F366492

General Info

Members Datasets Scaffolds Average Seq Length
256 169 237 207

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10058878|Ga0157371_100588782
Length 244
Sequence MAYFFTLPGYIFTIVLMGDDLYLWTITLSFTFVNPHTMFLHYSPFWLKIFFPHYTWHVKTKEKSIFLTFDDGPIPDITEFVLDTLEQFDAKATFFCIGDNVRKHPSVFKKIINEGHSIGNHTFNHLNGWKSQDHEYLANIDLCEKELNLETNLFRPPYGRMKKSQAAQLPKEKKIVMWDVLSGDFSLAIKPEICLKKTIQYTRPGSIVLFHDSLKAAKNMQYALPRFLDHFANKEYQFKALPMC

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541284 Pedobacter sp. YR016 Isolate Unclassified
3 2738543023 Pedobacter sp. OK628 Isolate Unclassified
4 2739367651 Pedobacter sp. OK291 Isolate Unclassified
5 2739367656 Pedobacter sp. CF523 Isolate Unclassified
6 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
7 2818991437 Pedobacter terrae 518 Isolate Unclassified
8 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
9 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
10 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
11 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
12 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
13 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
14 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
15 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
16 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
17 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
18 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
19 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
20 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
25 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
26 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
113 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
114 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
146 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
147 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
151 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
152 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
153 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
154 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
155 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
156 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
157 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
158 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
159 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
160 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
161 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
162 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
165 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
169 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.19
Metatranscriptomes 0
Isolates 7.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.98
Nodule 0
Rhizoplane 1.17
Rhizosphere 76.56
Stem 0
Stem Tuber 0
Unclassified 13.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000528 3300001990 Bacteria 13415
2 JGI24735J21928_10000007 3300002067 Bacteria 333510
3 JGI24744J21845_10005924 3300002077 Bacteria 2535
4 JGI25162J39368_1000016 3300002737 Bacteria 288734
5 JGI25152J39213_1000772 3300002773 Bacteria 16164
6 JGI25150J39212_1000011 3300002774 Bacteria 195312
7 JGI25151J46595_10000033 3300003187 Bacteria 195312
8 JGI25153J46596_10000052 3300003215 Bacteria 139303
9 rootH1_10000302 3300003316 Bacteria 11059
10 rootH1_10004197 3300003316 Bacteria 14457
11 rootH1_10162790 3300003316 Bacteria 1637
12 rootH2_10026325 3300003320 Bacteria 23971
13 rootH2_10060599 3300003320 Bacteria 4821
14 rootH2_10101517 3300003320 Bacteria 3114
15 rootL2_10002438 3300003322 Bacteria 15805
16 rootL2_10025493 3300003322 Bacteria 8179
17 rootL2_10047136 3300003322 Bacteria 1368
18 rootL2_10223453 3300003322 Bacteria 1706
19 rootL2_10260758 3300003322 Bacteria 2664
20 rootL2_10273147 3300003322 Bacteria 1503
21 rootH1_10008439 3300003316 Bacteria 6239
22 rootH1_10008439 3300003323 Bacteria 31430
23 rootH1_10055176 3300003323 Bacteria 4052
24 rootH1_10059073 3300003323 Bacteria 1283
25 rootH1_10063258 3300003323 Bacteria 1024
26 rootH1_10304997 3300003323 Bacteria 1190
27 rootH1_10341654 3300003323 Bacteria 2130
28 Ga0065165_1002196 3300005262 Bacteria 17506
29 Ga0065714_10003616 3300005288 Bacteria 11736
30 Ga0065714_10003768 3300005288 Bacteria 6155
31 Ga0065714_10064671 3300005288 Bacteria 24582
32 Ga0065714_10078419 3300005288 Bacteria 2600
33 Ga0065714_10148417 3300005288 Bacteria 1105
34 Ga0065714_10192910 3300005288 Bacteria 920
35 Ga0065704_10102375 3300005289 Bacteria 2207
36 Ga0065704_10252212 3300005289 Bacteria 986
37 Ga0070676_10001224 3300005328 Bacteria 12899
38 Ga0070671_100117933 3300005355 Bacteria 2232
39 Ga0070673_100022769 3300005364 Bacteria 4566
40 Ga0070678_100002097 3300005456 Bacteria 10806
41 Ga0068867_100029853 3300005459 Bacteria 3930
42 Ga0068853_100011406 3300005539 Bacteria 7218
43 Ga0068853_100017625 3300005539 Bacteria 5894
44 Ga0068855_100132233 3300005563 Unclassified 2849
45 Ga0068855_100147692 3300005563 Bacteria 2675
46 Ga0068855_100251725 3300005563 Bacteria 1970
47 Ga0068855_100410033 3300005563 Unclassified 1484
48 Ga0068854_100016067 3300005578 Bacteria 4979
49 Ga0068854_100084479 3300005578 Bacteria 2349
50 Ga0068852_100001434 3300005616 Bacteria 16085
51 Ga0068864_100608067 3300005618 Bacteria 1061
52 Ga0075366_10071397 3300006195 Bacteria 2068
53 Ga0075366_10130907 3300006195 Bacteria 1514
54 Ga0097621_100001229 3300006237 Bacteria 17742
55 Ga0068871_100000085 3300006358 Bacteria 53374
56 Ga0068865_100000143 3300006881 Bacteria 37973
57 Ga0105241_10212787 3300009174 Bacteria 1620
58 Ga0105242_10032109 3300009176 Bacteria 4198
59 Ga0105237_10002113 3300009545 Bacteria 25080
60 Ga0105238_10007080 3300009551 Bacteria 11223
61 Ga0105239_10001982 3300010375 Bacteria 26624
62 Ga0105239_10145162 3300010375 Bacteria 2646
63 Ga0105239_10891779 3300010375 Bacteria 1021
64 Ga0105246_10114456 3300011119 Bacteria 1987
65 Ga0157373_10005975 3300013100 Bacteria 9105
66 Ga0157373_10045640 3300013100 Bacteria 3128
67 Ga0157371_10026050 3300013102 Bacteria 4255
68 Ga0157371_10028650 3300013102 Bacteria 4031
69 Ga0157371_10058878 3300013102 Bacteria 2725
70 Ga0157370_10219280 3300013104 Bacteria 1762
71 Ga0157370_10278127 3300013104 Bacteria 1547
72 Ga0157370_10618105 3300013104 Unclassified 991
73 Ga0157370_10648575 3300013104 Bacteria 965
74 Ga0157369_10000016 3300013105 Bacteria 257827
75 Ga0157369_10193110 3300013105 Bacteria 2138
76 Ga0157374_10011694 3300013296 Bacteria 7613
77 Ga0157374_10318162 3300013296 Bacteria 1542
78 Ga0157378_10136557 3300013297 Bacteria 2274
79 Ga0163162_10002585 3300013306 Bacteria 17137
80 Ga0163162_10004696 3300013306 Bacteria 13174
81 Ga0163162_10821828 3300013306 Bacteria 1046
82 Ga0157372_10002401 3300013307 Bacteria 20287
83 Ga0157372_10031664 3300013307 Bacteria 5791
84 Ga0157372_10052976 3300013307 Bacteria 4520
85 Ga0157372_10708616 3300013307 Bacteria 1171
86 Ga0157375_10132422 3300013308 Bacteria 2614
87 Ga0182008_10000034 3300014497 Bacteria 138235
88 Ga0182008_10000584 3300014497 Bacteria 26876
89 Ga0157379_10717713 3300014968 Bacteria 939
90 Ga0157376_10571303 3300014969 Bacteria 1122
91 Ga0182006_1000122 3300015261 Bacteria 83269
92 Ga0182006_1002002 3300015261 Bacteria 11478
93 Ga0182007_10000002 3300015262 Bacteria 564661
94 Ga0183373_1004 3300015682 Bacteria 537398
95 Ga0163161_10000752 3300017792 Bacteria 25480
96 Ga0163161_10003858 3300017792 Bacteria 10511
97 Ga0163161_10008861 3300017792 Bacteria 6957
98 Ga0163161_10294977 3300017792 Bacteria 1275
99 Ga0163161_10375315 3300017792 Bacteria 1135
100 Ga0209437_100119 3300025233 Bacteria 206549
101 Ga0207425_1000003 3300025245 Bacteria 1145342
102 Ga0209129_1000076 3300025258 Bacteria 195353
103 Ga0209129_1009430 3300025258 Bacteria 2573
104 Ga0209025_1000007 3300025294 Bacteria 1145109
105 Ga0209758_1000114 3300025297 Bacteria 199324
106 Ga0209050_1011204 3300025298 Bacteria 4290
107 Ga0207647_10011951 3300025904 Bacteria 6062
108 Ga0207645_10234208 3300025907 Bacteria 1212
109 Ga0207654_10117584 3300025911 Bacteria 1664
110 Ga0207695_10038587 3300025913 Bacteria 5140
111 Ga0207671_10000318 3300025914 Bacteria 71076
112 Ga0207671_10002980 3300025914 Bacteria 17367
113 Ga0207671_10048118 3300025914 Bacteria 3156
114 Ga0207694_10162195 3300025924 Bacteria 1806
115 Ga0207704_10000143 3300025938 Bacteria 38321
116 Ga0207667_10029275 3300025949 Bacteria 5973
117 Ga0207667_10141970 3300025949 Bacteria 2473
118 Ga0207667_10209716 3300025949 Bacteria 1997
119 Ga0207651_10001183 3300025960 Bacteria 11708
120 Ga0207640_10014367 3300025981 Bacteria 4557
121 Ga0207640_10023222 3300025981 Bacteria 3725
122 Ga0207677_10113751 3300026023 Bacteria 2021
123 Ga0207648_10030116 3300026089 Bacteria 4811
124 Ga0207674_10961910 3300026116 Unclassified 823
125 Ga0207698_10126415 3300026142 Bacteria 2175
126 Ga0307517_10001656 3300028786 Bacteria 36804
127 Ga0307515_10030140 3300028794 Bacteria 9129
128 Ga0307515_10429258 3300028794 Bacteria 940
129 Ga0265331_10046041 3300031250 Bacteria 2104
130 Ga0307513_10237451 3300031456 Bacteria 1631
131 Ga0307509_10229031 3300031507 Bacteria 1663
132 Ga0307408_100001346 3300031548 Bacteria 18412
133 Ga0307408_100002342 3300031548 Bacteria 13408
134 Ga0307408_100002694 3300031548 Bacteria 12318
135 Ga0265314_10035166 3300031711 Bacteria 3654
136 Ga0307405_10000006 3300031731 Bacteria 361477
137 Ga0307407_10000003 3300031903 Bacteria 271723
138 Ga0307407_10469250 3300031903 Bacteria 917
139 Ga0307412_10004308 3300031911 Bacteria 7931
140 Ga0307412_10076800 3300031911 Bacteria 2296
141 Ga0307412_10589452 3300031911 Bacteria 940
142 Ga0307416_100000002 3300032002 Bacteria 509907
143 Ga0307414_10000679 3300032004 Bacteria 17429
144 Ga0307414_10001906 3300032004 Bacteria 10789
145 Ga0307414_10009866 3300032004 Bacteria 5506
146 Ga0307414_10020520 3300032004 Bacteria 4120
147 Ga0307414_10053976 3300032004 Bacteria 2806
148 Ga0307414_10100634 3300032004 Bacteria 2174
149 Ga0307414_10163230 3300032004 Bacteria 1772
150 Ga0307414_10169539 3300032004 Unclassified 1743
151 Ga0307414_10410700 3300032004 Bacteria 1178
152 Ga0307414_10456614 3300032004 Bacteria 1122
153 Ga0307510_10000714 3300033180 Bacteria 34043
154 Ga0316574_0021811 3300035398 Bacteria 3806
155 Ga0373935_0346312 3300035692 Bacteria 1059
156 Ga0395899_0191411 3300037312 Bacteria 1431
157 Ga0395900_0039435 3300037418 Bacteria 4866
158 Ga0395898_0049058 3300037466 Bacteria 4138
159 Ga0395905_0001448 3300037471 Bacteria 28528
160 Ga0395905_0772759 3300037471 Unclassified 863
161 Ga0395901_0001552 3300038443 Bacteria 23803
162 Ga0395901_0180932 3300038443 Unclassified 2211
163 Ga0451793_0617413 3300041452 Bacteria 1135
164 Ga0439457_013497 3300042014 Bacteria 1836
165 Ga0450893_0021423 3300042532 Bacteria 1116
166 Ga0451577_0023959 3300042876 Bacteria 5559
167 Ga0451577_0216643 3300042876 Bacteria 1730
168 Ga0453684_0001359 3300044712 Bacteria 71348
169 Ga0453684_0002810 3300044712 Bacteria 41144
170 Ga0453684_0103623 3300044712 Bacteria 3476
171 Ga0451576_0012596 3300045051 Bacteria 9494
172 Ga0451576_0621242 3300045051 Unclassified 1135
173 Ga0495627_001422 3300046453 Bacteria 14085
174 Ga0495638_0000006 3300046460 Bacteria 668846
175 Ga0495638_0170545 3300046460 Bacteria 1249
176 Ga0495650_0000081 3300046471 Bacteria 240957
177 Ga0495585_0000036 3300046492 Bacteria 135914
178 Ga0495606_0000034 3300046507 Bacteria 247705
179 Ga0495606_0006336 3300046507 Bacteria 10946
180 Ga0495606_0028388 3300046507 Bacteria 3948
181 Ga0495610_0000294 3300046512 Bacteria 52522
182 Ga0495610_0000517 3300046512 Bacteria 38786
183 Ga0495610_0006345 3300046512 Bacteria 8170
184 Ga0495616_0001684 3300046513 Bacteria 15088
185 Ga0495616_0003755 3300046513 Bacteria 9689
186 Ga0495631_0011907 3300046518 Bacteria 4264
187 Ga0495632_0070718 3300046519 Bacteria 1678
188 Ga0495637_0073363 3300046520 Bacteria 1377
189 Ga0495663_0038091 3300046525 Bacteria 1452
190 Ga0495652_0096761 3300046529 Bacteria 2403
191 Ga0495633_0119565 3300046558 Bacteria 1220
192 Ga0495668_0396625 3300046616 Bacteria 758
193 Ga0495625_0000049 3300046660 Bacteria 197646
194 Ga0495625_0022567 3300046660 Bacteria 4824
195 Ga0495625_0078602 3300046660 Bacteria 2302
196 Ga0495661_0001086 3300046665 Bacteria 23886
197 Ga0495661_0042474 3300046665 Bacteria 2802
198 Ga0495671_0101770 3300046692 Bacteria 1404
199 Ga0495649_0000014 3300046694 Bacteria 287408
200 Ga0495649_0029048 3300046694 Bacteria 3063
201 Ga0495660_0013375 3300046810 Bacteria 4757
202 Ga0495636_0000112 3300047318 Bacteria 33923
203 Ga0495683_0030491 3300047323 Bacteria 2751
204 Ga0495687_017658 3300047443 Bacteria 3548
205 Ga0495679_040148 3300047446 Bacteria 1456
206 Ga0495673_0018844 3300047469 Bacteria 3471
207 Ga0495681_0015864 3300047470 Bacteria 4251
208 Ga0495686_0001830 3300047472 Bacteria 21394
209 Ga0495686_0081551 3300047472 Bacteria 1975
210 Ga0495686_0084775 3300047472 Bacteria 1931
211 Ga0496115_0724037 3300048918 Unclassified 780
212 Ga0495678_003380 3300049459 Bacteria 9932
213 Ga0495682_0032961 3300049460 Bacteria 1913
214 Ga0501300_004673 3300049523 Bacteria 2025
215 Ga0501033_0190923 3300049570 Bacteria 1466
216 Ga0501043_0068939 3300049579 Bacteria 2778
217 Ga0501198_023263 3300049649 Bacteria 997
218 Ga0501202_005783 3300049652 Bacteria 2196
219 Ga0501206_032204 3300049653 Bacteria 784
220 Ga0501217_001326 3300049661 Bacteria 4606
221 Ga0501235_028535 3300049669 Bacteria 1254
222 Ga0501236_000045 3300049670 Bacteria 11108
223 Ga0501238_008014 3300049671 Bacteria 1382
224 Ga0501239_006963 3300049672 Bacteria 1173
225 Ga0501261_008750 3300049690 Bacteria 1311
226 Ga0501245_006043 3300049708 Bacteria 1686
227 Ga0501241_001898 3300049758 Bacteria 4108
228 Ga0501264_000002 3300049761 Bacteria 40456
229 Ga0501266_001818 3300049763 Bacteria 2695
230 Ga0500651_0077497 3300053093 Bacteria 2062
231 Ga0500608_000468 3300053122 Bacteria 15101
232 Ga0500618_000018 3300053125 Bacteria 163272
233 Ga0500616_0000044 3300053153 Bacteria 339611
234 Ga0500616_0172957 3300053153 Bacteria 979
235 Ga0500622_0005710 3300053156 Bacteria 7396
236 Ga0500624_000821 3300053157 Bacteria 7125
237 Ga0500627_0066880 3300053158 Bacteria 1588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005578 Ga0068854_100016067 Ga0068854_1000160672 186
2 3300025914 Ga0207671_10000318 Ga0207671_1000031812 186
3 3300025981 Ga0207640_10014367 Ga0207640_100143674 186
4 3300026116 Ga0207674_10961910 Ga0207674_109619102 186
5 3300005563 Ga0068855_100132233 Ga0068855_1001322332 189
6 3300010375 Ga0105239_10891779 Ga0105239_108917791 189
7 3300026089 Ga0207648_10030116 Ga0207648_100301163 189
8 3300013307 Ga0157372_10052976 Ga0157372_100529765 190
9 3300025913 Ga0207695_10038587 Ga0207695_100385874 190
10 iso_pu_bacteria 2954016120 2954021444 191
11 3300031903 Ga0307407_10000003 Ga0307407_1000000386 196
12 3300032002 Ga0307416_100000002 Ga0307416_100000002332 196
13 3300032004 Ga0307414_10163230 Ga0307414_101632302 196
14 3300005563 Ga0068855_100251725 Ga0068855_1002517252 197
15 3300013100 Ga0157373_10045640 Ga0157373_100456402 197
16 3300013104 Ga0157370_10278127 Ga0157370_102781272 197
17 3300013105 Ga0157369_10000016 Ga0157369_10000016146 197
18 3300013306 Ga0163162_10004696 Ga0163162_100046965 197
19 3300013307 Ga0157372_10708616 Ga0157372_107086162 197
20 3300014497 Ga0182008_10000584 Ga0182008_100005846 197
21 3300015261 Ga0182006_1002002 Ga0182006_10020023 197
22 3300015262 Ga0182007_10000002 Ga0182007_10000002344 197
23 3300017792 Ga0163161_10003858 Ga0163161_100038587 197
24 3300025949 Ga0207667_10209716 Ga0207667_102097162 197
25 3300046507 Ga0495606_0028388 Ga0495606_0028388_2105_2782 197
26 3300047318 Ga0495636_0000112 Ga0495636_0000112_13838_14437 197
27 3300003320 rootH2_10060599 rootH2_100605997 198
28 3300046558 Ga0495633_0119565 Ga0495633_0119565_304_981 198
29 3300025298 Ga0209050_1011204 Ga0209050_10112042 199
30 3300046460 Ga0495638_0000006 Ga0495638_0000006_248020_248640 199
31 3300053153 Ga0500616_0000044 Ga0500616_0000044_1356_1976 199
32 3300003316 rootH1_10162790 rootH1_101627902 200
33 3300003322 rootL2_10223453 rootL2_102234532 200
34 3300003322 rootL2_10273147 rootL2_102731472 200
35 3300003323 rootH1_10304997 rootH1_103049972 200
36 3300017792 Ga0163161_10000752 Ga0163161_1000075212 200
37 3300031507 Ga0307509_10229031 Ga0307509_102290312 200
38 3300042876 Ga0451577_0023959 Ga0451577_0023959_1118_1753 200
39 3300044712 Ga0453684_0002810 Ga0453684_0002810_32977_33612 200
40 3300045051 Ga0451576_0012596 Ga0451576_0012596_5771_6406 200
41 3300053153 Ga0500616_0172957 Ga0500616_0172957_22_648 200
42 3300053156 Ga0500622_0005710 Ga0500622_0005710_281_907 200
43 3300003322 rootL2_10025493 rootL2_100254936 201
44 3300003323 rootH1_10055176 rootH1_100551762 201
45 3300005618 Ga0068864_100608067 Ga0068864_1006080672 201
46 3300013102 Ga0157371_10058878 Ga0157371_100588782 201
47 3300031456 Ga0307513_10237451 Ga0307513_102374512 201
48 3300035692 Ga0373935_0346312 Ga0373935_0346312_410_1039 201
49 3300046519 Ga0495632_0070718 Ga0495632_0070718_102_731 201
50 iso_pu_bacteria 2738541284 2738762147 201
51 iso_pu_bacteria 2738543023 2739303458 201
52 iso_pu_bacteria 2739367651 2739588039 201
53 iso_pu_bacteria 2739367656 2739614323 201
54 iso_pu_bacteria 2775506987 2776615226 201
55 iso_pu_bacteria 2818991437 2819545912 201
56 iso_pu_bacteria 2833640130 2833642098 201
57 iso_pu_bacteria 2842722452 2842724186 201
58 iso_pu_bacteria 2842909656 2842913677 201
59 iso_pu_bacteria 2849281842 2849282496 201
60 iso_pu_bacteria 2902048731 2902050381 201
61 iso_pu_bacteria 2904445276 2904449147 201
62 iso_pu_bacteria 2919186247 2919189117 201
63 iso_pu_bacteria 2939664404 2939666728 201
64 3300003316 rootH1_10000302 rootH1_1000030210 202
65 3300003320 rootH2_10026325 rootH2_1002632511 202
66 3300003322 rootL2_10002438 rootL2_100024385 202
67 3300003322 rootL2_10047136 rootL2_100471362 202
68 3300003323 rootH1_10008439 rootH1_1000843928 202
69 3300003323 rootH1_10341654 rootH1_103416542 202
70 3300005262 Ga0065165_1002196 Ga0065165_100219616 202
71 3300013296 Ga0157374_10318162 Ga0157374_103181621 202
72 3300013297 Ga0157378_10136557 Ga0157378_101365572 202
73 3300032004 Ga0307414_10001906 Ga0307414_100019069 202
74 3300032004 Ga0307414_10009866 Ga0307414_100098663 202
75 3300032004 Ga0307414_10169539 Ga0307414_101695392 202
76 3300032004 Ga0307414_10410700 Ga0307414_104107002 202
77 3300032004 Ga0307414_10456614 Ga0307414_104566142 202
78 3300045051 Ga0451576_0621242 Ga0451576_0621242_478_1104 202
79 3300049570 Ga0501033_0190923 Ga0501033_0190923_669_1277 202
80 3300053158 Ga0500627_0066880 Ga0500627_0066880_668_1303 202
81 iso_pu_bacteria 2599185184 2599479878 202
82 iso_pu_bacteria 2919437846 2919440506 202
83 iso_pu_bacteria 2928078545 2928081007 202
84 iso_pu_bacteria 2928147474 2928152576 202
85 iso_pu_bacteria 2932082852 2932087373 202
86 3300013104 Ga0157370_10618105 Ga0157370_106181051 203
87 3300031250 Ga0265331_10046041 Ga0265331_100460412 203
88 3300031711 Ga0265314_10035166 Ga0265314_100351664 203
89 3300032004 Ga0307414_10000679 Ga0307414_1000067915 203
90 3300035398 Ga0316574_0021811 Ga0316574_0021811_1475_2116 203
91 3300038443 Ga0395901_0180932 Ga0395901_0180932_167_784 203
92 3300042532 Ga0450893_0021423 Ga0450893_0021423_232_882 203
93 3300044712 Ga0453684_0103623 Ga0453684_0103623_2197_2808 203
94 3300049523 Ga0501300_004673 Ga0501300_004673_382_1032 203
95 3300049661 Ga0501217_001326 Ga0501217_001326_3739_4389 203
96 3300049670 Ga0501236_000045 Ga0501236_000045_1152_1802 203
97 3300049671 Ga0501238_008014 Ga0501238_008014_32_682 203
98 3300049761 Ga0501264_000002 Ga0501264_000002_26236_26886 203
99 3300005288 Ga0065714_10078419 Ga0065714_100784193 204
100 3300042876 Ga0451577_0216643 Ga0451577_0216643_147_776 204
101 3300044712 Ga0453684_0001359 Ga0453684_0001359_16731_17360 204
102 3300046453 Ga0495627_001422 Ga0495627_001422_7309_7950 204
103 3300002077 JGI24744J21845_10005924 JGI24744J21845_100059242 205
104 3300002773 JGI25152J39213_1000772 JGI25152J39213_10007729 205
105 3300002774 JGI25150J39212_1000011 JGI25150J39212_1000011106 205
106 3300003187 JGI25151J46595_10000033 JGI25151J46595_10000033106 205
107 3300003215 JGI25153J46596_10000052 JGI25153J46596_1000005220 205
108 3300003323 rootH1_10059073 rootH1_100590731 205
109 3300005288 Ga0065714_10003616 Ga0065714_100036162 205
110 3300005288 Ga0065714_10003768 Ga0065714_100037681 205
111 3300005288 Ga0065714_10064671 Ga0065714_100646719 205
112 3300005288 Ga0065714_10148417 Ga0065714_101484171 205
113 3300005288 Ga0065714_10192910 Ga0065714_101929101 205
114 3300005289 Ga0065704_10102375 Ga0065704_101023752 205
115 3300005289 Ga0065704_10252212 Ga0065704_102522122 205
116 3300005328 Ga0070676_10001224 Ga0070676_1000122414 205
117 3300005364 Ga0070673_100022769 Ga0070673_1000227692 205
118 3300005456 Ga0070678_100002097 Ga0070678_1000020978 205
119 3300005459 Ga0068867_100029853 Ga0068867_1000298533 205
120 3300005539 Ga0068853_100011406 Ga0068853_1000114066 205
121 3300005616 Ga0068852_100001434 Ga0068852_1000014348 205
122 3300006237 Ga0097621_100001229 Ga0097621_1000012293 205
123 3300006358 Ga0068871_100000085 Ga0068871_1000000853 205
124 3300006881 Ga0068865_100000143 Ga0068865_10000014339 205
125 3300009174 Ga0105241_10212787 Ga0105241_102127871 205
126 3300009176 Ga0105242_10032109 Ga0105242_100321094 205
127 3300009545 Ga0105237_10002113 Ga0105237_100021137 205
128 3300009551 Ga0105238_10007080 Ga0105238_100070802 205
129 3300011119 Ga0105246_10114456 Ga0105246_101144563 205
130 3300013100 Ga0157373_10005975 Ga0157373_100059756 205
131 3300013102 Ga0157371_10028650 Ga0157371_100286504 205
132 3300013104 Ga0157370_10219280 Ga0157370_102192801 205
133 3300013296 Ga0157374_10011694 Ga0157374_100116942 205
134 3300013307 Ga0157372_10031664 Ga0157372_100316642 205
135 3300013308 Ga0157375_10132422 Ga0157375_101324223 205
136 3300014497 Ga0182008_10000034 Ga0182008_1000003447 205
137 3300014969 Ga0157376_10571303 Ga0157376_105713031 205
138 3300015261 Ga0182006_1000122 Ga0182006_100012271 205
139 3300015682 Ga0183373_1004 Ga0183373_1004132 205
140 3300017792 Ga0163161_10294977 Ga0163161_102949771 205
141 3300017792 Ga0163161_10375315 Ga0163161_103753151 205
142 3300025245 Ga0207425_1000003 Ga0207425_1000003933 205
143 3300025258 Ga0209129_1000076 Ga0209129_1000076101 205
144 3300025294 Ga0209025_1000007 Ga0209025_1000007932 205
145 3300025297 Ga0209758_1000114 Ga0209758_100011465 205
146 3300025907 Ga0207645_10234208 Ga0207645_102342082 205
147 3300025911 Ga0207654_10117584 Ga0207654_101175842 205
148 3300025914 Ga0207671_10048118 Ga0207671_100481183 205
149 3300025924 Ga0207694_10162195 Ga0207694_101621952 205
150 3300025938 Ga0207704_10000143 Ga0207704_1000014336 205
151 3300025960 Ga0207651_10001183 Ga0207651_1000118310 205
152 3300026023 Ga0207677_10113751 Ga0207677_101137512 205
153 3300026142 Ga0207698_10126415 Ga0207698_101264152 205
154 3300028794 Ga0307515_10030140 Ga0307515_100301403 205
155 3300031548 Ga0307408_100001346 Ga0307408_1000013467 205
156 3300031548 Ga0307408_100002342 Ga0307408_1000023427 205
157 3300031548 Ga0307408_100002694 Ga0307408_1000026948 205
158 3300031731 Ga0307405_10000006 Ga0307405_10000006153 205
159 3300031903 Ga0307407_10469250 Ga0307407_104692501 205
160 3300031911 Ga0307412_10004308 Ga0307412_100043082 205
161 3300031911 Ga0307412_10076800 Ga0307412_100768002 205
162 3300031911 Ga0307412_10589452 Ga0307412_105894522 205
163 3300032004 Ga0307414_10020520 Ga0307414_100205202 205
164 3300032004 Ga0307414_10053976 Ga0307414_100539761 205
165 3300032004 Ga0307414_10100634 Ga0307414_101006342 205
166 3300041452 Ga0451793_0617413 Ga0451793_0617413_345_1022 205
167 3300042014 Ga0439457_013497 Ga0439457_013497_1160_1777 205
168 3300046512 Ga0495610_0000294 Ga0495610_0000294_42652_43320 205
169 3300046512 Ga0495610_0000517 Ga0495610_0000517_29588_30256 205
170 3300046525 Ga0495663_0038091 Ga0495663_0038091_45_713 205
171 3300046694 Ga0495649_0029048 Ga0495649_0029048_832_1449 205
172 3300047470 Ga0495681_0015864 Ga0495681_0015864_530_1198 205
173 3300049460 Ga0495682_0032961 Ga0495682_0032961_363_980 205
174 3300049758 Ga0501241_001898 Ga0501241_001898_630_1247 205
175 3300053093 Ga0500651_0077497 Ga0500651_0077497_1236_1853 205
176 3300053122 Ga0500608_000468 Ga0500608_000468_14461_15078 205
177 3300001990 JGI24737J22298_10000528 JGI24737J22298_100005283 206
178 3300002067 JGI24735J21928_10000007 JGI24735J21928_1000000784 206
179 3300002737 JGI25162J39368_1000016 JGI25162J39368_1000016154 206
180 3300003316 rootH1_10004197 rootH1_100041979 206
181 3300003320 rootH2_10101517 rootH2_101015173 206
182 3300003322 rootL2_10260758 rootL2_102607583 206
183 3300003323 rootH1_10063258 rootH1_100632582 206
184 3300005355 Ga0070671_100117933 Ga0070671_1001179332 206
185 3300005539 Ga0068853_100017625 Ga0068853_1000176254 206
186 3300005563 Ga0068855_100147692 Ga0068855_1001476922 206
187 3300005563 Ga0068855_100410033 Ga0068855_1004100332 206
188 3300005578 Ga0068854_100084479 Ga0068854_1000844792 206
189 3300006195 Ga0075366_10071397 Ga0075366_100713972 206
190 3300006195 Ga0075366_10130907 Ga0075366_101309072 206
191 3300010375 Ga0105239_10001982 Ga0105239_1000198222 206
192 3300010375 Ga0105239_10145162 Ga0105239_101451622 206
193 3300013102 Ga0157371_10026050 Ga0157371_100260505 206
194 3300013104 Ga0157370_10648575 Ga0157370_106485751 206
195 3300013105 Ga0157369_10193110 Ga0157369_101931102 206
196 3300013306 Ga0163162_10002585 Ga0163162_1000258516 206
197 3300013306 Ga0163162_10821828 Ga0163162_108218282 206
198 3300013307 Ga0157372_10002401 Ga0157372_1000240112 206
199 3300014968 Ga0157379_10717713 Ga0157379_107177131 206
200 3300017792 Ga0163161_10008861 Ga0163161_100088613 206
201 3300025233 Ga0209437_100119 Ga0209437_10011971 206
202 3300025258 Ga0209129_1009430 Ga0209129_10094303 206
203 3300025904 Ga0207647_10011951 Ga0207647_100119515 206
204 3300025914 Ga0207671_10002980 Ga0207671_1000298012 206
205 3300025949 Ga0207667_10029275 Ga0207667_100292754 206
206 3300025949 Ga0207667_10141970 Ga0207667_101419702 206
207 3300025981 Ga0207640_10023222 Ga0207640_100232223 206
208 3300028786 Ga0307517_10001656 Ga0307517_1000165621 206
209 3300028794 Ga0307515_10429258 Ga0307515_104292581 206
210 3300033180 Ga0307510_10000714 Ga0307510_100007147 206
211 3300037312 Ga0395899_0191411 Ga0395899_0191411_68_691 206
212 3300037418 Ga0395900_0039435 Ga0395900_0039435_4169_4792 206
213 3300037466 Ga0395898_0049058 Ga0395898_0049058_2693_3316 206
214 3300037471 Ga0395905_0001448 Ga0395905_0001448_2534_3157 206
215 3300037471 Ga0395905_0772759 Ga0395905_0772759_217_852 206
216 3300038443 Ga0395901_0001552 Ga0395901_0001552_75_698 206
217 3300046460 Ga0495638_0170545 Ga0495638_0170545_230_853 206
218 3300046471 Ga0495650_0000081 Ga0495650_0000081_224574_225197 206
219 3300046492 Ga0495585_0000036 Ga0495585_0000036_128542_129165 206
220 3300046507 Ga0495606_0000034 Ga0495606_0000034_238889_239512 206
221 3300046507 Ga0495606_0006336 Ga0495606_0006336_3393_4016 206
222 3300046512 Ga0495610_0006345 Ga0495610_0006345_1999_2622 206
223 3300046513 Ga0495616_0001684 Ga0495616_0001684_4843_5466 206
224 3300046513 Ga0495616_0003755 Ga0495616_0003755_2668_3291 206
225 3300046518 Ga0495631_0011907 Ga0495631_0011907_3507_4130 206
226 3300046520 Ga0495637_0073363 Ga0495637_0073363_326_949 206
227 3300046529 Ga0495652_0096761 Ga0495652_0096761_736_1356 206
228 3300046616 Ga0495668_0396625 Ga0495668_0396625_116_739 206
229 3300046660 Ga0495625_0000049 Ga0495625_0000049_169108_169731 206
230 3300046660 Ga0495625_0022567 Ga0495625_0022567_1435_2055 206
231 3300046660 Ga0495625_0078602 Ga0495625_0078602_214_837 206
232 3300046665 Ga0495661_0001086 Ga0495661_0001086_22729_23352 206
233 3300046665 Ga0495661_0042474 Ga0495661_0042474_1573_2196 206
234 3300046692 Ga0495671_0101770 Ga0495671_0101770_67_690 206
235 3300046694 Ga0495649_0000014 Ga0495649_0000014_27916_28539 206
236 3300046810 Ga0495660_0013375 Ga0495660_0013375_4032_4655 206
237 3300047323 Ga0495683_0030491 Ga0495683_0030491_1322_1945 206
238 3300047443 Ga0495687_017658 Ga0495687_017658_2155_2775 206
239 3300047446 Ga0495679_040148 Ga0495679_040148_406_1029 206
240 3300047469 Ga0495673_0018844 Ga0495673_0018844_2491_3114 206
241 3300047472 Ga0495686_0001830 Ga0495686_0001830_7514_8137 206
242 3300047472 Ga0495686_0081551 Ga0495686_0081551_874_1497 206
243 3300047472 Ga0495686_0084775 Ga0495686_0084775_493_1167 206
244 3300048918 Ga0496115_0724037 Ga0496115_0724037_101_748 206
245 3300049459 Ga0495678_003380 Ga0495678_003380_7393_8016 206
246 3300049579 Ga0501043_0068939 Ga0501043_0068939_110_763 206
247 3300049649 Ga0501198_023263 Ga0501198_023263_340_975 206
248 3300049652 Ga0501202_005783 Ga0501202_005783_223_858 206
249 3300049653 Ga0501206_032204 Ga0501206_032204_70_705 206
250 3300049669 Ga0501235_028535 Ga0501235_028535_26_661 206
251 3300049672 Ga0501239_006963 Ga0501239_006963_341_976 206
252 3300049690 Ga0501261_008750 Ga0501261_008750_609_1244 206
253 3300049708 Ga0501245_006043 Ga0501245_006043_51_686 206
254 3300049763 Ga0501266_001818 Ga0501266_001818_1019_1654 206
255 3300053125 Ga0500618_000018 Ga0500618_000018_59884_60510 206
256 3300053157 Ga0500624_000821 Ga0500624_000821_3212_3844 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

57

174

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m1b-assembly2.cif.gz_B structural determination of ba0150, a polysaccharide deacetylase from bacillus anthracis 0.9199 17 204
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.9071 27 204
5lgc-assembly1.cif.gz_A t48 deacetylase with substrate 0.8818 24 204
6h8n-assembly1.cif.gz_A structure of peptidoglycan deacetylase pdac from bacillus subtilis - mutant d285s 0.8817 21 205
2cc0-assembly1.cif.gz_B family 4 carbohydrate esterase from streptomyces lividans in complex with acetate 0.8809 27 202
ID Description Score Start End Superfamily
4m1bB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9199 17 204 3.20.20.370
2c1iA03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9158 28 205 3.20.20.370
af_O53444_35_232_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8871 22 205 3.20.20.370
5lgcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8818 24 204 3.20.20.370
2cc0B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8809 27 202 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A1N7DGT5-F1-model_v4 deleted 0.9994 1 206
AF-A0A519Y3Z5-F1-model_v4 Polysaccharide deacetylase family protein 0.9946 45 206 GO:0005975
GO:0016020
GO:0016810
AF-A0A1N7DGT5-F1-model_v4 deleted 0.9945 1 206
AF-A0A522YP35-F1-model_v4 deleted 0.9944 1 205
AF-A0A849UVL6-F1-model_v4 Polysaccharide deacetylase family protein 0.9901 1 205 GO:0005975
GO:0016020
GO:0016810

Feature Viewer

pLDDT pTM Quality
96.99 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map