F366495

General Info

Members Datasets Scaffolds Average Seq Length
256 197 512 240

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10085249|Ga0157369_100852494
Length 290
Sequence MAGLRAAKPGGNDPAGQAANSGQAPGMPVVSSESVLALKRRARRINKALADKYPYAHAELDFRNPFELLVATVLSAQTTDVTVNQVSKVLFARWPDARSLAEADPVELETILKPTGFFRAKARNVLALCTRLVDDFDGEVPGRMKDLVTLPGVGRKTANVVLGNAFGVPGISVDTHFARLAKRFGWTQSEDPVQIEQDVAGLFERRDWTMLSHRVIFHGRRVCHARKPACGACPVANWCPSYGLGEMDPDKAAKLLKYELAPGSEALLDQYLSEQHRAAEIRMASQLRAP

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
59 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
120 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
131 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
132 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
133 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 2527291629 Frankia sp. BMG5.23 Isolate Nodule
182 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
183 2576861822 Frankia sp. CeD Isolate Nodule
184 2684623036 Frankia sp. CgIM4 Isolate Nodule
185 2710264753 Frankia sp. KB5 Isolate Nodule
186 2773857924 Frankia sp. CgIS1 Isolate Nodule
187 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
188 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
189 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
190 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
191 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
192 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
193 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
194 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
195 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
196 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
197 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.97
Metatranscriptomes 0.39
Isolates 6.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 1.95
Rhizoplane 4.69
Rhizosphere 88.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10085249 3300013105 Bacteria 3376
2 Ga0055524_1019138 3300003775 Bacteria 2351
3 Ga0070658_10247167 3300005327 Bacteria 1513
4 Ga0070683_100135517 3300005329 Bacteria 2331
5 Ga0070680_100012607 3300005336 Bacteria 6572
6 Ga0070680_100252389 3300005336 Bacteria 1491
7 Ga0070691_10000033 3300005341 Bacteria 39121
8 Ga0070692_10117250 3300005345 Bacteria 1480
9 Ga0070659_100023850 3300005366 Bacteria 4685
10 Ga0070714_100055922 3300005435 Bacteria 3374
11 Ga0070714_100485259 3300005435 Bacteria 1177
12 Ga0070713_100028334 3300005436 Bacteria 4422
13 Ga0070713_100082782 3300005436 Bacteria 2741
14 Ga0070713_100216838 3300005436 Bacteria 1735
15 Ga0070710_10010124 3300005437 Bacteria 4627
16 Ga0070711_100007954 3300005439 Bacteria 6465
17 Ga0070711_100029266 3300005439 Bacteria 3633
18 Ga0070678_100159031 3300005456 Bacteria 1828
19 Ga0070681_10114320 3300005458 Bacteria 2638
20 Ga0070681_10132265 3300005458 Bacteria 2427
21 Ga0070706_100002754 3300005467 Bacteria 17588
22 Ga0070707_100001503 3300005468 Bacteria 22738
23 Ga0070698_100000665 3300005471 Bacteria 36678
24 Ga0070698_100005211 3300005471 Bacteria 14212
25 Ga0070679_100035057 3300005530 Bacteria 4977
26 Ga0068853_100001647 3300005539 Bacteria 16330
27 Ga0070672_100015865 3300005543 Bacteria 5378
28 Ga0070695_100008582 3300005545 Bacteria 6070
29 Ga0070696_100211985 3300005546 Bacteria 1450
30 Ga0068855_100009942 3300005563 Bacteria 11472
31 Ga0070664_100370835 3300005564 Bacteria 1305
32 Ga0068857_100002650 3300005577 Bacteria 14696
33 Ga0068854_100025508 3300005578 Bacteria 4057
34 Ga0068856_100001370 3300005614 Bacteria 25638
35 Ga0068856_100153589 3300005614 Bacteria 2312
36 Ga0068852_100008577 3300005616 Bacteria 7540
37 Ga0068859_100016240 3300005617 Bacteria 7479
38 Ga0068859_100406102 3300005617 Bacteria 1458
39 Ga0068864_100141356 3300005618 Bacteria 2171
40 Ga0068870_10009736 3300005840 Bacteria 4382
41 Ga0068863_100011164 3300005841 Bacteria 8707
42 Ga0068858_100000308 3300005842 Bacteria 51941
43 Ga0068858_100010272 3300005842 Bacteria 8879
44 Ga0068858_100290186 3300005842 Bacteria 1559
45 Ga0068862_100023697 3300005844 Bacteria 5144
46 Ga0081455_10007875 3300005937 Bacteria 11154
47 Ga0070717_10004658 3300006028 Bacteria 9949
48 Ga0070717_10228484 3300006028 Bacteria 1638
49 Ga0070712_100001086 3300006175 Bacteria 16374
50 Ga0075430_100017078 3300006846 Bacteria 6181
51 Ga0075431_100135439 3300006847 Bacteria 2539
52 Ga0075434_100001912 3300006871 Bacteria 18049
53 Ga0075436_100003621 3300006914 Bacteria 10599
54 Ga0075436_100005635 3300006914 Bacteria 8593
55 Ga0097620_100016240 3300006931 Bacteria 7479
56 Ga0097620_100406102 3300006931 Bacteria 1458
57 Ga0075435_100004561 3300007076 Bacteria 9527
58 Ga0099795_10073114 3300007788 Bacteria 1297
59 Ga0105240_10003092 3300009093 Bacteria 26174
60 Ga0105247_10001081 3300009101 Bacteria 20329
61 Ga0105241_10002297 3300009174 Bacteria 14366
62 Ga0105242_10814165 3300009176 Bacteria 926
63 Ga0105237_10000746 3300009545 Bacteria 44835
64 Ga0105238_10007767 3300009551 Bacteria 10725
65 Ga0157373_10001483 3300013100 Bacteria 17886
66 Ga0157369_10002018 3300013105 Bacteria 24475
67 Ga0157369_10027322 3300013105 Bacteria 6327
68 Ga0157369_10072512 3300013105 Bacteria 3696
69 Ga0157374_10055603 3300013296 Bacteria 3694
70 Ga0157374_10462882 3300013296 Bacteria 1270
71 Ga0157372_10007018 3300013307 Bacteria 11995
72 Ga0163163_10032210 3300014325 Bacteria 5063
73 Ga0157380_10154482 3300014326 Bacteria 1987
74 Ga0157379_10000155 3300014968 Bacteria 50838
75 Ga0157379_10001588 3300014968 Bacteria 18738
76 Ga0157379_10002050 3300014968 Bacteria 16740
77 Ga0157379_10016532 3300014968 Bacteria 6490
78 Ga0206353_10786672 3300020082 Bacteria 5745
79 Ga0213871_10011378 3300021441 Bacteria 2043
80 Ga0213871_10019889 3300021441 Bacteria 1658
81 Ga0228598_1012482 3300024227 Bacteria 1688
82 Ga0207710_10000182 3300025900 Bacteria 63613
83 Ga0207699_10058775 3300025906 Bacteria 2302
84 Ga0207699_10670155 3300025906 Bacteria 758
85 Ga0207645_10002223 3300025907 Bacteria 15481
86 Ga0207645_10120695 3300025907 Bacteria 1701
87 Ga0207643_10003637 3300025908 Bacteria 8312
88 Ga0207705_10081100 3300025909 Bacteria 2365
89 Ga0207705_10194173 3300025909 Bacteria 1536
90 Ga0207684_10000323 3300025910 Bacteria 67693
91 Ga0207654_10033286 3300025911 Bacteria 2856
92 Ga0207707_10109145 3300025912 Bacteria 2419
93 Ga0207707_10456011 3300025912 Bacteria 1094
94 Ga0207695_10000932 3300025913 Bacteria 52193
95 Ga0207695_10016474 3300025913 Bacteria 8643
96 Ga0207671_10023468 3300025914 Bacteria 4652
97 Ga0207693_10000534 3300025915 Bacteria 34415
98 Ga0207693_10001699 3300025915 Bacteria 19392
99 Ga0207663_10084082 3300025916 Bacteria 2092
100 Ga0207660_10049538 3300025917 Bacteria 2979
101 Ga0207657_10008625 3300025919 Bacteria 10319
102 Ga0207646_10000050 3300025922 Bacteria 171554
103 Ga0207681_10187079 3300025923 Bacteria 1582
104 Ga0207681_10250894 3300025923 Bacteria 1381
105 Ga0207700_10506144 3300025928 Bacteria 1069
106 Ga0207700_10623812 3300025928 Bacteria 960
107 Ga0207700_10725791 3300025928 Bacteria 887
108 Ga0207706_10001734 3300025933 Bacteria 21451
109 Ga0207665_10092304 3300025939 Bacteria 2100
110 Ga0207691_10008966 3300025940 Bacteria 9595
111 Ga0207661_10002532 3300025944 Bacteria 12574
112 Ga0207667_10004609 3300025949 Bacteria 16905
113 Ga0207640_10071374 3300025981 Bacteria 2339
114 Ga0207703_10000002 3300026035 Bacteria 600711
115 Ga0207703_10025055 3300026035 Bacteria 4692
116 Ga0207703_10082607 3300026035 Bacteria 2682
117 Ga0207702_10149666 3300026078 Bacteria 2122
118 Ga0207641_10004040 3300026088 Bacteria 12794
119 Ga0207674_10000134 3300026116 Bacteria 86377
120 Ga0209984_1002549 3300027424 Bacteria 2043
121 Ga0210000_1022106 3300027462 Bacteria 975
122 Ga0209968_1014600 3300027526 Bacteria 1237
123 Ga0209982_1027839 3300027552 Bacteria 884
124 Ga0209971_1003208 3300027682 Bacteria 3897
125 Ga0207428_10015933 3300027907 Bacteria 6483
126 Ga0268265_10297547 3300028380 Bacteria 1451
127 Ga0265318_10000842 3300028577 Bacteria 20159
128 Ga0265338_10094783 3300028800 Bacteria 2454
129 Ga0265332_10152532 3300031238 Bacteria 966
130 Ga0265325_10000365 3300031241 Bacteria 31743
131 Ga0265325_10021329 3300031241 Bacteria 3559
132 Ga0265340_10104630 3300031247 Bacteria 1313
133 Ga0265339_10003492 3300031249 Bacteria 10991
134 Ga0265331_10005470 3300031250 Bacteria 7667
135 Ga0265316_10061901 3300031344 Bacteria 2905
136 Ga0307408_100016981 3300031548 Bacteria 4866
137 Ga0265313_10000968 3300031595 Bacteria 28412
138 Ga0265313_10001041 3300031595 Bacteria 26994
139 Ga0265313_10002198 3300031595 Bacteria 17259
140 Ga0265313_10010226 3300031595 Bacteria 5970
141 Ga0265314_10007761 3300031711 Bacteria 9278
142 Ga0265314_10074315 3300031711 Bacteria 2264
143 Ga0265314_10086230 3300031711 Bacteria 2056
144 Ga0316576_10000050 3300031727 Bacteria 37008
145 Ga0307412_10290880 3300031911 Bacteria 1287
146 Ga0307409_100001174 3300031995 Bacteria 12512
147 Ga0307409_100335771 3300031995 Bacteria 1420
148 Ga0307416_100000713 3300032002 Bacteria 17248
149 Ga0307415_100000057 3300032126 Bacteria 47112
150 Ga0373923_0098567 3300035111 Bacteria 1286
151 Ga0373923_0110549 3300035111 Bacteria 1220
152 Ga0373953_0023278 3300035117 Bacteria 2343
153 Ga0373954_0044554 3300035118 Bacteria 2071
154 Ga0373955_0051130 3300035172 Bacteria 2250
155 Ga0373931_0428032 3300035691 Bacteria 843
156 Ga0373935_0127543 3300035692 Bacteria 1706
157 Ga0373927_0020522 3300035695 Bacteria 4333
158 Ga0373933_0002892 3300035724 Bacteria 9597
159 Ga0373933_0053621 3300035724 Bacteria 2415
160 Ga0373937_0011720 3300036401 Bacteria 7688
161 Ga0373937_0064903 3300036401 Bacteria 3359
162 Ga0373937_0145335 3300036401 Bacteria 2219
163 Ga0316582_0479218 3300036647 Bacteria 857
164 Ga0316584_0000463 3300036712 Bacteria 21184
165 Ga0373925_0019125 3300037068 Bacteria 4980
166 Ga0373925_0132134 3300037068 Bacteria 1947
167 Ga0395899_0108743 3300037312 Bacteria 1995
168 Ga0395900_0122872 3300037418 Bacteria 2663
169 Ga0395900_0146054 3300037418 Bacteria 2418
170 Ga0395898_0092038 3300037466 Bacteria 2916
171 Ga0395898_0154333 3300037466 Bacteria 2196
172 Ga0316581_0031434 3300037588 Bacteria 1600
173 Ga0395901_0035489 3300038443 Bacteria 5152
174 Ga0436365_1464616 3300039437 Bacteria 816
175 Ga0436360_0820330 3300039438 Bacteria 5655
176 Ga0436360_0988725 3300039438 Bacteria 1359
177 Ga0436360_1037385 3300039438 Bacteria 854
178 Ga0436362_0424286 3300039453 Bacteria 2327
179 Ga0436362_0622811 3300039453 Bacteria 1211
180 Ga0436362_0671700 3300039453 Bacteria 2055
181 Ga0436362_1168339 3300039453 Bacteria 882
182 Ga0451797_0954949 3300041453 Bacteria 1594
183 Ga0439450_042058 3300042008 Bacteria 1064
184 Ga0439464_0046619 3300042439 Bacteria 1246
185 Ga0439440_0000698 3300042993 Bacteria 5769
186 Ga0466964_0038347 3300044706 Bacteria 1926
187 Ga0466964_0166874 3300044706 Bacteria 1033
188 Ga0495592_0041857 3300046454 Bacteria 3432
189 Ga0495651_0002900 3300046462 Bacteria 13279
190 Ga0495608_0175442 3300046511 Bacteria 1358
191 Ga0495628_0038324 3300046516 Bacteria 3837
192 Ga0495628_0038924 3300046516 Bacteria 3804
193 Ga0495632_0009273 3300046519 Bacteria 5943
194 Ga0495652_0007579 3300046529 Bacteria 10005
195 Ga0495587_0069346 3300046536 Bacteria 2053
196 Ga0495645_0009981 3300046543 Bacteria 6647
197 Ga0495645_0049926 3300046543 Bacteria 3046
198 Ga0495667_0225854 3300046559 Bacteria 1194
199 Ga0495635_0103699 3300046663 Bacteria 1944
200 Ga0495657_0357471 3300046675 Bacteria 863
201 Ga0495646_0108256 3300046680 Bacteria 1585
202 Ga0495600_0096665 3300046809 Bacteria 1925
203 Ga0495604_0057716 3300047317 Bacteria 2984
204 Ga0495674_0055085 3300047319 Bacteria 3489
205 Ga0495680_0145035 3300047322 Bacteria 1735
206 Ga0496101_0968545 3300048904 Bacteria 669
207 Ga0496102_0541714 3300048905 Bacteria 1086
208 Ga0496104_0012795 3300048907 Bacteria 7558
209 Ga0496106_0244134 3300048909 Bacteria 1435
210 Ga0496106_0445115 3300048909 Bacteria 1041
211 Ga0496108_0013296 3300048911 Bacteria 6710
212 Ga0496111_0137852 3300048914 Bacteria 1808
213 Ga0496112_0118443 3300048915 Bacteria 2618
214 Ga0496113_0140273 3300048916 Bacteria 1901
215 Ga0496114_0091128 3300048917 Bacteria 2589
216 Ga0496118_0054485 3300048921 Bacteria 3029
217 Ga0496119_0015591 3300048922 Bacteria 5837
218 Ga0496121_0006504 3300048924 Bacteria 14455
219 Ga0501033_0207237 3300049570 Bacteria 1399
220 Ga0501034_0376239 3300049571 Bacteria 1346
221 Ga0501037_0202797 3300049573 Bacteria 1401
222 Ga0501047_0049686 3300049581 Bacteria 4049
223 Ga0501067_0036580 3300049583 Bacteria 2725
224 Ga0501070_0138680 3300049586 Bacteria 2008
225 Ga0501083_0219567 3300049744 Bacteria 1238
226 Ga0501035_0008954 3300049822 Bacteria 9314
227 nmdc:mga05p37_918142_c1 3300050507 Bacteria 941
228 nmdc:mga09592_155646_c1 3300050508 Bacteria 1973
229 nmdc:mga0qj67_158904_c1 3300050509 Bacteria 1835
230 nmdc:mga06r32_171033_c1 3300050510 Bacteria 2157
231 nmdc:mga08y16_624308_c1 3300050511 Bacteria 1084
232 Ga0495601_0155538 3300053077 Bacteria 1493
233 Ga0495601_0347853 3300053077 Bacteria 964
234 Ga0495619_0011747 3300053085 Bacteria 5518
235 Ga0495619_0228355 3300053085 Bacteria 1289
236 Ga0500616_0075468 3300053153 Bacteria 1706
237 Ga0501084_0080500 3300054114 Bacteria 2731
238 Ga0501084_0192611 3300054114 Bacteria 1720
239 Ga0501082_0570126 3300060353 Bacteria 990
240 2528213909 2527291629 Bacteria 5267418
241 2546948777 2546825537 Bacteria 5389291
242 2579747907 2576861822 Bacteria 5004595
243 2686540680 2684623036 Bacteria 5199090
244 2710605313 2710264753 Bacteria 5455564
245 2774867618 2773857924 Bacteria 5256821
246 2775655739 2775506735 Bacteria 4556596
247 2791913767 2791354901 Bacteria 8322202
248 2808828473 2808606357 Bacteria 4466944
249 2808849717 2808606360 Bacteria 4404006
250 2808877692 2808606366 Bacteria 4415912
251 2808899138 2808606371 Bacteria 4251511
252 2812319817 2811994871 Bacteria 4497550
253 2812363821 2811994880 Bacteria 4147780
254 2905929444 2905926851 Bacteria 4423176
255 2945917557 2945916053 Bacteria 4555517
256 2946061387 2946059875 Bacteria 4386623
257 Ga0157369_10085249
258 Ga0055524_1019138
259 Ga0070658_10247167
260 Ga0070683_100135517
261 Ga0070680_100012607
262 Ga0070680_100252389
263 Ga0070691_10000033
264 Ga0070692_10117250
265 Ga0070659_100023850
266 Ga0070714_100055922
267 Ga0070714_100485259
268 Ga0070713_100028334
269 Ga0070713_100082782
270 Ga0070713_100216838
271 Ga0070710_10010124
272 Ga0070711_100007954
273 Ga0070711_100029266
274 Ga0070678_100159031
275 Ga0070681_10114320
276 Ga0070681_10132265
277 Ga0070706_100002754
278 Ga0070707_100001503
279 Ga0070698_100000665
280 Ga0070698_100005211
281 Ga0070679_100035057
282 Ga0068853_100001647
283 Ga0070672_100015865
284 Ga0070695_100008582
285 Ga0070696_100211985
286 Ga0068855_100009942
287 Ga0070664_100370835
288 Ga0068857_100002650
289 Ga0068854_100025508
290 Ga0068856_100001370
291 Ga0068856_100153589
292 Ga0068852_100008577
293 Ga0068859_100016240
294 Ga0068859_100406102
295 Ga0068864_100141356
296 Ga0068870_10009736
297 Ga0068863_100011164
298 Ga0068858_100000308
299 Ga0068858_100010272
300 Ga0068858_100290186
301 Ga0068862_100023697
302 Ga0081455_10007875
303 Ga0070717_10004658
304 Ga0070717_10228484
305 Ga0070712_100001086
306 Ga0075430_100017078
307 Ga0075431_100135439
308 Ga0075434_100001912
309 Ga0075436_100003621
310 Ga0075436_100005635
311 Ga0097620_100016240
312 Ga0097620_100406102
313 Ga0075435_100004561
314 Ga0099795_10073114
315 Ga0105240_10003092
316 Ga0105247_10001081
317 Ga0105241_10002297
318 Ga0105242_10814165
319 Ga0105237_10000746
320 Ga0105238_10007767
321 Ga0157373_10001483
322 Ga0157369_10002018
323 Ga0157369_10027322
324 Ga0157369_10072512
325 Ga0157374_10055603
326 Ga0157374_10462882
327 Ga0157372_10007018
328 Ga0163163_10032210
329 Ga0157380_10154482
330 Ga0157379_10000155
331 Ga0157379_10001588
332 Ga0157379_10002050
333 Ga0157379_10016532
334 Ga0206353_10786672
335 Ga0213871_10011378
336 Ga0213871_10019889
337 Ga0228598_1012482
338 Ga0207710_10000182
339 Ga0207699_10058775
340 Ga0207699_10670155
341 Ga0207645_10002223
342 Ga0207645_10120695
343 Ga0207643_10003637
344 Ga0207705_10081100
345 Ga0207705_10194173
346 Ga0207684_10000323
347 Ga0207654_10033286
348 Ga0207707_10109145
349 Ga0207707_10456011
350 Ga0207695_10000932
351 Ga0207695_10016474
352 Ga0207671_10023468
353 Ga0207693_10000534
354 Ga0207693_10001699
355 Ga0207663_10084082
356 Ga0207660_10049538
357 Ga0207657_10008625
358 Ga0207646_10000050
359 Ga0207681_10187079
360 Ga0207681_10250894
361 Ga0207700_10506144
362 Ga0207700_10623812
363 Ga0207700_10725791
364 Ga0207706_10001734
365 Ga0207665_10092304
366 Ga0207691_10008966
367 Ga0207661_10002532
368 Ga0207667_10004609
369 Ga0207640_10071374
370 Ga0207703_10000002
371 Ga0207703_10025055
372 Ga0207703_10082607
373 Ga0207702_10149666
374 Ga0207641_10004040
375 Ga0207674_10000134
376 Ga0209984_1002549
377 Ga0210000_1022106
378 Ga0209968_1014600
379 Ga0209982_1027839
380 Ga0209971_1003208
381 Ga0207428_10015933
382 Ga0268265_10297547
383 Ga0265318_10000842
384 Ga0265338_10094783
385 Ga0265332_10152532
386 Ga0265325_10000365
387 Ga0265325_10021329
388 Ga0265340_10104630
389 Ga0265339_10003492
390 Ga0265331_10005470
391 Ga0265316_10061901
392 Ga0307408_100016981
393 Ga0265313_10000968
394 Ga0265313_10001041
395 Ga0265313_10002198
396 Ga0265313_10010226
397 Ga0265314_10007761
398 Ga0265314_10074315
399 Ga0265314_10086230
400 Ga0316576_10000050
401 Ga0307412_10290880
402 Ga0307409_100001174
403 Ga0307409_100335771
404 Ga0307416_100000713
405 Ga0307415_100000057
406 Ga0373923_0098567
407 Ga0373923_0110549
408 Ga0373953_0023278
409 Ga0373954_0044554
410 Ga0373955_0051130
411 Ga0373931_0428032
412 Ga0373935_0127543
413 Ga0373927_0020522
414 Ga0373933_0002892
415 Ga0373933_0053621
416 Ga0373937_0011720
417 Ga0373937_0064903
418 Ga0373937_0145335
419 Ga0316582_0479218
420 Ga0316584_0000463
421 Ga0373925_0019125
422 Ga0373925_0132134
423 Ga0395899_0108743
424 Ga0395900_0122872
425 Ga0395900_0146054
426 Ga0395898_0092038
427 Ga0395898_0154333
428 Ga0316581_0031434
429 Ga0395901_0035489
430 Ga0436365_1464616
431 Ga0436360_0820330
432 Ga0436360_0988725
433 Ga0436360_1037385
434 Ga0436362_0424286
435 Ga0436362_0622811
436 Ga0436362_0671700
437 Ga0436362_1168339
438 Ga0451797_0954949
439 Ga0439450_042058
440 Ga0439464_0046619
441 Ga0439440_0000698
442 Ga0466964_0038347
443 Ga0466964_0166874
444 Ga0495592_0041857
445 Ga0495651_0002900
446 Ga0495608_0175442
447 Ga0495628_0038324
448 Ga0495628_0038924
449 Ga0495632_0009273
450 Ga0495652_0007579
451 Ga0495587_0069346
452 Ga0495645_0009981
453 Ga0495645_0049926
454 Ga0495667_0225854
455 Ga0495635_0103699
456 Ga0495657_0357471
457 Ga0495646_0108256
458 Ga0495600_0096665
459 Ga0495604_0057716
460 Ga0495674_0055085
461 Ga0495680_0145035
462 Ga0496101_0968545
463 Ga0496102_0541714
464 Ga0496104_0012795
465 Ga0496106_0244134
466 Ga0496106_0445115
467 Ga0496108_0013296
468 Ga0496111_0137852
469 Ga0496112_0118443
470 Ga0496113_0140273
471 Ga0496114_0091128
472 Ga0496118_0054485
473 Ga0496119_0015591
474 Ga0496121_0006504
475 Ga0501033_0207237
476 Ga0501034_0376239
477 Ga0501037_0202797
478 Ga0501047_0049686
479 Ga0501067_0036580
480 Ga0501070_0138680
481 Ga0501083_0219567
482 Ga0501035_0008954
483 nmdc:mga05p37_918142_c1
484 nmdc:mga09592_155646_c1
485 nmdc:mga0qj67_158904_c1
486 nmdc:mga06r32_171033_c1
487 nmdc:mga08y16_624308_c1
488 Ga0495601_0155538
489 Ga0495601_0347853
490 Ga0495619_0011747
491 Ga0495619_0228355
492 Ga0500616_0075468
493 Ga0501084_0080500
494 Ga0501084_0192611
495 Ga0501082_0570126
496 2528213909
497 2546948777
498 2579747907
499 2686540680
500 2710605313
501 2774867618
502 2775655739
503 2791913767
504 2808828473
505 2808849717
506 2808877692
507 2808899138
508 2812319817
509 2812363821
510 2905929444
511 2945917557
512 2946061387

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10576

EndIII_4Fe-2S

Iron-sulfur binding domain of endonuclease III

223

239

0.99

PF00633

HHH

Helix-hairpin-helix motif

135

163

0.95

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

70

205

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2abk-assembly1.cif.gz_A refinement of the native structure of endonuclease iii to a resolution of 1.85 angstrom 0.9833 31 238
2abk-assembly1.cif.gz_A refinement of the native structure of endonuclease iii to a resolution of 1.85 angstrom 0.965 31 238
1p59-assembly1.cif.gz_A structure of a non-covalent endonuclease iii-dna complex 0.9119 31 234
1orp-assembly1.cif.gz_A structure of a trapped endonuclease iii-dna covalent intermediate: estranged-adenine complex 0.9088 31 234
1kea-assembly1.cif.gz_A structure of a thermostable thymine-dna glycosylase 0.8823 34 233
ID Description Score Start End Superfamily
af_P0AB83_21_132_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9932 51 162 1.10.340.30
af_P0AB83_21_132_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9845 51 162 1.10.340.30
af_P0AB83_133_208_1.10.1670.10 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.98 164 238 1.10.1670.10
af_Q4CY47_40_146_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9762 59 156 1.10.340.30
af_Q58030_26_127_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.976 61 160 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A2S6N9H2-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.9974 33 239 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078
AF-A0A3C0TRN7-F1-model_v4 Endonuclease III 0.9959 31 201 GO:0003677
GO:0003906
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
AF-A0A6N8A6Y0-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.9953 31 240 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078
AF-A0A7Y2TQ52-F1-model_v4 Endonuclease III 0.995 31 220 GO:0003677
GO:0003906
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
AF-A0A2N8MFA7-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.9949 31 240 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078

Map