F366373

General Info

Members Datasets Scaffolds Average Seq Length
256 168 512 135

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10576249|Ga0075364_105762492
Length 161
Sequence VICIGIGLMAETALSVWRSAAYDLSMDANFSSGPIIVFDAECILCSANAQFVLLHDRARRFRLASMQGETGAALYRRFGIDPADPETMIVVTGDRALRDSDAVLAIYDGLGWPWKAIGVFRLVPRLVRDPLYRLIARNRYRIFGKREACWVPSRDYADRML

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
88 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
89 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
90 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
91 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
102 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
106 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
114 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
118 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
119 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
152 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
153 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
154 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
155 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
156 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
161 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
162 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
163 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
164 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
165 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
166 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
167 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
168 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.44
Metatranscriptomes 0.39
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.67
Nodule 0.78
Rhizoplane 5.86
Rhizosphere 64.06
Stem 0
Stem Tuber 0
Unclassified 14.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10576249 3300006051 Bacteria 769
2 JGI24741J21665_1001830 3300001915 Bacteria 5817
3 JGI24740J21852_10013813 3300001979 Bacteria 2999
4 JGI24739J22299_10000353 3300001989 Bacteria 15747
5 JGI24739J22299_10065052 3300001989 Bacteria 1145
6 JGI24737J22298_10011998 3300001990 Bacteria 2830
7 JGI24737J22298_10183457 3300001990 Unclassified 617
8 JGI24735J21928_10006940 3300002067 Bacteria 3706
9 Ga0065165_1059675 3300005262 Unclassified 1049
10 Ga0065165_1065620 3300005262 Bacteria 979
11 Ga0070658_10031947 3300005327 Bacteria 4231
12 Ga0070670_100053692 3300005331 Bacteria 3460
13 Ga0070660_100278107 3300005339 Unclassified 1369
14 Ga0070661_100005256 3300005344 Bacteria 8915
15 Ga0070675_101131757 3300005354 Bacteria 720
16 Ga0070673_101210768 3300005364 Bacteria 708
17 Ga0070659_100025016 3300005366 Bacteria 4582
18 Ga0070659_100237130 3300005366 Unclassified 1508
19 Ga0070659_100439245 3300005366 Bacteria 1105
20 Ga0070663_100048622 3300005455 Unclassified 3008
21 Ga0070678_100648699 3300005456 Bacteria 947
22 Ga0070662_100097370 3300005457 Bacteria 2221
23 Ga0070684_100030094 3300005535 Bacteria 4610
24 Ga0068853_100087935 3300005539 Bacteria 2727
25 Ga0068853_101010886 3300005539 Unclassified 800
26 Ga0070665_100306214 3300005548 Bacteria 1592
27 Ga0068855_100174837 3300005563 Bacteria 2430
28 Ga0070664_100205530 3300005564 Bacteria 1758
29 Ga0068854_100268203 3300005578 Unclassified 1369
30 Ga0068854_100312182 3300005578 Bacteria 1275
31 Ga0068852_100095194 3300005616 Bacteria 2673
32 Ga0068852_100167651 3300005616 Unclassified 2056
33 Ga0068852_100171645 3300005616 Bacteria 2033
34 Ga0068851_10014614 3300005834 Bacteria 3728
35 Ga0075364_10002300 3300006051 Bacteria 10706
36 Ga0075364_10015928 3300006051 Bacteria 4668
37 Ga0075362_10036881 3300006177 Bacteria 2141
38 Ga0075369_10004993 3300006186 Bacteria 4938
39 Ga0075370_10007741 3300006353 Bacteria 5486
40 Ga0079104_1000015 3300006946 Bacteria 321803
41 Ga0105240_11015619 3300009093 Unclassified 886
42 Ga0105240_11624923 3300009093 Bacteria 676
43 Ga0105241_10006002 3300009174 Bacteria 8963
44 Ga0105241_10179551 3300009174 Bacteria 1755
45 Ga0105237_10147401 3300009545 Unclassified 2348
46 Ga0105238_10087921 3300009551 Bacteria 3094
47 Ga0157317_1002503 3300012475 Bacteria 1088
48 Ga0157373_10033109 3300013100 Bacteria 3720
49 Ga0157373_10074493 3300013100 Bacteria 2395
50 Ga0157371_10157374 3300013102 Bacteria 1622
51 Ga0157369_11322692 3300013105 Bacteria 734
52 Ga0157374_10491574 3300013296 Bacteria 1231
53 Ga0157372_10555760 3300013307 Unclassified 1338
54 Ga0206353_10433881 3300020082 Unclassified 579
55 Ga0213876_10000021 3300021384 Bacteria 260105
56 Ga0209674_111623 3300025226 Bacteria 890
57 Ga0209257_1009860 3300025304 Bacteria 4989
58 Ga0207656_10000858 3300025321 Bacteria 9930
59 Ga0207647_10077126 3300025904 Bacteria 2003
60 Ga0207647_10105088 3300025904 Unclassified 1673
61 Ga0207647_10746971 3300025904 Unclassified 530
62 Ga0207705_10000309 3300025909 Bacteria 45040
63 Ga0207654_10000363 3300025911 Bacteria 26735
64 Ga0207654_10783209 3300025911 Unclassified 688
65 Ga0207695_10020497 3300025913 Bacteria 7570
66 Ga0207695_11149445 3300025913 Unclassified 656
67 Ga0207671_10008227 3300025914 Bacteria 8880
68 Ga0207657_10020388 3300025919 Bacteria 6265
69 Ga0207649_10032329 3300025920 Bacteria 3118
70 Ga0207694_10006827 3300025924 Bacteria 8668
71 Ga0207694_10170964 3300025924 Bacteria 1759
72 Ga0207690_10047728 3300025932 Bacteria 2843
73 Ga0207690_10049400 3300025932 Bacteria 2804
74 Ga0207690_10268585 3300025932 Bacteria 1324
75 Ga0207706_10043889 3300025933 Bacteria 3962
76 Ga0207706_10050946 3300025933 Bacteria 3657
77 Ga0207686_10708612 3300025934 Bacteria 801
78 Ga0207669_10004808 3300025937 Bacteria 5993
79 Ga0207679_10259471 3300025945 Bacteria 1481
80 Ga0207667_10000001 3300025949 Bacteria 1178522
81 Ga0207640_10148038 3300025981 Unclassified 1721
82 Ga0207640_10313320 3300025981 Bacteria 1246
83 Ga0207658_10099557 3300025986 Bacteria 2274
84 Ga0207639_10002653 3300026041 Bacteria 12006
85 Ga0207639_10083835 3300026041 Bacteria 2531
86 Ga0207678_10008204 3300026067 Bacteria 9207
87 Ga0207702_10000963 3300026078 Bacteria 29605
88 Ga0207674_10018633 3300026116 Bacteria 7540
89 Ga0207683_10208288 3300026121 Bacteria 1779
90 Ga0207698_10001652 3300026142 Bacteria 13008
91 Ga0207698_10059167 3300026142 Bacteria 2973
92 Ga0207698_10073234 3300026142 Bacteria 2727
93 Ga0209281_1000034 3300027111 Bacteria 382562
94 Ga0268266_10262151 3300028379 Bacteria 1602
95 Ga0307517_10085675 3300028786 Bacteria 2637
96 Ga0307513_10047881 3300031456 Bacteria 4646
97 Ga0307408_100310544 3300031548 Bacteria 1324
98 Ga0307408_100425129 3300031548 Unclassified 1147
99 Ga0307405_10025977 3300031731 Bacteria 3370
100 Ga0307405_10074251 3300031731 Bacteria 2198
101 Ga0307405_10193420 3300031731 Bacteria 1471
102 Ga0307405_10894553 3300031731 Bacteria 750
103 Ga0307413_10231151 3300031824 Bacteria 1358
104 Ga0307410_10011328 3300031852 Bacteria 5095
105 Ga0307410_10746719 3300031852 Unclassified 828
106 Ga0307406_10036021 3300031901 Bacteria 3046
107 Ga0307406_10381428 3300031901 Bacteria 1111
108 Ga0307407_10064584 3300031903 Bacteria 2152
109 Ga0307412_10075188 3300031911 Bacteria 2316
110 Ga0307412_10155036 3300031911 Bacteria 1694
111 Ga0307412_10660375 3300031911 Unclassified 893
112 Ga0307409_100070911 3300031995 Bacteria 2768
113 Ga0307409_100396099 3300031995 Bacteria 1317
114 Ga0307416_101860707 3300032002 Unclassified 705
115 Ga0307414_10204393 3300032004 Bacteria 1609
116 Ga0307411_10001001 3300032005 Bacteria 10879
117 Ga0307411_11554523 3300032005 Unclassified 609
118 Ga0307415_100153871 3300032126 Bacteria 1773
119 Ga0307510_10091137 3300033180 Bacteria 2892
120 Ga0307510_10361926 3300033180 Bacteria 899
121 Ga0395900_0249751 3300037418 Bacteria 1776
122 Ga0436365_0618060 3300039437 Bacteria 25583
123 Ga0436362_0126459 3300039453 Bacteria 236400
124 Ga0451795_1324878 3300041456 Bacteria 669
125 Ga0451843_1383885 3300041509 Bacteria 564
126 Ga0439448_0114322 3300042005 Bacteria 924
127 Ga0495617_033276 3300046452 Bacteria 1730
128 Ga0495627_000631 3300046453 Bacteria 27818
129 Ga0495627_000781 3300046453 Bacteria 23497
130 Ga0495638_0185457 3300046460 Bacteria 1184
131 Ga0495650_0000628 3300046471 Bacteria 47433
132 Ga0495584_0077008 3300046491 Bacteria 1677
133 Ga0495585_0012251 3300046492 Bacteria 5052
134 Ga0495585_0145083 3300046492 Bacteria 1241
135 Ga0495596_0048832 3300046500 Bacteria 1659
136 Ga0495583_0025689 3300046506 Bacteria 2937
137 Ga0495583_0149807 3300046506 Bacteria 967
138 Ga0495606_0011152 3300046507 Bacteria 7362
139 Ga0495606_0067807 3300046507 Bacteria 2258
140 Ga0495606_0178899 3300046507 Unclassified 1224
141 Ga0495610_0005148 3300046512 Bacteria 9381
142 Ga0495616_0100414 3300046513 Bacteria 1358
143 Ga0495631_0063593 3300046518 Bacteria 1598
144 Ga0495631_0072657 3300046518 Bacteria 1486
145 Ga0495637_0231170 3300046520 Unclassified 670
146 Ga0495643_0009723 3300046522 Bacteria 5948
147 Ga0495643_0042001 3300046522 Bacteria 2492
148 Ga0495648_0000122 3300046524 Bacteria 93823
149 Ga0495648_0339359 3300046524 Unclassified 690
150 Ga0495663_0002676 3300046525 Bacteria 5310
151 Ga0495654_0000156 3300046530 Bacteria 68238
152 Ga0495654_0138480 3300046530 Bacteria 1086
153 Ga0495597_0152016 3300046542 Unclassified 949
154 Ga0495597_0355369 3300046542 Bacteria 562
155 Ga0495633_0004524 3300046558 Bacteria 8793
156 Ga0495633_0419705 3300046558 Unclassified 605
157 Ga0495668_0003244 3300046616 Bacteria 12389
158 Ga0495611_0021074 3300046648 Bacteria 2813
159 Ga0495611_0050231 3300046648 Bacteria 1878
160 Ga0495625_0009545 3300046660 Bacteria 8105
161 Ga0495625_0014086 3300046660 Bacteria 6399
162 Ga0495625_0061425 3300046660 Bacteria 2659
163 Ga0495625_0085438 3300046660 Bacteria 2190
164 Ga0495625_0227553 3300046660 Bacteria 1219
165 Ga0495625_0290854 3300046660 Bacteria 1048
166 Ga0495625_0788083 3300046660 Bacteria 554
167 Ga0495613_0532749 3300046689 Unclassified 788
168 Ga0495670_0131618 3300046691 Bacteria 1304
169 Ga0495671_0188354 3300046692 Bacteria 1002
170 Ga0495649_0013604 3300046694 Bacteria 4691
171 Ga0495600_0075435 3300046809 Bacteria 2202
172 Ga0495660_0088522 3300046810 Bacteria 1613
173 Ga0495683_0013104 3300047323 Bacteria 4341
174 Ga0495683_0015357 3300047323 Bacteria 3986
175 Ga0495687_005081 3300047443 Bacteria 8539
176 Ga0495687_007301 3300047443 Bacteria 6547
177 Ga0495673_0047716 3300047469 Bacteria 1891
178 Ga0495681_0000221 3300047470 Bacteria 47433
179 Ga0495681_0080364 3300047470 Bacteria 1456
180 Ga0495681_0199093 3300047470 Unclassified 813
181 Ga0495686_0015142 3300047472 Bacteria 5282
182 Ga0495686_0251535 3300047472 Bacteria 993
183 Ga0496100_0441048 3300048903 Unclassified 997
184 Ga0496102_0000201 3300048905 Bacteria 80907
185 Ga0496103_0000165 3300048906 Bacteria 69702
186 Ga0496104_0099657 3300048907 Unclassified 2781
187 Ga0496105_0002985 3300048908 Bacteria 12435
188 Ga0496106_0667328 3300048909 Unclassified 830
189 Ga0496107_0070309 3300048910 Bacteria 2541
190 Ga0496109_0119528 3300048912 Bacteria 2454
191 Ga0496110_0011254 3300048913 Bacteria 7314
192 Ga0496110_0645858 3300048913 Bacteria 958
193 Ga0496111_0053749 3300048914 Unclassified 2910
194 Ga0496113_0282476 3300048916 Unclassified 1327
195 Ga0496114_0028337 3300048917 Bacteria 4595
196 Ga0496115_0002872 3300048918 Bacteria 12404
197 Ga0496116_0000201 3300048919 Bacteria 115647
198 Ga0496116_0020689 3300048919 Bacteria 4989
199 Ga0496117_0000441 3300048920 Bacteria 69108
200 Ga0496117_0090532 3300048920 Bacteria 1971
201 Ga0496118_0000425 3300048921 Bacteria 70035
202 Ga0496118_0027305 3300048921 Bacteria 4836
203 Ga0496119_0008774 3300048922 Bacteria 8811
204 Ga0496121_0003571 3300048924 Bacteria 21984
205 Ga0496121_0008606 3300048924 Bacteria 11948
206 Ga0496122_0000533 3300048925 Bacteria 78884
207 Ga0496122_0015219 3300048925 Bacteria 7362
208 Ga0496122_0141504 3300048925 Bacteria 1504
209 Ga0496123_0000406 3300048926 Bacteria 78882
210 Ga0496123_0017821 3300048926 Bacteria 5688
211 Ga0496123_0340379 3300048926 Bacteria 701
212 Ga0496124_0000468 3300048927 Bacteria 69747
213 Ga0496124_0006719 3300048927 Bacteria 12445
214 Ga0496124_0038743 3300048927 Bacteria 4136
215 Ga0496124_0201409 3300048927 Bacteria 1513
216 Ga0496125_0005884 3300048928 Bacteria 13450
217 Ga0496125_0023287 3300048928 Bacteria 5720
218 Ga0496125_0026154 3300048928 Bacteria 5328
219 Ga0496125_0326522 3300048928 Bacteria 927
220 Ga0496125_0347529 3300048928 Unclassified 887
221 Ga0496125_0768614 3300048928 Bacteria 502
222 Ga0496126_0000298 3300048929 Bacteria 105872
223 Ga0496126_0000563 3300048929 Bacteria 71182
224 Ga0496126_0061111 3300048929 Bacteria 3386
225 Ga0496126_0095480 3300048929 Bacteria 2608
226 Ga0496126_0174521 3300048929 Bacteria 1829
227 Ga0501300_002954 3300049523 Bacteria 2536
228 Ga0501034_0497622 3300049571 Bacteria 1133
229 nmdc:mga00v17_380_c1 3300050491 Bacteria 16341
230 nmdc:mga00v17_9748_c1 3300050491 Bacteria 5214
231 nmdc:mga07m45_3128_c1 3300050496 Bacteria 7929
232 nmdc:mga0sz30_2316_c1 3300050516 Bacteria 6803
233 Ga0500610_0001078 3300053079 Bacteria 8965
234 Ga0500643_001096 3300053087 Bacteria 16262
235 Ga0500643_005175 3300053087 Bacteria 5689
236 Ga0500643_008401 3300053087 Bacteria 4060
237 Ga0500641_0046631 3300053096 Bacteria 1770
238 Ga0500556_0046511 3300053104 Bacteria 1553
239 Ga0500562_002707 3300053108 Bacteria 4405
240 Ga0500592_038002 3300053116 Unclassified 778
241 Ga0500595_003346 3300053119 Bacteria 7529
242 Ga0500595_017214 3300053119 Bacteria 2673
243 Ga0500607_109493 3300053121 Bacteria 1357
244 Ga0500618_070606 3300053125 Bacteria 784
245 Ga0500642_0000446 3300053130 Bacteria 13263
246 Ga0500658_0002592 3300053134 Bacteria 6987
247 Ga0500616_0003077 3300053153 Bacteria 13099
248 Ga0500616_0136619 3300053153 Bacteria 1151
249 Ga0500627_0000287 3300053158 Bacteria 14133
250 Ga0500627_0130554 3300053158 Bacteria 1135
251 Ga0500645_004841 3300053730 Bacteria 5077
252 Ga0500645_149231 3300053730 Unclassified 644
253 Ga0500661_027401 3300055283 Bacteria 1007
254 2738944081 2738541317 Bacteria 5340176
255 2913313591 2913308742 Bacteria 5350706
256 2989350069 2989349275 Bacteria 6349068
257 Ga0075364_10576249
258 JGI24741J21665_1001830
259 JGI24740J21852_10013813
260 JGI24739J22299_10000353
261 JGI24739J22299_10065052
262 JGI24737J22298_10011998
263 JGI24737J22298_10183457
264 JGI24735J21928_10006940
265 Ga0065165_1059675
266 Ga0065165_1065620
267 Ga0070658_10031947
268 Ga0070670_100053692
269 Ga0070660_100278107
270 Ga0070661_100005256
271 Ga0070675_101131757
272 Ga0070673_101210768
273 Ga0070659_100025016
274 Ga0070659_100237130
275 Ga0070659_100439245
276 Ga0070663_100048622
277 Ga0070678_100648699
278 Ga0070662_100097370
279 Ga0070684_100030094
280 Ga0068853_100087935
281 Ga0068853_101010886
282 Ga0070665_100306214
283 Ga0068855_100174837
284 Ga0070664_100205530
285 Ga0068854_100268203
286 Ga0068854_100312182
287 Ga0068852_100095194
288 Ga0068852_100167651
289 Ga0068852_100171645
290 Ga0068851_10014614
291 Ga0075364_10002300
292 Ga0075364_10015928
293 Ga0075362_10036881
294 Ga0075369_10004993
295 Ga0075370_10007741
296 Ga0079104_1000015
297 Ga0105240_11015619
298 Ga0105240_11624923
299 Ga0105241_10006002
300 Ga0105241_10179551
301 Ga0105237_10147401
302 Ga0105238_10087921
303 Ga0157317_1002503
304 Ga0157373_10033109
305 Ga0157373_10074493
306 Ga0157371_10157374
307 Ga0157369_11322692
308 Ga0157374_10491574
309 Ga0157372_10555760
310 Ga0206353_10433881
311 Ga0213876_10000021
312 Ga0209674_111623
313 Ga0209257_1009860
314 Ga0207656_10000858
315 Ga0207647_10077126
316 Ga0207647_10105088
317 Ga0207647_10746971
318 Ga0207705_10000309
319 Ga0207654_10000363
320 Ga0207654_10783209
321 Ga0207695_10020497
322 Ga0207695_11149445
323 Ga0207671_10008227
324 Ga0207657_10020388
325 Ga0207649_10032329
326 Ga0207694_10006827
327 Ga0207694_10170964
328 Ga0207690_10047728
329 Ga0207690_10049400
330 Ga0207690_10268585
331 Ga0207706_10043889
332 Ga0207706_10050946
333 Ga0207686_10708612
334 Ga0207669_10004808
335 Ga0207679_10259471
336 Ga0207667_10000001
337 Ga0207640_10148038
338 Ga0207640_10313320
339 Ga0207658_10099557
340 Ga0207639_10002653
341 Ga0207639_10083835
342 Ga0207678_10008204
343 Ga0207702_10000963
344 Ga0207674_10018633
345 Ga0207683_10208288
346 Ga0207698_10001652
347 Ga0207698_10059167
348 Ga0207698_10073234
349 Ga0209281_1000034
350 Ga0268266_10262151
351 Ga0307517_10085675
352 Ga0307513_10047881
353 Ga0307408_100310544
354 Ga0307408_100425129
355 Ga0307405_10025977
356 Ga0307405_10074251
357 Ga0307405_10193420
358 Ga0307405_10894553
359 Ga0307413_10231151
360 Ga0307410_10011328
361 Ga0307410_10746719
362 Ga0307406_10036021
363 Ga0307406_10381428
364 Ga0307407_10064584
365 Ga0307412_10075188
366 Ga0307412_10155036
367 Ga0307412_10660375
368 Ga0307409_100070911
369 Ga0307409_100396099
370 Ga0307416_101860707
371 Ga0307414_10204393
372 Ga0307411_10001001
373 Ga0307411_11554523
374 Ga0307415_100153871
375 Ga0307510_10091137
376 Ga0307510_10361926
377 Ga0395900_0249751
378 Ga0436365_0618060
379 Ga0436362_0126459
380 Ga0451795_1324878
381 Ga0451843_1383885
382 Ga0439448_0114322
383 Ga0495617_033276
384 Ga0495627_000631
385 Ga0495627_000781
386 Ga0495638_0185457
387 Ga0495650_0000628
388 Ga0495584_0077008
389 Ga0495585_0012251
390 Ga0495585_0145083
391 Ga0495596_0048832
392 Ga0495583_0025689
393 Ga0495583_0149807
394 Ga0495606_0011152
395 Ga0495606_0067807
396 Ga0495606_0178899
397 Ga0495610_0005148
398 Ga0495616_0100414
399 Ga0495631_0063593
400 Ga0495631_0072657
401 Ga0495637_0231170
402 Ga0495643_0009723
403 Ga0495643_0042001
404 Ga0495648_0000122
405 Ga0495648_0339359
406 Ga0495663_0002676
407 Ga0495654_0000156
408 Ga0495654_0138480
409 Ga0495597_0152016
410 Ga0495597_0355369
411 Ga0495633_0004524
412 Ga0495633_0419705
413 Ga0495668_0003244
414 Ga0495611_0021074
415 Ga0495611_0050231
416 Ga0495625_0009545
417 Ga0495625_0014086
418 Ga0495625_0061425
419 Ga0495625_0085438
420 Ga0495625_0227553
421 Ga0495625_0290854
422 Ga0495625_0788083
423 Ga0495613_0532749
424 Ga0495670_0131618
425 Ga0495671_0188354
426 Ga0495649_0013604
427 Ga0495600_0075435
428 Ga0495660_0088522
429 Ga0495683_0013104
430 Ga0495683_0015357
431 Ga0495687_005081
432 Ga0495687_007301
433 Ga0495673_0047716
434 Ga0495681_0000221
435 Ga0495681_0080364
436 Ga0495681_0199093
437 Ga0495686_0015142
438 Ga0495686_0251535
439 Ga0496100_0441048
440 Ga0496102_0000201
441 Ga0496103_0000165
442 Ga0496104_0099657
443 Ga0496105_0002985
444 Ga0496106_0667328
445 Ga0496107_0070309
446 Ga0496109_0119528
447 Ga0496110_0011254
448 Ga0496110_0645858
449 Ga0496111_0053749
450 Ga0496113_0282476
451 Ga0496114_0028337
452 Ga0496115_0002872
453 Ga0496116_0000201
454 Ga0496116_0020689
455 Ga0496117_0000441
456 Ga0496117_0090532
457 Ga0496118_0000425
458 Ga0496118_0027305
459 Ga0496119_0008774
460 Ga0496121_0003571
461 Ga0496121_0008606
462 Ga0496122_0000533
463 Ga0496122_0015219
464 Ga0496122_0141504
465 Ga0496123_0000406
466 Ga0496123_0017821
467 Ga0496123_0340379
468 Ga0496124_0000468
469 Ga0496124_0006719
470 Ga0496124_0038743
471 Ga0496124_0201409
472 Ga0496125_0005884
473 Ga0496125_0023287
474 Ga0496125_0026154
475 Ga0496125_0326522
476 Ga0496125_0347529
477 Ga0496125_0768614
478 Ga0496126_0000298
479 Ga0496126_0000563
480 Ga0496126_0061111
481 Ga0496126_0095480
482 Ga0496126_0174521
483 Ga0501300_002954
484 Ga0501034_0497622
485 nmdc:mga00v17_380_c1
486 nmdc:mga00v17_9748_c1
487 nmdc:mga07m45_3128_c1
488 nmdc:mga0sz30_2316_c1
489 Ga0500610_0001078
490 Ga0500643_001096
491 Ga0500643_005175
492 Ga0500643_008401
493 Ga0500641_0046631
494 Ga0500556_0046511
495 Ga0500562_002707
496 Ga0500592_038002
497 Ga0500595_003346
498 Ga0500595_017214
499 Ga0500607_109493
500 Ga0500618_070606
501 Ga0500642_0000446
502 Ga0500658_0002592
503 Ga0500616_0003077
504 Ga0500616_0136619
505 Ga0500627_0000287
506 Ga0500627_0130554
507 Ga0500645_004841
508 Ga0500645_149231
509 Ga0500661_027401
510 2738944081
511 2913313591
512 2989350069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04134

DCC1-like

DCC1-like thiol-disulfide oxidoreductase

36

145

0.98

Map