F366392

General Info

Members Datasets Scaffolds Average Seq Length
256 181 512 132

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_101102276|Ga0075430_1011022761
Length 144
Sequence LAQHAEQTMENDEQAIRQLVATWMAATKAGDTDTVLSLMADDVVFLQAGNPPMIGKASFAAAAKAQAVHGAPRFDGKSEMQEIKVLGDWAFMWTRLTVVATPAGGGDSITRAGHTLSVLKKENGKWLLARDANMLAPVQGIGKH

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
141 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
142 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
167 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
179 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
180 2738543012 Acidovorax sp. CF301 Isolate Unclassified
181 2816332133 Acidovorax radicis 2721A Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 5.47
Rhizosphere 89.06
Stem 0
Stem Tuber 0
Unclassified 17.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_101102276 3300006846 Unclassified 654
2 rootL2_10024476 3300003322 Bacteria 6128
3 rootL2_10091193 3300003322 Bacteria 8319
4 Ga0065704_10190242 3300005289 Bacteria 1193
5 Ga0065712_10002147 3300005290 Bacteria 7579
6 Ga0065715_10088951 3300005293 Bacteria 21191
7 Ga0065707_10098846 3300005295 Plasmid 3049
8 Ga0070658_10541926 3300005327 Bacteria 1007
9 Ga0070676_10100445 3300005328 Unclassified 1786
10 Ga0070690_100065022 3300005330 Bacteria 2358
11 Ga0070670_100004195 3300005331 Bacteria 12063
12 Ga0070670_100775399 3300005331 Unclassified 865
13 Ga0070677_10150325 3300005333 Bacteria 1083
14 Ga0070677_10440260 3300005333 Bacteria 695
15 Ga0068869_100066290 3300005334 Bacteria 2660
16 Ga0068869_100456014 3300005334 Bacteria 1060
17 Ga0070666_10178672 3300005335 Bacteria 1488
18 Ga0070666_10192208 3300005335 Bacteria 1434
19 Ga0070682_100212032 3300005337 Bacteria 1373
20 Ga0068868_100085919 3300005338 Bacteria 2528
21 Ga0070689_100331433 3300005340 Bacteria 1273
22 Ga0070689_100744079 3300005340 Bacteria 859
23 Ga0070691_10120036 3300005341 Bacteria 1323
24 Ga0070691_10174879 3300005341 Bacteria 1114
25 Ga0070661_100091979 3300005344 Bacteria 2247
26 Ga0070668_100248436 3300005347 Bacteria 1476
27 Ga0070668_101737423 3300005347 Bacteria 573
28 Ga0070669_100603542 3300005353 Bacteria 920
29 Ga0070675_100003440 3300005354 Bacteria 11998
30 Ga0070675_100059211 3300005354 Bacteria 3159
31 Ga0070675_100585465 3300005354 Bacteria 1011
32 Ga0070671_100281159 3300005355 Unclassified 1415
33 Ga0070673_100105591 3300005364 Bacteria 2327
34 Ga0070673_100388020 3300005364 Bacteria 1246
35 Ga0070673_100871888 3300005364 Bacteria 834
36 Ga0070688_100917219 3300005365 Unclassified 692
37 Ga0070659_100683803 3300005366 Bacteria 886
38 Ga0070667_100521933 3300005367 Bacteria 1090
39 Ga0070709_10398243 3300005434 Bacteria 1027
40 Ga0070705_100133703 3300005440 Bacteria 1622
41 Ga0070694_100183000 3300005444 Bacteria 1551
42 Ga0070662_100419832 3300005457 Bacteria 1106
43 Ga0070681_10037545 3300005458 Bacteria 4860
44 Ga0070681_10177626 3300005458 Bacteria 2051
45 Ga0070685_11479388 3300005466 Unclassified 523
46 Ga0070679_100223492 3300005530 Bacteria 1843
47 Ga0070684_100254260 3300005535 Bacteria 1606
48 Ga0070672_100123222 3300005543 Unclassified 2124
49 Ga0070686_100436396 3300005544 Bacteria 1004
50 Ga0070695_100102987 3300005545 Bacteria 1925
51 Ga0070665_100294216 3300005548 Bacteria 1626
52 Ga0070704_101759617 3300005549 Unclassified 573
53 Ga0068855_100041474 3300005563 Bacteria 5455
54 Ga0068855_101373474 3300005563 Bacteria 729
55 Ga0070664_100004788 3300005564 Bacteria 10845
56 Ga0070664_101218628 3300005564 Bacteria 710
57 Ga0068857_100418157 3300005577 Bacteria 1249
58 Ga0068857_101080315 3300005577 Bacteria 774
59 Ga0068854_100811823 3300005578 Bacteria 816
60 Ga0068856_100097147 3300005614 Bacteria 2934
61 Ga0068856_101727930 3300005614 Unclassified 638
62 Ga0070702_100026467 3300005615 Unclassified 3117
63 Ga0068852_100188317 3300005616 Bacteria 1945
64 Ga0068859_100043488 3300005617 Bacteria 4514
65 Ga0068859_101321651 3300005617 Bacteria 795
66 Ga0068864_100016774 3300005618 Bacteria 6103
67 Ga0068864_100279133 3300005618 Bacteria 1559
68 Ga0068861_101146399 3300005719 Unclassified 749
69 Ga0068863_100143888 3300005841 Bacteria 2280
70 Ga0068863_100445784 3300005841 Bacteria 1270
71 Ga0068858_100515771 3300005842 Bacteria 1156
72 Ga0068860_100039587 3300005843 Bacteria 4509
73 Ga0068860_100458513 3300005843 Bacteria 1268
74 Ga0068862_100484736 3300005844 Unclassified 1171
75 Ga0081540_1083466 3300005983 Unclassified 1429
76 Ga0070712_100385027 3300006175 Bacteria 1155
77 Ga0097621_100731708 3300006237 Bacteria 913
78 Ga0097621_101815520 3300006237 Bacteria 581
79 Ga0075428_100643402 3300006844 Bacteria 1131
80 Ga0075431_100477321 3300006847 Bacteria 1240
81 Ga0075431_100644961 3300006847 Bacteria 1040
82 Ga0075433_10533027 3300006852 Bacteria 1033
83 Ga0075433_11795269 3300006852 Bacteria 527
84 Ga0075434_100006205 3300006871 Bacteria 10949
85 Ga0075429_100779059 3300006880 Unclassified 838
86 Ga0075429_100802963 3300006880 Bacteria 824
87 Ga0075429_100933782 3300006880 Unclassified 759
88 Ga0068865_101144816 3300006881 Bacteria 687
89 Ga0075436_100595857 3300006914 Bacteria 814
90 Ga0097620_100043487 3300006931 Bacteria 4514
91 Ga0097620_101321588 3300006931 Bacteria 795
92 Ga0075435_100128855 3300007076 Bacteria 2116
93 Ga0111539_10110030 3300009094 Bacteria 3233
94 Ga0111539_10397593 3300009094 Bacteria 1605
95 Ga0105245_10016310 3300009098 Bacteria 6477
96 Ga0105245_12336310 3300009098 Bacteria 588
97 Ga0114129_10165597 3300009147 Unclassified 3017
98 Ga0105241_10299023 3300009174 Bacteria 1381
99 Ga0105242_10358056 3300009176 Bacteria 1350
100 Ga0105242_10458712 3300009176 Unclassified 1203
101 Ga0105248_10948575 3300009177 Bacteria 972
102 Ga0105237_10503045 3300009545 Unclassified 1218
103 Ga0105237_10665030 3300009545 Bacteria 1048
104 Ga0105238_10746768 3300009551 Bacteria 992
105 Ga0105238_11458885 3300009551 Bacteria 712
106 Ga0105249_11001828 3300009553 Bacteria 904
107 Ga0105239_11875277 3300010375 Unclassified 695
108 Ga0105246_10008458 3300011119 Bacteria 6325
109 Ga0157346_1009448 3300012480 Bacteria 690
110 Ga0157373_10435201 3300013100 Unclassified 942
111 Ga0157373_10485881 3300013100 Bacteria 891
112 Ga0157371_10486870 3300013102 Bacteria 910
113 Ga0157371_11437866 3300013102 Unclassified 536
114 Ga0157370_10383751 3300013104 Bacteria 1294
115 Ga0157369_10006080 3300013105 Bacteria 14008
116 Ga0157374_10008549 3300013296 Bacteria 8754
117 Ga0157378_10125900 3300013297 Bacteria 2366
118 Ga0157378_10716480 3300013297 Bacteria 1021
119 Ga0157378_11254067 3300013297 Bacteria 782
120 Ga0163162_10088280 3300013306 Bacteria 3180
121 Ga0163162_10772537 3300013306 Bacteria 1079
122 Ga0157372_10073074 3300013307 Bacteria 3865
123 Ga0157372_10689884 3300013307 Bacteria 1188
124 Ga0157375_10048830 3300013308 Bacteria 4143
125 Ga0157375_10525266 3300013308 Bacteria 1346
126 Ga0157375_10567987 3300013308 Bacteria 1295
127 Ga0157375_12156550 3300013308 Bacteria 663
128 Ga0163163_10315816 3300014325 Bacteria 1616
129 Ga0157380_11059998 3300014326 Bacteria 847
130 Ga0157379_10181904 3300014968 Bacteria 1899
131 Ga0157379_10495295 3300014968 Bacteria 1132
132 Ga0157379_10852619 3300014968 Bacteria 862
133 Ga0157379_11277782 3300014968 Unclassified 708
134 Ga0157376_10867202 3300014969 Bacteria 919
135 Ga0207697_10010141 3300025315 Bacteria 4041
136 Ga0207682_10024850 3300025893 Bacteria 2375
137 Ga0207688_10411994 3300025901 Bacteria 839
138 Ga0207699_11052398 3300025906 Bacteria 602
139 Ga0207645_10213017 3300025907 Bacteria 1273
140 Ga0207705_10167361 3300025909 Bacteria 1654
141 Ga0207654_10353120 3300025911 Bacteria 1013
142 Ga0207707_10021166 3300025912 Bacteria 5684
143 Ga0207671_10898267 3300025914 Unclassified 700
144 Ga0207693_10504359 3300025915 Bacteria 944
145 Ga0207660_10115700 3300025917 Bacteria 2024
146 Ga0207662_10010299 3300025918 Bacteria 5161
147 Ga0207649_10279559 3300025920 Bacteria 1213
148 Ga0207652_10075536 3300025921 Bacteria 2937
149 Ga0207694_11038169 3300025924 Bacteria 694
150 Ga0207650_10005371 3300025925 Bacteria 8741
151 Ga0207650_10739255 3300025925 Bacteria 832
152 Ga0207659_10283814 3300025926 Bacteria 1354
153 Ga0207659_10453376 3300025926 Unclassified 1080
154 Ga0207659_10954126 3300025926 Bacteria 738
155 Ga0207659_10967397 3300025926 Bacteria 732
156 Ga0207659_11234085 3300025926 Unclassified 642
157 Ga0207687_10050852 3300025927 Bacteria 2887
158 Ga0207644_10167913 3300025931 Bacteria 1711
159 Ga0207644_10265182 3300025931 Unclassified 1375
160 Ga0207690_10235484 3300025932 Unclassified 1408
161 Ga0207706_10002871 3300025933 Bacteria 16704
162 Ga0207706_10786244 3300025933 Bacteria 809
163 Ga0207686_10248602 3300025934 Unclassified 1298
164 Ga0207670_10274778 3300025936 Bacteria 1311
165 Ga0207691_10109095 3300025940 Bacteria 2462
166 Ga0207689_10351783 3300025942 Bacteria 1225
167 Ga0207679_10030174 3300025945 Bacteria 3784
168 Ga0207667_10026790 3300025949 Bacteria 6290
169 Ga0207651_10010409 3300025960 Bacteria 5156
170 Ga0207668_10917328 3300025972 Bacteria 780
171 Ga0207640_10088509 3300025981 Bacteria 2138
172 Ga0207640_11472738 3300025981 Bacteria 611
173 Ga0207677_10276402 3300026023 Bacteria 1376
174 Ga0207703_10520745 3300026035 Bacteria 1118
175 Ga0207702_10168449 3300026078 Bacteria 2006
176 Ga0207641_10471972 3300026088 Bacteria 1215
177 Ga0207648_10559563 3300026089 Bacteria 1051
178 Ga0207676_11809635 3300026095 Bacteria 609
179 Ga0207674_10063832 3300026116 Bacteria 3716
180 Ga0207674_10255666 3300026116 Bacteria 1699
181 Ga0207675_100043053 3300026118 Bacteria 4216
182 Ga0207675_100253072 3300026118 Bacteria 1705
183 Ga0207683_10233389 3300026121 Bacteria 1678
184 Ga0207683_11746715 3300026121 Unclassified 571
185 Ga0268266_10721539 3300028379 Bacteria 961
186 Ga0268265_10253707 3300028380 Bacteria 1560
187 Ga0268265_11099642 3300028380 Bacteria 789
188 Ga0268264_10048078 3300028381 Bacteria 3548
189 Ga0307515_10026315 3300028794 Bacteria 10022
190 Ga0307513_10021830 3300031456 Bacteria 7546
191 Ga0307513_10102368 3300031456 Bacteria 2883
192 Ga0307513_10234003 3300031456 Bacteria 1648
193 Ga0307509_10000088 3300031507 Bacteria 126453
194 Ga0307509_10074891 3300031507 Bacteria 3518
195 Ga0307516_10010285 3300031730 Bacteria 10303
196 Ga0373929_0000004 3300035085 Bacteria 462745
197 Ga0373931_0004057 3300035691 Bacteria 6639
198 Ga0395905_0000138 3300037471 Bacteria 120373
199 Ga0451789_0226268 3300041443 Unclassified 502
200 Ga0451789_1274985 3300041443 Unclassified 550
201 Ga0451793_1313413 3300041452 Bacteria 669
202 Ga0451797_1303606 3300041453 Unclassified 535
203 Ga0451807_0432196 3300041486 Unclassified 970
204 Ga0451843_1159258 3300041509 Unclassified 506
205 Ga0453684_1260265 3300044712 Bacteria 773
206 Ga0451576_0289836 3300045051 Bacteria 1711
207 Ga0451576_0800481 3300045051 Unclassified 990
208 Ga0495590_0045999 3300046457 Bacteria 1522
209 Ga0495590_0181880 3300046457 Unclassified 769
210 Ga0495638_0018265 3300046460 Bacteria 4660
211 Ga0495638_0163238 3300046460 Bacteria 1284
212 Ga0495585_0279085 3300046492 Bacteria 826
213 Ga0495632_0046358 3300046519 Unclassified 2160
214 Ga0495597_0014431 3300046542 Bacteria 3763
215 Ga0495597_0147713 3300046542 Bacteria 966
216 Ga0495622_0056454 3300046557 Bacteria 1821
217 Ga0495668_0049928 3300046616 Bacteria 2320
218 Ga0495668_0562852 3300046616 Unclassified 629
219 Ga0495625_0306755 3300046660 Bacteria 1014
220 Ga0495625_0370497 3300046660 Bacteria 901
221 Ga0495624_0050093 3300046690 Bacteria 2647
222 Ga0495589_0406206 3300046794 Unclassified 625
223 Ga0495687_000454 3300047443 Bacteria 50500
224 Ga0495686_0434244 3300047472 Bacteria 700
225 Ga0495626_0060522 3300048091 Bacteria 1725
226 Ga0495626_0066330 3300048091 Bacteria 1632
227 Ga0495626_0160759 3300048091 Unclassified 942
228 Ga0496102_0753904 3300048905 Bacteria 896
229 Ga0496102_1387298 3300048905 Bacteria 622
230 Ga0496104_0337150 3300048907 Bacteria 1421
231 Ga0496104_0566923 3300048907 Unclassified 1046
232 Ga0496109_0232586 3300048912 Unclassified 1734
233 Ga0496111_0895718 3300048914 Bacteria 639
234 Ga0496112_0007027 3300048915 Bacteria 9943
235 Ga0496112_0012155 3300048915 Bacteria 7901
236 Ga0496115_0025235 3300048918 Bacteria 4627
237 Ga0495678_097590 3300049459 Bacteria 1023
238 Ga0495682_0113293 3300049460 Bacteria 972
239 Ga0501075_0036274 3300049591 Bacteria 3680
240 Ga0501075_0986186 3300049591 Bacteria 640
241 Ga0501079_0156943 3300049741 Bacteria 1774
242 Ga0501081_0151180 3300049743 Bacteria 1668
243 Ga0501035_0815111 3300049822 Bacteria 745
244 nmdc:mga09592_1068701_c1 3300050508 Unclassified 672
245 nmdc:mga09592_662109_c1 3300050508 Bacteria 891
246 nmdc:mga09592_926985_c1 3300050508 Unclassified 731
247 nmdc:mga06r32_1907997_c1 3300050510 Bacteria 528
248 nmdc:mga0n895_364327_c1 3300050512 Bacteria 1463
249 nmdc:mga0n895_98495_c1 3300050512 Unclassified 2931
250 nmdc:mga0rr50_28565_c1 3300050513 Bacteria 3922
251 nmdc:mga08x19_541798_c1 3300050514 Bacteria 823
252 nmdc:mga0a205_675211_c1 3300050515 Bacteria 884
253 nmdc:mga0sz30_46195_c1 3300050516 Bacteria 1838
254 Ga0500643_021078 3300053087 Bacteria 2118
255 2739242776 2738543012 Bacteria 7115078
256 2816472909 2816332133 Bacteria 7249298
257 Ga0075430_101102276
258 rootL2_10024476
259 rootL2_10091193
260 Ga0065704_10190242
261 Ga0065712_10002147
262 Ga0065715_10088951
263 Ga0065707_10098846
264 Ga0070658_10541926
265 Ga0070676_10100445
266 Ga0070690_100065022
267 Ga0070670_100004195
268 Ga0070670_100775399
269 Ga0070677_10150325
270 Ga0070677_10440260
271 Ga0068869_100066290
272 Ga0068869_100456014
273 Ga0070666_10178672
274 Ga0070666_10192208
275 Ga0070682_100212032
276 Ga0068868_100085919
277 Ga0070689_100331433
278 Ga0070689_100744079
279 Ga0070691_10120036
280 Ga0070691_10174879
281 Ga0070661_100091979
282 Ga0070668_100248436
283 Ga0070668_101737423
284 Ga0070669_100603542
285 Ga0070675_100003440
286 Ga0070675_100059211
287 Ga0070675_100585465
288 Ga0070671_100281159
289 Ga0070673_100105591
290 Ga0070673_100388020
291 Ga0070673_100871888
292 Ga0070688_100917219
293 Ga0070659_100683803
294 Ga0070667_100521933
295 Ga0070709_10398243
296 Ga0070705_100133703
297 Ga0070694_100183000
298 Ga0070662_100419832
299 Ga0070681_10037545
300 Ga0070681_10177626
301 Ga0070685_11479388
302 Ga0070679_100223492
303 Ga0070684_100254260
304 Ga0070672_100123222
305 Ga0070686_100436396
306 Ga0070695_100102987
307 Ga0070665_100294216
308 Ga0070704_101759617
309 Ga0068855_100041474
310 Ga0068855_101373474
311 Ga0070664_100004788
312 Ga0070664_101218628
313 Ga0068857_100418157
314 Ga0068857_101080315
315 Ga0068854_100811823
316 Ga0068856_100097147
317 Ga0068856_101727930
318 Ga0070702_100026467
319 Ga0068852_100188317
320 Ga0068859_100043488
321 Ga0068859_101321651
322 Ga0068864_100016774
323 Ga0068864_100279133
324 Ga0068861_101146399
325 Ga0068863_100143888
326 Ga0068863_100445784
327 Ga0068858_100515771
328 Ga0068860_100039587
329 Ga0068860_100458513
330 Ga0068862_100484736
331 Ga0081540_1083466
332 Ga0070712_100385027
333 Ga0097621_100731708
334 Ga0097621_101815520
335 Ga0075428_100643402
336 Ga0075431_100477321
337 Ga0075431_100644961
338 Ga0075433_10533027
339 Ga0075433_11795269
340 Ga0075434_100006205
341 Ga0075429_100779059
342 Ga0075429_100802963
343 Ga0075429_100933782
344 Ga0068865_101144816
345 Ga0075436_100595857
346 Ga0097620_100043487
347 Ga0097620_101321588
348 Ga0075435_100128855
349 Ga0111539_10110030
350 Ga0111539_10397593
351 Ga0105245_10016310
352 Ga0105245_12336310
353 Ga0114129_10165597
354 Ga0105241_10299023
355 Ga0105242_10358056
356 Ga0105242_10458712
357 Ga0105248_10948575
358 Ga0105237_10503045
359 Ga0105237_10665030
360 Ga0105238_10746768
361 Ga0105238_11458885
362 Ga0105249_11001828
363 Ga0105239_11875277
364 Ga0105246_10008458
365 Ga0157346_1009448
366 Ga0157373_10435201
367 Ga0157373_10485881
368 Ga0157371_10486870
369 Ga0157371_11437866
370 Ga0157370_10383751
371 Ga0157369_10006080
372 Ga0157374_10008549
373 Ga0157378_10125900
374 Ga0157378_10716480
375 Ga0157378_11254067
376 Ga0163162_10088280
377 Ga0163162_10772537
378 Ga0157372_10073074
379 Ga0157372_10689884
380 Ga0157375_10048830
381 Ga0157375_10525266
382 Ga0157375_10567987
383 Ga0157375_12156550
384 Ga0163163_10315816
385 Ga0157380_11059998
386 Ga0157379_10181904
387 Ga0157379_10495295
388 Ga0157379_10852619
389 Ga0157379_11277782
390 Ga0157376_10867202
391 Ga0207697_10010141
392 Ga0207682_10024850
393 Ga0207688_10411994
394 Ga0207699_11052398
395 Ga0207645_10213017
396 Ga0207705_10167361
397 Ga0207654_10353120
398 Ga0207707_10021166
399 Ga0207671_10898267
400 Ga0207693_10504359
401 Ga0207660_10115700
402 Ga0207662_10010299
403 Ga0207649_10279559
404 Ga0207652_10075536
405 Ga0207694_11038169
406 Ga0207650_10005371
407 Ga0207650_10739255
408 Ga0207659_10283814
409 Ga0207659_10453376
410 Ga0207659_10954126
411 Ga0207659_10967397
412 Ga0207659_11234085
413 Ga0207687_10050852
414 Ga0207644_10167913
415 Ga0207644_10265182
416 Ga0207690_10235484
417 Ga0207706_10002871
418 Ga0207706_10786244
419 Ga0207686_10248602
420 Ga0207670_10274778
421 Ga0207691_10109095
422 Ga0207689_10351783
423 Ga0207679_10030174
424 Ga0207667_10026790
425 Ga0207651_10010409
426 Ga0207668_10917328
427 Ga0207640_10088509
428 Ga0207640_11472738
429 Ga0207677_10276402
430 Ga0207703_10520745
431 Ga0207702_10168449
432 Ga0207641_10471972
433 Ga0207648_10559563
434 Ga0207676_11809635
435 Ga0207674_10063832
436 Ga0207674_10255666
437 Ga0207675_100043053
438 Ga0207675_100253072
439 Ga0207683_10233389
440 Ga0207683_11746715
441 Ga0268266_10721539
442 Ga0268265_10253707
443 Ga0268265_11099642
444 Ga0268264_10048078
445 Ga0307515_10026315
446 Ga0307513_10021830
447 Ga0307513_10102368
448 Ga0307513_10234003
449 Ga0307509_10000088
450 Ga0307509_10074891
451 Ga0307516_10010285
452 Ga0373929_0000004
453 Ga0373931_0004057
454 Ga0395905_0000138
455 Ga0451789_0226268
456 Ga0451789_1274985
457 Ga0451793_1313413
458 Ga0451797_1303606
459 Ga0451807_0432196
460 Ga0451843_1159258
461 Ga0453684_1260265
462 Ga0451576_0289836
463 Ga0451576_0800481
464 Ga0495590_0045999
465 Ga0495590_0181880
466 Ga0495638_0018265
467 Ga0495638_0163238
468 Ga0495585_0279085
469 Ga0495632_0046358
470 Ga0495597_0014431
471 Ga0495597_0147713
472 Ga0495622_0056454
473 Ga0495668_0049928
474 Ga0495668_0562852
475 Ga0495625_0306755
476 Ga0495625_0370497
477 Ga0495624_0050093
478 Ga0495589_0406206
479 Ga0495687_000454
480 Ga0495686_0434244
481 Ga0495626_0060522
482 Ga0495626_0066330
483 Ga0495626_0160759
484 Ga0496102_0753904
485 Ga0496102_1387298
486 Ga0496104_0337150
487 Ga0496104_0566923
488 Ga0496109_0232586
489 Ga0496111_0895718
490 Ga0496112_0007027
491 Ga0496112_0012155
492 Ga0496115_0025235
493 Ga0495678_097590
494 Ga0495682_0113293
495 Ga0501075_0036274
496 Ga0501075_0986186
497 Ga0501079_0156943
498 Ga0501081_0151180
499 Ga0501035_0815111
500 nmdc:mga09592_1068701_c1
501 nmdc:mga09592_662109_c1
502 nmdc:mga09592_926985_c1
503 nmdc:mga06r32_1907997_c1
504 nmdc:mga0n895_364327_c1
505 nmdc:mga0n895_98495_c1
506 nmdc:mga0rr50_28565_c1
507 nmdc:mga08x19_541798_c1
508 nmdc:mga0a205_675211_c1
509 nmdc:mga0sz30_46195_c1
510 Ga0500643_021078
511 2739242776
512 2816472909

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13577

SnoaL_4

SnoaL-like domain

9

130

0.92

PF14534

DUF4440

Domain of unknown function (DUF4440)

16

128

0.88

PF13474

SnoaL_3

SnoaL-like domain

16

131

0.87

PF12680

SnoaL_2

SnoaL-like domain

20

129

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.9373 4 129
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.9089 4 129
5ien-assembly2.cif.gz_B structure of cdl2.2, a computationally designed vitamin-d3 binder 0.8504 3 128
3ef8-assembly1.cif.gz_A crystal structure of putative scytalone dehydratase (yp_496742.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.845 4 130
5ien-assembly2.cif.gz_B structure of cdl2.2, a computationally designed vitamin-d3 binder 0.8441 3 128
ID Description Score Start End Superfamily
3robD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9432 4 129 3.10.450.50
3robD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9136 4 129 3.10.450.50
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8268 4 130 3.10.450.50
af_Q7KPV8_5_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8262 5 123 3.10.450.50
af_A0A078BPG0_5_119_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8248 6 127 3.10.450.50
ID Description Score Start End GO Terms
AF-F0G6I7-F1-model_v4 DUF4440 domain-containing protein 0.9727 66 130
AF-A0A517WFT3-F1-model_v4 SnoaL-like domain protein 0.9676 1 130
AF-A0A517WFT3-F1-model_v4 SnoaL-like domain protein 0.9531 1 130
AF-A0A2J7TF81-F1-model_v4 DUF4440 domain-containing protein 0.9498 1 130
AF-A0A1I7M5X7-F1-model_v4 DUF4440 domain-containing protein 0.9486 1 131

Map