 Ga0070686_100061645
301 Ga0070696_101758344
302 Ga0070665_100127708
303 Ga0070704_100046663
304 Ga0068855_100019437
305 Ga0068855_100042642
306 Ga0068855_100352239
307 Ga0070664_100493933
308 Ga0068857_100027663
309 Ga0068857_100031565
310 Ga0068857_100183356
311 Ga0068854_100001993
312 Ga0068854_100002051
313 Ga0068854_100827562
314 Ga0068856_100012926
315 Ga0068852_100097085
316 Ga0068852_100563300
317 Ga0068859_100028875
318 Ga0068859_101030824
319 Ga0068864_100893406
320 Ga0068864_100950691
321 Ga0068861_100112788
322 Ga0068863_100016336
323 Ga0068863_100283091
324 Ga0068858_100000279
325 Ga0075364_10165224
326 Ga0075362_10000093
327 Ga0075362_10010961
328 Ga0075369_10061121
329 Ga0075369_10094105
330 Ga0075366_10608004
331 Ga0075370_10000056
332 Ga0075428_100032267
333 Ga0075428_100376035
334 Ga0075430_100070781
335 Ga0068865_100135966
336 Ga0097620_100028875
337 Ga0097620_101030982
338 Ga0111539_10009104
339 Ga0111539_10336061
340 Ga0111539_12332065
341 Ga0114129_10889723
342 Ga0105241_10019609
343 Ga0105242_10140581
344 Ga0105249_10413988
345 Ga0105246_10000210
346 Ga0157373_10002823
347 Ga0157373_10034952
348 Ga0157371_10071658
349 Ga0157371_10075532
350 Ga0157370_10006455
351 Ga0157370_11126679
352 Ga0157369_10003247
353 Ga0157369_10737435
354 Ga0163162_10058271
355 Ga0157372_10092518
356 Ga0157372_10099666
357 Ga0157375_11691576
358 Ga0157380_10096866
359 Ga0157377_10892592
360 Ga0207653_10109066
361 Ga0207680_10480351
362 Ga0207647_10114812
363 Ga0207705_10307744
364 Ga0207684_10295055
365 Ga0207707_10175296
366 Ga0207707_11104503
367 Ga0207660_10151326
368 Ga0207660_10382653
369 Ga0207660_10402260
370 Ga0207657_10000081
371 Ga0207649_10434608
372 Ga0207649_10487963
373 Ga0207649_10674368
374 Ga0207652_10571422
375 Ga0207652_10805461
376 Ga0207650_10719670
377 Ga0207690_10139193
378 Ga0207690_10214491
379 Ga0207706_10000735
380 Ga0207706_10020092
381 Ga0207686_10208104
382 Ga0207670_10291172
383 Ga0207704_10107642
384 Ga0207711_10948961
385 Ga0207689_10335332
386 Ga0207689_10370393
387 Ga0207679_10191589
388 Ga0207667_10029818
389 Ga0207667_10033799
390 Ga0207667_10243285
391 Ga0207667_10530673
392 Ga0207667_11547594
393 Ga0207668_11371892
394 Ga0207640_10003032
395 Ga0207640_10114477
396 Ga0207703_10002076
397 Ga0207639_10064788
398 Ga0207639_11059665
399 Ga0207708_10109306
400 Ga0207702_10033118
401 Ga0207641_10000179
402 Ga0207676_11090042
403 Ga0207674_10102278
404 Ga0207674_10185388
405 Ga0207674_10291060
406 Ga0207675_100007804
407 Ga0207675_100853275
408 Ga0207683_10625361
409 Ga0207698_10140981
410 Ga0207698_10192856
411 Ga0209974_10325500
412 Ga0268266_10130851
413 Ga0268265_10077336
414 Ga0307408_100099291
415 Ga0307408_100550870
416 Ga0307508_10079875
417 Ga0307516_10344331
418 Ga0307405_10000597
419 Ga0307405_10091489
420 Ga0307405_10148958
421 Ga0307413_10029573
422 Ga0307413_10178363
423 Ga0307413_10245454
424 Ga0307413_10643461
425 Ga0307413_10676899
426 Ga0307410_10123124
427 Ga0307410_10175505
428 Ga0307410_10238115
429 Ga0307406_10075394
430 Ga0307406_11845322
431 Ga0307407_10147822
432 Ga0307412_10155683
433 Ga0307409_100260762
434 Ga0307409_100432040
435 Ga0307409_100485517
436 Ga0307416_100170637
437 Ga0307416_100468371
438 Ga0307414_10124622
439 Ga0307414_10127070
440 Ga0307414_10499936
441 Ga0307414_10595249
442 Ga0307411_10095650
443 Ga0307411_10180760
444 Ga0307411_10381102
445 Ga0307415_100288877
446 Ga0307415_100483656
447 Ga0307415_101036562
448 Ga0316583_10014145
449 Ga0373960_0052643
450 Ga0373935_0673376
451 Ga0316582_0135775
452 Ga0316584_0425058
453 Ga0316581_0100617
454 Ga0439436_0157332
455 Ga0451802_1182914
456 Ga0451807_0927190
457 Ga0451833_0426322
458 Ga0451853_2887821
459 Ga0453684_0217302
460 Ga0451576_0000007
461 Ga0451576_0024319
462 Ga0495643_0041110
463 Ga0495643_0186787
464 Ga0495598_0096510
465 Ga0495621_0047355
466 Ga0495656_0746638
467 Ga0495636_0534581
468 Ga0495615_0012140
469 Ga0496114_0041029
470 Ga0496126_0046792
471 Ga0501032_0011153
472 Ga0501032_0804657
473 Ga0501033_0005387
474 Ga0501033_0050717
475 Ga0501034_0015835
476 Ga0501036_0215374
477 Ga0501036_1004601
478 Ga0501036_1047998
479 Ga0501038_0034876
480 Ga0501039_0052083
481 Ga0501043_0068445
482 Ga0501043_0503043
483 Ga0501046_1247072
484 Ga0501047_0510214
485 Ga0501047_0518628
486 Ga0501048_0395973
487 Ga0501071_0179245
488 Ga0501072_1507286
489 Ga0501074_0686455
490 Ga0501075_1039815
491 Ga0501076_0371489
492 Ga0501081_0182340
493 Ga0501035_0005118
494 Ga0501044_0006703
495 Ga0501044_0239069
496 nmdc:mga03683_37032_c1
497 nmdc:mga03683_64_c1
498 nmdc:mga03n38_162081_c1
499 nmdc:mga00v17_34701_c1
500 nmdc:mga0k408_150477_c1
501 nmdc:mga06z11_15514_c1
502 nmdc:mga07m45_3_c1
503 nmdc:mga09592_72371_c1
504 nmdc:mga0qj67_62010_c1
505 nmdc:mga08y16_1156988_c1
506 nmdc:mga08y16_267430_c1
507 nmdc:mga0a205_565318_c1
508 nmdc:mga0sz30_144393_c1
509 nmdc:mga0sz30_83916_c1
510 Ga0500627_0000005
511 Ga0501082_0875205
512 2895886005

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

6

139

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dww-assembly1.cif.gz_B electron crystallographic structure of human microsomal prostaglandin e synthase 1 0.6241 5 129
3dww-assembly1.cif.gz_B electron crystallographic structure of human microsomal prostaglandin e synthase 1 0.6027 5 129
5i9k-assembly1.cif.gz_A the structure of microsomal glutathione transferase 1 0.5969 3 129
4ntb-assembly1.cif.gz_A mus musculus ltc4 synthase in gsh complex form 0.5913 6 129
5i9k-assembly1.cif.gz_A the structure of microsomal glutathione transferase 1 0.5542 3 129
ID Description Score Start End Superfamily
5ia9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5969 3 129 1.20.120.550
4wabA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5812 3 129 1.20.120.550
af_A1A5Y1_7_139_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.571 1 129 1.20.120.550
4wabA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5655 3 129 1.20.120.550
5ia9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5542 3 129 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A7C2NR64-F1-model_v4 MAPEG family protein 0.9062 5 129 GO:0016020
AF-A0A0P7WSE7-F1-model_v4 MAPEG family 0.9038 4 129 GO:0016020
AF-A0A4V1D969-F1-model_v4 MAPEG family protein 0.8942 1 128 GO:0016020
AF-A0A3C0MD02-F1-model_v4 MAPEG family protein 0.8918 4 129 GO:0016020
AF-D0LG33-F1-model_v4 MAPEG family protein 0.8902 1 129 GO:0016020

Map