F366495
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 256 | 197 | 512 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10085249|Ga0157369_100852494 |
| Length | 290 |
| Sequence | MAGLRAAKPGGNDPAGQAANSGQAPGMPVVSSESVLALKRRARRINKALADKYPYAHAELDFRNPFELLVATVLSAQTTDVTVNQVSKVLFARWPDARSLAEADPVELETILKPTGFFRAKARNVLALCTRLVDDFDGEVPGRMKDLVTLPGVGRKTANVVLGNAFGVPGISVDTHFARLAKRFGWTQSEDPVQIEQDVAGLFERRDWTMLSHRVIFHGRRVCHARKPACGACPVANWCPSYGLGEMDPDKAAKLLKYELAPGSEALLDQYLSEQHRAAEIRMASQLRAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 58 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 59 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 60 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 98 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 99 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 100 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 101 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 102 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 103 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 106 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 108 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 109 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 110 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 111 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 112 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 113 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 114 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 116 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 117 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 118 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 120 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 121 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 123 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 124 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 125 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 126 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 127 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 128 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 129 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 130 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 131 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 132 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 133 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 134 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 135 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 153 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 154 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 155 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 157 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 158 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 159 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 160 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 161 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 162 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 179 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 182 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 183 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 184 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 185 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 186 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 187 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 188 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 189 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 190 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 191 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 192 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 193 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 194 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 195 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 196 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 197 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.97 |
| Metatranscriptomes | 0.39 |
| Isolates | 6.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.78 |
| Nodule | 1.95 |
| Rhizoplane | 4.69 |
| Rhizosphere | 88.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157369_10085249 | 3300013105 | Bacteria | 3376 |
| 2 | Ga0055524_1019138 | 3300003775 | Bacteria | 2351 |
| 3 | Ga0070658_10247167 | 3300005327 | Bacteria | 1513 |
| 4 | Ga0070683_100135517 | 3300005329 | Bacteria | 2331 |
| 5 | Ga0070680_100012607 | 3300005336 | Bacteria | 6572 |
| 6 | Ga0070680_100252389 | 3300005336 | Bacteria | 1491 |
| 7 | Ga0070691_10000033 | 3300005341 | Bacteria | 39121 |
| 8 | Ga0070692_10117250 | 3300005345 | Bacteria | 1480 |
| 9 | Ga0070659_100023850 | 3300005366 | Bacteria | 4685 |
| 10 | Ga0070714_100055922 | 3300005435 | Bacteria | 3374 |
| 11 | Ga0070714_100485259 | 3300005435 | Bacteria | 1177 |
| 12 | Ga0070713_100028334 | 3300005436 | Bacteria | 4422 |
| 13 | Ga0070713_100082782 | 3300005436 | Bacteria | 2741 |
| 14 | Ga0070713_100216838 | 3300005436 | Bacteria | 1735 |
| 15 | Ga0070710_10010124 | 3300005437 | Bacteria | 4627 |
| 16 | Ga0070711_100007954 | 3300005439 | Bacteria | 6465 |
| 17 | Ga0070711_100029266 | 3300005439 | Bacteria | 3633 |
| 18 | Ga0070678_100159031 | 3300005456 | Bacteria | 1828 |
| 19 | Ga0070681_10114320 | 3300005458 | Bacteria | 2638 |
| 20 | Ga0070681_10132265 | 3300005458 | Bacteria | 2427 |
| 21 | Ga0070706_100002754 | 3300005467 | Bacteria | 17588 |
| 22 | Ga0070707_100001503 | 3300005468 | Bacteria | 22738 |
| 23 | Ga0070698_100000665 | 3300005471 | Bacteria | 36678 |
| 24 | Ga0070698_100005211 | 3300005471 | Bacteria | 14212 |
| 25 | Ga0070679_100035057 | 3300005530 | Bacteria | 4977 |
| 26 | Ga0068853_100001647 | 3300005539 | Bacteria | 16330 |
| 27 | Ga0070672_100015865 | 3300005543 | Bacteria | 5378 |
| 28 | Ga0070695_100008582 | 3300005545 | Bacteria | 6070 |
| 29 | Ga0070696_100211985 | 3300005546 | Bacteria | 1450 |
| 30 | Ga0068855_100009942 | 3300005563 | Bacteria | 11472 |
| 31 | Ga0070664_100370835 | 3300005564 | Bacteria | 1305 |
| 32 | Ga0068857_100002650 | 3300005577 | Bacteria | 14696 |
| 33 | Ga0068854_100025508 | 3300005578 | Bacteria | 4057 |
| 34 | Ga0068856_100001370 | 3300005614 | Bacteria | 25638 |
| 35 | Ga0068856_100153589 | 3300005614 | Bacteria | 2312 |
| 36 | Ga0068852_100008577 | 3300005616 | Bacteria | 7540 |
| 37 | Ga0068859_100016240 | 3300005617 | Bacteria | 7479 |
| 38 | Ga0068859_100406102 | 3300005617 | Bacteria | 1458 |
| 39 | Ga0068864_100141356 | 3300005618 | Bacteria | 2171 |
| 40 | Ga0068870_10009736 | 3300005840 | Bacteria | 4382 |
| 41 | Ga0068863_100011164 | 3300005841 | Bacteria | 8707 |
| 42 | Ga0068858_100000308 | 3300005842 | Bacteria | 51941 |
| 43 | Ga0068858_100010272 | 3300005842 | Bacteria | 8879 |
| 44 | Ga0068858_100290186 | 3300005842 | Bacteria | 1559 |
| 45 | Ga0068862_100023697 | 3300005844 | Bacteria | 5144 |
| 46 | Ga0081455_10007875 | 3300005937 | Bacteria | 11154 |
| 47 | Ga0070717_10004658 | 3300006028 | Bacteria | 9949 |
| 48 | Ga0070717_10228484 | 3300006028 | Bacteria | 1638 |
| 49 | Ga0070712_100001086 | 3300006175 | Bacteria | 16374 |
| 50 | Ga0075430_100017078 | 3300006846 | Bacteria | 6181 |
| 51 | Ga0075431_100135439 | 3300006847 | Bacteria | 2539 |
| 52 | Ga0075434_100001912 | 3300006871 | Bacteria | 18049 |
| 53 | Ga0075436_100003621 | 3300006914 | Bacteria | 10599 |
| 54 | Ga0075436_100005635 | 3300006914 | Bacteria | 8593 |
| 55 | Ga0097620_100016240 | 3300006931 | Bacteria | 7479 |
| 56 | Ga0097620_100406102 | 3300006931 | Bacteria | 1458 |
| 57 | Ga0075435_100004561 | 3300007076 | Bacteria | 9527 |
| 58 | Ga0099795_10073114 | 3300007788 | Bacteria | 1297 |
| 59 | Ga0105240_10003092 | 3300009093 | Bacteria | 26174 |
| 60 | Ga0105247_10001081 | 3300009101 | Bacteria | 20329 |
| 61 | Ga0105241_10002297 | 3300009174 | Bacteria | 14366 |
| 62 | Ga0105242_10814165 | 3300009176 | Bacteria | 926 |
| 63 | Ga0105237_10000746 | 3300009545 | Bacteria | 44835 |
| 64 | Ga0105238_10007767 | 3300009551 | Bacteria | 10725 |
| 65 | Ga0157373_10001483 | 3300013100 | Bacteria | 17886 |
| 66 | Ga0157369_10002018 | 3300013105 | Bacteria | 24475 |
| 67 | Ga0157369_10027322 | 3300013105 | Bacteria | 6327 |
| 68 | Ga0157369_10072512 | 3300013105 | Bacteria | 3696 |
| 69 | Ga0157374_10055603 | 3300013296 | Bacteria | 3694 |
| 70 | Ga0157374_10462882 | 3300013296 | Bacteria | 1270 |
| 71 | Ga0157372_10007018 | 3300013307 | Bacteria | 11995 |
| 72 | Ga0163163_10032210 | 3300014325 | Bacteria | 5063 |
| 73 | Ga0157380_10154482 | 3300014326 | Bacteria | 1987 |
| 74 | Ga0157379_10000155 | 3300014968 | Bacteria | 50838 |
| 75 | Ga0157379_10001588 | 3300014968 | Bacteria | 18738 |
| 76 | Ga0157379_10002050 | 3300014968 | Bacteria | 16740 |
| 77 | Ga0157379_10016532 | 3300014968 | Bacteria | 6490 |
| 78 | Ga0206353_10786672 | 3300020082 | Bacteria | 5745 |
| 79 | Ga0213871_10011378 | 3300021441 | Bacteria | 2043 |
| 80 | Ga0213871_10019889 | 3300021441 | Bacteria | 1658 |
| 81 | Ga0228598_1012482 | 3300024227 | Bacteria | 1688 |
| 82 | Ga0207710_10000182 | 3300025900 | Bacteria | 63613 |
| 83 | Ga0207699_10058775 | 3300025906 | Bacteria | 2302 |
| 84 | Ga0207699_10670155 | 3300025906 | Bacteria | 758 |
| 85 | Ga0207645_10002223 | 3300025907 | Bacteria | 15481 |
| 86 | Ga0207645_10120695 | 3300025907 | Bacteria | 1701 |
| 87 | Ga0207643_10003637 | 3300025908 | Bacteria | 8312 |
| 88 | Ga0207705_10081100 | 3300025909 | Bacteria | 2365 |
| 89 | Ga0207705_10194173 | 3300025909 | Bacteria | 1536 |
| 90 | Ga0207684_10000323 | 3300025910 | Bacteria | 67693 |
| 91 | Ga0207654_10033286 | 3300025911 | Bacteria | 2856 |
| 92 | Ga0207707_10109145 | 3300025912 | Bacteria | 2419 |
| 93 | Ga0207707_10456011 | 3300025912 | Bacteria | 1094 |
| 94 | Ga0207695_10000932 | 3300025913 | Bacteria | 52193 |
| 95 | Ga0207695_10016474 | 3300025913 | Bacteria | 8643 |
| 96 | Ga0207671_10023468 | 3300025914 | Bacteria | 4652 |
| 97 | Ga0207693_10000534 | 3300025915 | Bacteria | 34415 |
| 98 | Ga0207693_10001699 | 3300025915 | Bacteria | 19392 |
| 99 | Ga0207663_10084082 | 3300025916 | Bacteria | 2092 |
| 100 | Ga0207660_10049538 | 3300025917 | Bacteria | 2979 |
| 101 | Ga0207657_10008625 | 3300025919 | Bacteria | 10319 |
| 102 | Ga0207646_10000050 | 3300025922 | Bacteria | 171554 |
| 103 | Ga0207681_10187079 | 3300025923 | Bacteria | 1582 |
| 104 | Ga0207681_10250894 | 3300025923 | Bacteria | 1381 |
| 105 | Ga0207700_10506144 | 3300025928 | Bacteria | 1069 |
| 106 | Ga0207700_10623812 | 3300025928 | Bacteria | 960 |
| 107 | Ga0207700_10725791 | 3300025928 | Bacteria | 887 |
| 108 | Ga0207706_10001734 | 3300025933 | Bacteria | 21451 |
| 109 | Ga0207665_10092304 | 3300025939 | Bacteria | 2100 |
| 110 | Ga0207691_10008966 | 3300025940 | Bacteria | 9595 |
| 111 | Ga0207661_10002532 | 3300025944 | Bacteria | 12574 |
| 112 | Ga0207667_10004609 | 3300025949 | Bacteria | 16905 |
| 113 | Ga0207640_10071374 | 3300025981 | Bacteria | 2339 |
| 114 | Ga0207703_10000002 | 3300026035 | Bacteria | 600711 |
| 115 | Ga0207703_10025055 | 3300026035 | Bacteria | 4692 |
| 116 | Ga0207703_10082607 | 3300026035 | Bacteria | 2682 |
| 117 | Ga0207702_10149666 | 3300026078 | Bacteria | 2122 |
| 118 | Ga0207641_10004040 | 3300026088 | Bacteria | 12794 |
| 119 | Ga0207674_10000134 | 3300026116 | Bacteria | 86377 |
| 120 | Ga0209984_1002549 | 3300027424 | Bacteria | 2043 |
| 121 | Ga0210000_1022106 | 3300027462 | Bacteria | 975 |
| 122 | Ga0209968_1014600 | 3300027526 | Bacteria | 1237 |
| 123 | Ga0209982_1027839 | 3300027552 | Bacteria | 884 |
| 124 | Ga0209971_1003208 | 3300027682 | Bacteria | 3897 |
| 125 | Ga0207428_10015933 | 3300027907 | Bacteria | 6483 |
| 126 | Ga0268265_10297547 | 3300028380 | Bacteria | 1451 |
| 127 | Ga0265318_10000842 | 3300028577 | Bacteria | 20159 |
| 128 | Ga0265338_10094783 | 3300028800 | Bacteria | 2454 |
| 129 | Ga0265332_10152532 | 3300031238 | Bacteria | 966 |
| 130 | Ga0265325_10000365 | 3300031241 | Bacteria | 31743 |
| 131 | Ga0265325_10021329 | 3300031241 | Bacteria | 3559 |
| 132 | Ga0265340_10104630 | 3300031247 | Bacteria | 1313 |
| 133 | Ga0265339_10003492 | 3300031249 | Bacteria | 10991 |
| 134 | Ga0265331_10005470 | 3300031250 | Bacteria | 7667 |
| 135 | Ga0265316_10061901 | 3300031344 | Bacteria | 2905 |
| 136 | Ga0307408_100016981 | 3300031548 | Bacteria | 4866 |
| 137 | Ga0265313_10000968 | 3300031595 | Bacteria | 28412 |
| 138 | Ga0265313_10001041 | 3300031595 | Bacteria | 26994 |
| 139 | Ga0265313_10002198 | 3300031595 | Bacteria | 17259 |
| 140 | Ga0265313_10010226 | 3300031595 | Bacteria | 5970 |
| 141 | Ga0265314_10007761 | 3300031711 | Bacteria | 9278 |
| 142 | Ga0265314_10074315 | 3300031711 | Bacteria | 2264 |
| 143 | Ga0265314_10086230 | 3300031711 | Bacteria | 2056 |
| 144 | Ga0316576_10000050 | 3300031727 | Bacteria | 37008 |
| 145 | Ga0307412_10290880 | 3300031911 | Bacteria | 1287 |
| 146 | Ga0307409_100001174 | 3300031995 | Bacteria | 12512 |
| 147 | Ga0307409_100335771 | 3300031995 | Bacteria | 1420 |
| 148 | Ga0307416_100000713 | 3300032002 | Bacteria | 17248 |
| 149 | Ga0307415_100000057 | 3300032126 | Bacteria | 47112 |
| 150 | Ga0373923_0098567 | 3300035111 | Bacteria | 1286 |
| 151 | Ga0373923_0110549 | 3300035111 | Bacteria | 1220 |
| 152 | Ga0373953_0023278 | 3300035117 | Bacteria | 2343 |
| 153 | Ga0373954_0044554 | 3300035118 | Bacteria | 2071 |
| 154 | Ga0373955_0051130 | 3300035172 | Bacteria | 2250 |
| 155 | Ga0373931_0428032 | 3300035691 | Bacteria | 843 |
| 156 | Ga0373935_0127543 | 3300035692 | Bacteria | 1706 |
| 157 | Ga0373927_0020522 | 3300035695 | Bacteria | 4333 |
| 158 | Ga0373933_0002892 | 3300035724 | Bacteria | 9597 |
| 159 | Ga0373933_0053621 | 3300035724 | Bacteria | 2415 |
| 160 | Ga0373937_0011720 | 3300036401 | Bacteria | 7688 |
| 161 | Ga0373937_0064903 | 3300036401 | Bacteria | 3359 |
| 162 | Ga0373937_0145335 | 3300036401 | Bacteria | 2219 |
| 163 | Ga0316582_0479218 | 3300036647 | Bacteria | 857 |
| 164 | Ga0316584_0000463 | 3300036712 | Bacteria | 21184 |
| 165 | Ga0373925_0019125 | 3300037068 | Bacteria | 4980 |
| 166 | Ga0373925_0132134 | 3300037068 | Bacteria | 1947 |
| 167 | Ga0395899_0108743 | 3300037312 | Bacteria | 1995 |
| 168 | Ga0395900_0122872 | 3300037418 | Bacteria | 2663 |
| 169 | Ga0395900_0146054 | 3300037418 | Bacteria | 2418 |
| 170 | Ga0395898_0092038 | 3300037466 | Bacteria | 2916 |
| 171 | Ga0395898_0154333 | 3300037466 | Bacteria | 2196 |
| 172 | Ga0316581_0031434 | 3300037588 | Bacteria | 1600 |
| 173 | Ga0395901_0035489 | 3300038443 | Bacteria | 5152 |
| 174 | Ga0436365_1464616 | 3300039437 | Bacteria | 816 |
| 175 | Ga0436360_0820330 | 3300039438 | Bacteria | 5655 |
| 176 | Ga0436360_0988725 | 3300039438 | Bacteria | 1359 |
| 177 | Ga0436360_1037385 | 3300039438 | Bacteria | 854 |
| 178 | Ga0436362_0424286 | 3300039453 | Bacteria | 2327 |
| 179 | Ga0436362_0622811 | 3300039453 | Bacteria | 1211 |
| 180 | Ga0436362_0671700 | 3300039453 | Bacteria | 2055 |
| 181 | Ga0436362_1168339 | 3300039453 | Bacteria | 882 |
| 182 | Ga0451797_0954949 | 3300041453 | Bacteria | 1594 |
| 183 | Ga0439450_042058 | 3300042008 | Bacteria | 1064 |
| 184 | Ga0439464_0046619 | 3300042439 | Bacteria | 1246 |
| 185 | Ga0439440_0000698 | 3300042993 | Bacteria | 5769 |
| 186 | Ga0466964_0038347 | 3300044706 | Bacteria | 1926 |
| 187 | Ga0466964_0166874 | 3300044706 | Bacteria | 1033 |
| 188 | Ga0495592_0041857 | 3300046454 | Bacteria | 3432 |
| 189 | Ga0495651_0002900 | 3300046462 | Bacteria | 13279 |
| 190 | Ga0495608_0175442 | 3300046511 | Bacteria | 1358 |
| 191 | Ga0495628_0038324 | 3300046516 | Bacteria | 3837 |
| 192 | Ga0495628_0038924 | 3300046516 | Bacteria | 3804 |
| 193 | Ga0495632_0009273 | 3300046519 | Bacteria | 5943 |
| 194 | Ga0495652_0007579 | 3300046529 | Bacteria | 10005 |
| 195 | Ga0495587_0069346 | 3300046536 | Bacteria | 2053 |
| 196 | Ga0495645_0009981 | 3300046543 | Bacteria | 6647 |
| 197 | Ga0495645_0049926 | 3300046543 | Bacteria | 3046 |
| 198 | Ga0495667_0225854 | 3300046559 | Bacteria | 1194 |
| 199 | Ga0495635_0103699 | 3300046663 | Bacteria | 1944 |
| 200 | Ga0495657_0357471 | 3300046675 | Bacteria | 863 |
| 201 | Ga0495646_0108256 | 3300046680 | Bacteria | 1585 |
| 202 | Ga0495600_0096665 | 3300046809 | Bacteria | 1925 |
| 203 | Ga0495604_0057716 | 3300047317 | Bacteria | 2984 |
| 204 | Ga0495674_0055085 | 3300047319 | Bacteria | 3489 |
| 205 | Ga0495680_0145035 | 3300047322 | Bacteria | 1735 |
| 206 | Ga0496101_0968545 | 3300048904 | Bacteria | 669 |
| 207 | Ga0496102_0541714 | 3300048905 | Bacteria | 1086 |
| 208 | Ga0496104_0012795 | 3300048907 | Bacteria | 7558 |
| 209 | Ga0496106_0244134 | 3300048909 | Bacteria | 1435 |
| 210 | Ga0496106_0445115 | 3300048909 | Bacteria | 1041 |
| 211 | Ga0496108_0013296 | 3300048911 | Bacteria | 6710 |
| 212 | Ga0496111_0137852 | 3300048914 | Bacteria | 1808 |
| 213 | Ga0496112_0118443 | 3300048915 | Bacteria | 2618 |
| 214 | Ga0496113_0140273 | 3300048916 | Bacteria | 1901 |
| 215 | Ga0496114_0091128 | 3300048917 | Bacteria | 2589 |
| 216 | Ga0496118_0054485 | 3300048921 | Bacteria | 3029 |
| 217 | Ga0496119_0015591 | 3300048922 | Bacteria | 5837 |
| 218 | Ga0496121_0006504 | 3300048924 | Bacteria | 14455 |
| 219 | Ga0501033_0207237 | 3300049570 | Bacteria | 1399 |
| 220 | Ga0501034_0376239 | 3300049571 | Bacteria | 1346 |
| 221 | Ga0501037_0202797 | 3300049573 | Bacteria | 1401 |
| 222 | Ga0501047_0049686 | 3300049581 | Bacteria | 4049 |
| 223 | Ga0501067_0036580 | 3300049583 | Bacteria | 2725 |
| 224 | Ga0501070_0138680 | 3300049586 | Bacteria | 2008 |
| 225 | Ga0501083_0219567 | 3300049744 | Bacteria | 1238 |
| 226 | Ga0501035_0008954 | 3300049822 | Bacteria | 9314 |
| 227 | nmdc:mga05p37_918142_c1 | 3300050507 | Bacteria | 941 |
| 228 | nmdc:mga09592_155646_c1 | 3300050508 | Bacteria | 1973 |
| 229 | nmdc:mga0qj67_158904_c1 | 3300050509 | Bacteria | 1835 |
| 230 | nmdc:mga06r32_171033_c1 | 3300050510 | Bacteria | 2157 |
| 231 | nmdc:mga08y16_624308_c1 | 3300050511 | Bacteria | 1084 |
| 232 | Ga0495601_0155538 | 3300053077 | Bacteria | 1493 |
| 233 | Ga0495601_0347853 | 3300053077 | Bacteria | 964 |
| 234 | Ga0495619_0011747 | 3300053085 | Bacteria | 5518 |
| 235 | Ga0495619_0228355 | 3300053085 | Bacteria | 1289 |
| 236 | Ga0500616_0075468 | 3300053153 | Bacteria | 1706 |
| 237 | Ga0501084_0080500 | 3300054114 | Bacteria | 2731 |
| 238 | Ga0501084_0192611 | 3300054114 | Bacteria | 1720 |
| 239 | Ga0501082_0570126 | 3300060353 | Bacteria | 990 |
| 240 | 2528213909 | 2527291629 | Bacteria | 5267418 |
| 241 | 2546948777 | 2546825537 | Bacteria | 5389291 |
| 242 | 2579747907 | 2576861822 | Bacteria | 5004595 |
| 243 | 2686540680 | 2684623036 | Bacteria | 5199090 |
| 244 | 2710605313 | 2710264753 | Bacteria | 5455564 |
| 245 | 2774867618 | 2773857924 | Bacteria | 5256821 |
| 246 | 2775655739 | 2775506735 | Bacteria | 4556596 |
| 247 | 2791913767 | 2791354901 | Bacteria | 8322202 |
| 248 | 2808828473 | 2808606357 | Bacteria | 4466944 |
| 249 | 2808849717 | 2808606360 | Bacteria | 4404006 |
| 250 | 2808877692 | 2808606366 | Bacteria | 4415912 |
| 251 | 2808899138 | 2808606371 | Bacteria | 4251511 |
| 252 | 2812319817 | 2811994871 | Bacteria | 4497550 |
| 253 | 2812363821 | 2811994880 | Bacteria | 4147780 |
| 254 | 2905929444 | 2905926851 | Bacteria | 4423176 |
| 255 | 2945917557 | 2945916053 | Bacteria | 4555517 |
| 256 | 2946061387 | 2946059875 | Bacteria | 4386623 |
| 257 | Ga0157369_10085249 | |||
| 258 | Ga0055524_1019138 | |||
| 259 | Ga0070658_10247167 | |||
| 260 | Ga0070683_100135517 | |||
| 261 | Ga0070680_100012607 | |||
| 262 | Ga0070680_100252389 | |||
| 263 | Ga0070691_10000033 | |||
| 264 | Ga0070692_10117250 | |||
| 265 | Ga0070659_100023850 | |||
| 266 | Ga0070714_100055922 | |||
| 267 | Ga0070714_100485259 | |||
| 268 | Ga0070713_100028334 | |||
| 269 | Ga0070713_100082782 | |||
| 270 | Ga0070713_100216838 | |||
| 271 | Ga0070710_10010124 | |||
| 272 | Ga0070711_100007954 | |||
| 273 | Ga0070711_100029266 | |||
| 274 | Ga0070678_100159031 | |||
| 275 | Ga0070681_10114320 | |||
| 276 | Ga0070681_10132265 | |||
| 277 | Ga0070706_100002754 | |||
| 278 | Ga0070707_100001503 | |||
| 279 | Ga0070698_100000665 | |||
| 280 | Ga0070698_100005211 | |||
| 281 | Ga0070679_100035057 | |||
| 282 | Ga0068853_100001647 | |||
| 283 | Ga0070672_100015865 | |||
| 284 | Ga0070695_100008582 | |||
| 285 | Ga0070696_100211985 | |||
| 286 | Ga0068855_100009942 | |||
| 287 | Ga0070664_100370835 | |||
| 288 | Ga0068857_100002650 | |||
| 289 | Ga0068854_100025508 | |||
| 290 | Ga0068856_100001370 | |||
| 291 | Ga0068856_100153589 | |||
| 292 | Ga0068852_100008577 | |||
| 293 | Ga0068859_100016240 | |||
| 294 | Ga0068859_100406102 | |||
| 295 | Ga0068864_100141356 | |||
| 296 | Ga0068870_10009736 | |||
| 297 | Ga0068863_100011164 | |||
| 298 | Ga0068858_100000308 | |||
| 299 | Ga0068858_100010272 | |||
| 300 | Ga0068858_100290186 | |||
| 301 | Ga0068862_100023697 | |||
| 302 | Ga0081455_10007875 | |||
| 303 | Ga0070717_10004658 | |||
| 304 | Ga0070717_10228484 | |||
| 305 | Ga0070712_100001086 | |||
| 306 | Ga0075430_100017078 | |||
| 307 | Ga0075431_100135439 | |||
| 308 | Ga0075434_100001912 | |||
| 309 | Ga0075436_100003621 | |||
| 310 | Ga0075436_100005635 | |||
| 311 | Ga0097620_100016240 | |||
| 312 | Ga0097620_100406102 | |||
| 313 | Ga0075435_100004561 | |||
| 314 | Ga0099795_10073114 | |||
| 315 | Ga0105240_10003092 | |||
| 316 | Ga0105247_10001081 | |||
| 317 | Ga0105241_10002297 | |||
| 318 | Ga0105242_10814165 | |||
| 319 | Ga0105237_10000746 | |||
| 320 | Ga0105238_10007767 | |||
| 321 | Ga0157373_10001483 | |||
| 322 | Ga0157369_10002018 | |||
| 323 | Ga0157369_10027322 | |||
| 324 | Ga0157369_10072512 | |||
| 325 | Ga0157374_10055603 | |||
| 326 | Ga0157374_10462882 | |||
| 327 | Ga0157372_10007018 | |||
| 328 | Ga0163163_10032210 | |||
| 329 | Ga0157380_10154482 | |||
| 330 | Ga0157379_10000155 | |||
| 331 | Ga0157379_10001588 | |||
| 332 | Ga0157379_10002050 | |||
| 333 | Ga0157379_10016532 | |||
| 334 | Ga0206353_10786672 | |||
| 335 | Ga0213871_10011378 | |||
| 336 | Ga0213871_10019889 | |||
| 337 | Ga0228598_1012482 | |||
| 338 | Ga0207710_10000182 | |||
| 339 | Ga0207699_10058775 | |||
| 340 | Ga0207699_10670155 | |||
| 341 | Ga0207645_10002223 | |||
| 342 | Ga0207645_10120695 | |||
| 343 | Ga0207643_10003637 | |||
| 344 | Ga0207705_10081100 | |||
| 345 | Ga0207705_10194173 | |||
| 346 | Ga0207684_10000323 | |||
| 347 | Ga0207654_10033286 | |||
| 348 | Ga0207707_10109145 | |||
| 349 | Ga0207707_10456011 | |||
| 350 | Ga0207695_10000932 | |||
| 351 | Ga0207695_10016474 | |||
| 352 | Ga0207671_10023468 | |||
| 353 | Ga0207693_10000534 | |||
| 354 | Ga0207693_10001699 | |||
| 355 | Ga0207663_10084082 | |||
| 356 | Ga0207660_10049538 | |||
| 357 | Ga0207657_10008625 | |||
| 358 | Ga0207646_10000050 | |||
| 359 | Ga0207681_10187079 | |||
| 360 | Ga0207681_10250894 | |||
| 361 | Ga0207700_10506144 | |||
| 362 | Ga0207700_10623812 | |||
| 363 | Ga0207700_10725791 | |||
| 364 | Ga0207706_10001734 | |||
| 365 | Ga0207665_10092304 | |||
| 366 | Ga0207691_10008966 | |||
| 367 | Ga0207661_10002532 | |||
| 368 | Ga0207667_10004609 | |||
| 369 | Ga0207640_10071374 | |||
| 370 | Ga0207703_10000002 | |||
| 371 | Ga0207703_10025055 | |||
| 372 | Ga0207703_10082607 | |||
| 373 | Ga0207702_10149666 | |||
| 374 | Ga0207641_10004040 | |||
| 375 | Ga0207674_10000134 | |||
| 376 | Ga0209984_1002549 | |||
| 377 | Ga0210000_1022106 | |||
| 378 | Ga0209968_1014600 | |||
| 379 | Ga0209982_1027839 | |||
| 380 | Ga0209971_1003208 | |||
| 381 | Ga0207428_10015933 | |||
| 382 | Ga0268265_10297547 | |||
| 383 | Ga0265318_10000842 | |||
| 384 | Ga0265338_10094783 | |||
| 385 | Ga0265332_10152532 | |||
| 386 | Ga0265325_10000365 | |||
| 387 | Ga0265325_10021329 | |||
| 388 | Ga0265340_10104630 | |||
| 389 | Ga0265339_10003492 | |||
| 390 | Ga0265331_10005470 | |||
| 391 | Ga0265316_10061901 | |||
| 392 | Ga0307408_100016981 | |||
| 393 | Ga0265313_10000968 | |||
| 394 | Ga0265313_10001041 | |||
| 395 | Ga0265313_10002198 | |||
| 396 | Ga0265313_10010226 | |||
| 397 | Ga0265314_10007761 | |||
| 398 | Ga0265314_10074315 | |||
| 399 | Ga0265314_10086230 | |||
| 400 | Ga0316576_10000050 | |||
| 401 | Ga0307412_10290880 | |||
| 402 | Ga0307409_100001174 | |||
| 403 | Ga0307409_100335771 | |||
| 404 | Ga0307416_100000713 | |||
| 405 | Ga0307415_100000057 | |||
| 406 | Ga0373923_0098567 | |||
| 407 | Ga0373923_0110549 | |||
| 408 | Ga0373953_0023278 | |||
| 409 | Ga0373954_0044554 | |||
| 410 | Ga0373955_0051130 | |||
| 411 | Ga0373931_0428032 | |||
| 412 | Ga0373935_0127543 | |||
| 413 | Ga0373927_0020522 | |||
| 414 | Ga0373933_0002892 | |||
| 415 | Ga0373933_0053621 | |||
| 416 | Ga0373937_0011720 | |||
| 417 | Ga0373937_0064903 | |||
| 418 | Ga0373937_0145335 | |||
| 419 | Ga0316582_0479218 | |||
| 420 | Ga0316584_0000463 | |||
| 421 | Ga0373925_0019125 | |||
| 422 | Ga0373925_0132134 | |||
| 423 | Ga0395899_0108743 | |||
| 424 | Ga0395900_0122872 | |||
| 425 | Ga0395900_0146054 | |||
| 426 | Ga0395898_0092038 | |||
| 427 | Ga0395898_0154333 | |||
| 428 | Ga0316581_0031434 | |||
| 429 | Ga0395901_0035489 | |||
| 430 | Ga0436365_1464616 | |||
| 431 | Ga0436360_0820330 | |||
| 432 | Ga0436360_0988725 | |||
| 433 | Ga0436360_1037385 | |||
| 434 | Ga0436362_0424286 | |||
| 435 | Ga0436362_0622811 | |||
| 436 | Ga0436362_0671700 | |||
| 437 | Ga0436362_1168339 | |||
| 438 | Ga0451797_0954949 | |||
| 439 | Ga0439450_042058 | |||
| 440 | Ga0439464_0046619 | |||
| 441 | Ga0439440_0000698 | |||
| 442 | Ga0466964_0038347 | |||
| 443 | Ga0466964_0166874 | |||
| 444 | Ga0495592_0041857 | |||
| 445 | Ga0495651_0002900 | |||
| 446 | Ga0495608_0175442 | |||
| 447 | Ga0495628_0038324 | |||
| 448 | Ga0495628_0038924 | |||
| 449 | Ga0495632_0009273 | |||
| 450 | Ga0495652_0007579 | |||
| 451 | Ga0495587_0069346 | |||
| 452 | Ga0495645_0009981 | |||
| 453 | Ga0495645_0049926 | |||
| 454 | Ga0495667_0225854 | |||
| 455 | Ga0495635_0103699 | |||
| 456 | Ga0495657_0357471 | |||
| 457 | Ga0495646_0108256 | |||
| 458 | Ga0495600_0096665 | |||
| 459 | Ga0495604_0057716 | |||
| 460 | Ga0495674_0055085 | |||
| 461 | Ga0495680_0145035 | |||
| 462 | Ga0496101_0968545 | |||
| 463 | Ga0496102_0541714 | |||
| 464 | Ga0496104_0012795 | |||
| 465 | Ga0496106_0244134 | |||
| 466 | Ga0496106_0445115 | |||
| 467 | Ga0496108_0013296 | |||
| 468 | Ga0496111_0137852 | |||
| 469 | Ga0496112_0118443 | |||
| 470 | Ga0496113_0140273 | |||
| 471 | Ga0496114_0091128 | |||
| 472 | Ga0496118_0054485 | |||
| 473 | Ga0496119_0015591 | |||
| 474 | Ga0496121_0006504 | |||
| 475 | Ga0501033_0207237 | |||
| 476 | Ga0501034_0376239 | |||
| 477 | Ga0501037_0202797 | |||
| 478 | Ga0501047_0049686 | |||
| 479 | Ga0501067_0036580 | |||
| 480 | Ga0501070_0138680 | |||
| 481 | Ga0501083_0219567 | |||
| 482 | Ga0501035_0008954 | |||
| 483 | nmdc:mga05p37_918142_c1 | |||
| 484 | nmdc:mga09592_155646_c1 | |||
| 485 | nmdc:mga0qj67_158904_c1 | |||
| 486 | nmdc:mga06r32_171033_c1 | |||
| 487 | nmdc:mga08y16_624308_c1 | |||
| 488 | Ga0495601_0155538 | |||
| 489 | Ga0495601_0347853 | |||
| 490 | Ga0495619_0011747 | |||
| 491 | Ga0495619_0228355 | |||
| 492 | Ga0500616_0075468 | |||
| 493 | Ga0501084_0080500 | |||
| 494 | Ga0501084_0192611 | |||
| 495 | Ga0501082_0570126 | |||
| 496 | 2528213909 | |||
| 497 | 2546948777 | |||
| 498 | 2579747907 | |||
| 499 | 2686540680 | |||
| 500 | 2710605313 | |||
| 501 | 2774867618 | |||
| 502 | 2775655739 | |||
| 503 | 2791913767 | |||
| 504 | 2808828473 | |||
| 505 | 2808849717 | |||
| 506 | 2808877692 | |||
| 507 | 2808899138 | |||
| 508 | 2812319817 | |||
| 509 | 2812363821 | |||
| 510 | 2905929444 | |||
| 511 | 2945917557 | |||
| 512 | 2946061387 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2abk-assembly1.cif.gz_A | refinement of the native structure of endonuclease iii to a resolution of 1.85 angstrom | 0.9833 | 31 | 238 |
| 2abk-assembly1.cif.gz_A | refinement of the native structure of endonuclease iii to a resolution of 1.85 angstrom | 0.965 | 31 | 238 |
| 1p59-assembly1.cif.gz_A | structure of a non-covalent endonuclease iii-dna complex | 0.9119 | 31 | 234 |
| 1orp-assembly1.cif.gz_A | structure of a trapped endonuclease iii-dna covalent intermediate: estranged-adenine complex | 0.9088 | 31 | 234 |
| 1kea-assembly1.cif.gz_A | structure of a thermostable thymine-dna glycosylase | 0.8823 | 34 | 233 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AB83_21_132_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9932 | 51 | 162 | 1.10.340.30 |
| af_P0AB83_21_132_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9845 | 51 | 162 | 1.10.340.30 |
| af_P0AB83_133_208_1.10.1670.10 | Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) | 0.98 | 164 | 238 | 1.10.1670.10 |
| af_Q4CY47_40_146_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9762 | 59 | 156 | 1.10.340.30 |
| af_Q58030_26_127_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.976 | 61 | 160 | 1.10.340.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S6N9H2-F1-model_v4 | Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) | 0.9974 | 33 | 239 |
GO:0003677
GO:0004519 GO:0006285 GO:0019104 GO:0046872 GO:0051539 GO:0140078 |
| AF-A0A3C0TRN7-F1-model_v4 | Endonuclease III | 0.9959 | 31 | 201 |
GO:0003677
GO:0003906 GO:0004519 GO:0006285 GO:0019104 GO:0046872 GO:0051539 |
| AF-A0A6N8A6Y0-F1-model_v4 | Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) | 0.9953 | 31 | 240 |
GO:0003677
GO:0004519 GO:0006285 GO:0019104 GO:0046872 GO:0051539 GO:0140078 |
| AF-A0A7Y2TQ52-F1-model_v4 | Endonuclease III | 0.995 | 31 | 220 |
GO:0003677
GO:0003906 GO:0004519 GO:0006285 GO:0019104 GO:0046872 GO:0051539 |
| AF-A0A2N8MFA7-F1-model_v4 | Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) | 0.9949 | 31 | 240 |
GO:0003677
GO:0004519 GO:0006285 GO:0019104 GO:0046872 GO:0051539 GO:0140078 |