F366161

General Info

Members Datasets Scaffolds Average Seq Length
256 150 240 333

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10150387|rootH1_101503873
Length 358
Sequence MTIISHNIKKTLTRPLGGWGDRVKVGVVGGAGYTGGELLRILINHPDVDIAFVHSNSNAGNYIYEVHTDLFGDTELKFGSELSDDIDVLFLCVGHGDARKFLDANAIASHIRIIDLSQDFRLSQNSKFQIQNITADPEPSFRQFVYGLPELNRESIKTARNIANPGCFATCLQLGLLPLASKGLLTNEVHITATTGSTGAGQSLSPTSHFTWRNDNLSVYKVFEHQHLNEIGESLKQLQSNQEVGALNFIPYRGDFTRGIIASMYTESDLTEEEALKLYTDFYAGHPFTHVTKRNIDLKQIVNTNKCFIQVKKHGNKLFIISIIDNLLKGASGQAVQNMNLVFGLPEDSGLRLKAVAF

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541284 Pedobacter sp. YR016 Isolate Unclassified
3 2739367656 Pedobacter sp. CF523 Isolate Unclassified
4 2739367663 Pedobacter sp. YR510 Isolate Unclassified
5 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
6 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
7 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
8 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
9 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
10 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
11 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
12 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
13 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
14 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
15 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
148 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
149 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
150 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0
Isolates 6.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.03
Nodule 0
Rhizoplane 0.78
Rhizosphere 80.47
Stem 0
Stem Tuber 0
Unclassified 11.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004155 3300001989 Bacteria 5539
2 JGI24737J22298_10002537 3300001990 Bacteria 6482
3 JGI24737J22298_10015760 3300001990 Bacteria 2444
4 JGI24743J22301_10020279 3300001991 Bacteria 1266
5 JGI24735J21928_10000002 3300002067 Bacteria 624895
6 JGI24735J21928_10005097 3300002067 Bacteria 4373
7 JGI24744J21845_10007642 3300002077 Bacteria 2234
8 JGI25162J39368_1000024 3300002737 Bacteria 229507
9 JGI25162J39368_1001318 3300002737 Bacteria 13921
10 JGI25157J39369_1004360 3300002741 Bacteria 2591
11 JGI25157J39369_1008109 3300002741 Bacteria 1478
12 JGI25164J39214_1000855 3300002772 Bacteria 10454
13 JGI25165J46597_1001051 3300003214 Bacteria 17893
14 rootH1_10034281 3300003316 Bacteria 2378
15 rootH1_10034282 3300003316 Bacteria 9753
16 rootH2_10005719 3300003320 Bacteria 108734
17 rootH2_10037397 3300003320 Bacteria 2200
18 rootH2_10051333 3300003320 Bacteria 3078
19 rootH1_10002666 3300003323 Bacteria 23641
20 rootH1_10009087 3300003323 Bacteria 3829
21 rootH1_10012302 3300003323 Bacteria 2701
22 rootH1_10062121 3300003323 Bacteria 7043
23 rootH1_10150387 3300003323 Bacteria 3235
24 rootH1_10207268 3300003323 Bacteria 3154
25 rootH1_10229938 3300003323 Bacteria 2061
26 rootH1_10256108 3300003323 Bacteria 2093
27 Ga0065714_10007893 3300005288 Bacteria 4048
28 Ga0070658_10000011 3300005327 Bacteria 294396
29 Ga0070658_10201583 3300005327 Bacteria 1679
30 Ga0070676_10000277 3300005328 Bacteria 22624
31 Ga0068868_100005721 3300005338 Bacteria 8753
32 Ga0070660_100015693 3300005339 Bacteria 5477
33 Ga0070660_100047390 3300005339 Bacteria 3298
34 Ga0070675_100051700 3300005354 Bacteria 3377
35 Ga0070671_100042113 3300005355 Bacteria 3796
36 Ga0070673_100003782 3300005364 Bacteria 9493
37 Ga0070659_100000449 3300005366 Bacteria 30726
38 Ga0070659_100002083 3300005366 Bacteria 14235
39 Ga0070659_100263994 3300005366 Bacteria 1429
40 Ga0070678_100006236 3300005456 Bacteria 6976
41 Ga0070662_100000032 3300005457 Bacteria 78824
42 Ga0068867_100009759 3300005459 Bacteria 6765
43 Ga0068853_100008727 3300005539 Bacteria 8154
44 Ga0068853_100038977 3300005539 Bacteria 4051
45 Ga0070665_100000003 3300005548 Bacteria 811857
46 Ga0068855_100010454 3300005563 Bacteria 11197
47 Ga0068855_100032170 3300005563 Bacteria 6263
48 Ga0068857_100045223 3300005577 Bacteria 3905
49 Ga0068854_100278374 3300005578 Bacteria 1346
50 Ga0068856_100040048 3300005614 Bacteria 4601
51 Ga0068852_100002452 3300005616 Bacteria 12774
52 Ga0068852_100139862 3300005616 Bacteria 2239
53 Ga0068860_100056476 3300005843 Bacteria 3732
54 Ga0075366_10000804 3300006195 Bacteria 15009
55 Ga0075366_10045142 3300006195 Bacteria 2612
56 Ga0097621_100000165 3300006237 Bacteria 41398
57 Ga0068871_100000018 3300006358 Bacteria 89690
58 Ga0075431_100005370 3300006847 Bacteria 12650
59 Ga0068865_100000396 3300006881 Bacteria 24307
60 Ga0068865_100407076 3300006881 Bacteria 1115
61 Ga0105240_10000237 3300009093 Bacteria 109895
62 Ga0105240_10022011 3300009093 Bacteria 8465
63 Ga0105240_10029393 3300009093 Bacteria 7160
64 Ga0105240_10208449 3300009093 Bacteria 2286
65 Ga0105240_10293589 3300009093 Bacteria 1862
66 Ga0105240_10477687 3300009093 Bacteria 1390
67 Ga0114129_10012446 3300009147 Bacteria 12112
68 Ga0105243_10249038 3300009148 Bacteria 1585
69 Ga0105241_10007004 3300009174 Bacteria 8292
70 Ga0105241_10021319 3300009174 Bacteria 4789
71 Ga0105241_10030640 3300009174 Bacteria 4022
72 Ga0105242_10005497 3300009176 Bacteria 9783
73 Ga0105237_10000224 3300009545 Bacteria 79854
74 Ga0105237_10000963 3300009545 Bacteria 38740
75 Ga0105237_10001948 3300009545 Bacteria 26296
76 Ga0105237_10019011 3300009545 Bacteria 7101
77 Ga0105237_10061353 3300009545 Bacteria 3759
78 Ga0105237_10061401 3300009545 Bacteria 3757
79 Ga0105238_10037769 3300009551 Bacteria 4907
80 Ga0105238_10081151 3300009551 Bacteria 3233
81 Ga0105239_10000002 3300010375 Bacteria 610298
82 Ga0105239_10000013 3300010375 Bacteria 327371
83 Ga0105239_10001207 3300010375 Bacteria 35283
84 Ga0105239_10004436 3300010375 Bacteria 16776
85 Ga0105239_10006888 3300010375 Bacteria 13111
86 Ga0105239_10014078 3300010375 Bacteria 8880
87 Ga0105239_10016752 3300010375 Bacteria 8101
88 Ga0105239_10136791 3300010375 Bacteria 2728
89 Ga0105239_10391458 3300010375 Bacteria 1572
90 Ga0105246_10161741 3300011119 Bacteria 1706
91 Ga0157373_10000256 3300013100 Bacteria 43374
92 Ga0157373_10002482 3300013100 Bacteria 14050
93 Ga0157373_10025856 3300013100 Bacteria 4243
94 Ga0157373_10032956 3300013100 Bacteria 3729
95 Ga0157371_10000216 3300013102 Bacteria 83975
96 Ga0157371_10027826 3300013102 Bacteria 4097
97 Ga0157371_10066358 3300013102 Bacteria 2555
98 Ga0157370_10002361 3300013104 Bacteria 22770
99 Ga0157370_10021398 3300013104 Bacteria 6445
100 Ga0157370_10030370 3300013104 Bacteria 5295
101 Ga0157370_10108740 3300013104 Bacteria 2592
102 Ga0157369_10000046 3300013105 Bacteria 172851
103 Ga0157369_10089547 3300013105 Bacteria 3285
104 Ga0157369_10115336 3300013105 Bacteria 2853
105 Ga0157374_10000348 3300013296 Bacteria 42744
106 Ga0157374_10010541 3300013296 Bacteria 7955
107 Ga0157378_10035235 3300013297 Bacteria 4426
108 Ga0163162_10000031 3300013306 Bacteria 157666
109 Ga0163162_10009851 3300013306 Bacteria 9295
110 Ga0163162_10485823 3300013306 Bacteria 1366
111 Ga0157372_10003090 3300013307 Bacteria 17926
112 Ga0157372_10023256 3300013307 Bacteria 6716
113 Ga0157372_10029405 3300013307 Bacteria 5999
114 Ga0157372_10038494 3300013307 Bacteria 5278
115 Ga0157375_10033488 3300013308 Bacteria 4883
116 Ga0157375_10118550 3300013308 Bacteria 2753
117 Ga0182008_10000025 3300014497 Bacteria 191222
118 Ga0157377_10036751 3300014745 Bacteria 2696
119 Ga0157376_10044224 3300014969 Bacteria 3659
120 Ga0182007_10050298 3300015262 Bacteria 1376
121 Ga0183373_1008 3300015682 Bacteria 255339
122 Ga0163161_10029615 3300017792 Bacteria 3892
123 Ga0163161_10308308 3300017792 Bacteria 1248
124 Ga0213872_10035880 3300021361 Bacteria 2267
125 Ga0207427_100103 3300025231 Bacteria 119618
126 Ga0209437_100017 3300025233 Bacteria 694471
127 Ga0209437_100101 3300025233 Bacteria 226668
128 Ga0209026_1002049 3300025250 Bacteria 7962
129 Ga0209026_1003574 3300025250 Bacteria 5024
130 Ga0209129_1008535 3300025258 Bacteria 2838
131 Ga0209233_1000124 3300025261 Bacteria 226743
132 Ga0209233_1003362 3300025261 Bacteria 5655
133 Ga0209233_1011737 3300025261 Bacteria 2572
134 Ga0207647_10000104 3300025904 Bacteria 65696
135 Ga0207647_10028212 3300025904 Bacteria 3649
136 Ga0207645_10000650 3300025907 Bacteria 28882
137 Ga0207705_10000015 3300025909 Bacteria 382901
138 Ga0207705_10161618 3300025909 Bacteria 1683
139 Ga0207654_10007717 3300025911 Bacteria 5429
140 Ga0207654_10012469 3300025911 Bacteria 4356
141 Ga0207654_10019327 3300025911 Bacteria 3594
142 Ga0207695_10000013 3300025913 Bacteria 821265
143 Ga0207695_10005995 3300025913 Bacteria 15895
144 Ga0207695_10012058 3300025913 Bacteria 10392
145 Ga0207695_10295943 3300025913 Bacteria 1510
146 Ga0207695_10339707 3300025913 Bacteria 1389
147 Ga0207695_10389267 3300025913 Bacteria 1279
148 Ga0207671_10002707 3300025914 Bacteria 18581
149 Ga0207671_10005976 3300025914 Bacteria 11017
150 Ga0207671_10010699 3300025914 Bacteria 7545
151 Ga0207671_10015114 3300025914 Bacteria 6065
152 Ga0207671_10059455 3300025914 Bacteria 2834
153 Ga0207671_10162419 3300025914 Bacteria 1730
154 Ga0207657_10029952 3300025919 Bacteria 4946
155 Ga0207657_10057706 3300025919 Bacteria 3344
156 Ga0207694_10295411 3300025924 Bacteria 1333
157 Ga0207690_10003150 3300025932 Bacteria 9903
158 Ga0207690_10030854 3300025932 Bacteria 3424
159 Ga0207706_10000191 3300025933 Bacteria 68535
160 Ga0207709_10071013 3300025935 Bacteria 2209
161 Ga0207704_10000053 3300025938 Bacteria 79904
162 Ga0207667_10054870 3300025949 Bacteria 4191
163 Ga0207667_10066475 3300025949 Bacteria 3758
164 Ga0207651_10219916 3300025960 Bacteria 1535
165 Ga0207639_10006469 3300026041 Bacteria 7969
166 Ga0207639_10141665 3300026041 Bacteria 2004
167 Ga0207639_10346484 3300026041 Bacteria 1326
168 Ga0207702_10024798 3300026078 Bacteria 4975
169 Ga0207702_10206281 3300026078 Bacteria 1825
170 Ga0207648_10000175 3300026089 Bacteria 66839
171 Ga0207698_10004722 3300026142 Bacteria 8333
172 Ga0268266_10000018 3300028379 Bacteria 569141
173 Ga0268264_10031052 3300028381 Bacteria 4380
174 Ga0265326_10027091 3300028558 Bacteria 1634
175 Ga0307517_10002197 3300028786 Bacteria 31568
176 Ga0307515_10000927 3300028794 Bacteria 67260
177 Ga0307515_10001771 3300028794 Bacteria 48123
178 Ga0265338_10001011 3300028800 Bacteria 47254
179 Ga0265327_10000248 3300031251 Bacteria 107284
180 Ga0265327_10015148 3300031251 Bacteria 4997
181 Ga0307509_10045900 3300031507 Bacteria 4707
182 Ga0307410_10060760 3300031852 Bacteria 2584
183 Ga0307412_10459637 3300031911 Bacteria 1051
184 Ga0307414_10001471 3300032004 Bacteria 12250
185 Ga0307414_10034737 3300032004 Bacteria 3347
186 Ga0307414_10046227 3300032004 Bacteria 2986
187 Ga0307507_10000064 3300033179 Bacteria 161226
188 Ga0307510_10000328 3300033180 Bacteria 44214
189 Ga0395899_0000033 3300037312 Bacteria 306589
190 Ga0395899_0001077 3300037312 Bacteria 24592
191 Ga0395899_0065670 3300037312 Bacteria 2666
192 Ga0395900_0001393 3300037418 Bacteria 28920
193 Ga0395900_0003225 3300037418 Bacteria 17664
194 Ga0395898_0013831 3300037466 Bacteria 8295
195 Ga0395905_0001914 3300037471 Bacteria 23897
196 Ga0395901_0017854 3300038443 Bacteria 7241
197 Ga0395901_0111873 3300038443 Bacteria 2868
198 Ga0395901_0323341 3300038443 Bacteria 1595
199 Ga0436361_0307685 3300039447 Bacteria 5871
200 Ga0495627_023291 3300046453 Bacteria 2030
201 Ga0495650_0000003 3300046471 Bacteria 900730
202 Ga0495585_0000079 3300046492 Bacteria 100159
203 Ga0495585_0000411 3300046492 Bacteria 41565
204 Ga0495583_0041858 3300046506 Bacteria 2143
205 Ga0495606_0000116 3300046507 Bacteria 134901
206 Ga0495606_0012165 3300046507 Bacteria 6938
207 Ga0495606_0023782 3300046507 Bacteria 4431
208 Ga0495606_0026181 3300046507 Bacteria 4160
209 Ga0495606_0122159 3300046507 Unclassified 1558
210 Ga0495610_0004188 3300046512 Bacteria 10774
211 Ga0495616_0008226 3300046513 Bacteria 6192
212 Ga0495631_0037702 3300046518 Bacteria 2152
213 Ga0495644_0018713 3300046523 Bacteria 2643
214 Ga0495648_0002877 3300046524 Bacteria 15501
215 Ga0495648_0034727 3300046524 Bacteria 3278
216 Ga0495609_0033930 3300046538 Bacteria 2314
217 Ga0495622_0045381 3300046557 Bacteria 2042
218 Ga0495633_0000056 3300046558 Bacteria 149334
219 Ga0495625_0000159 3300046660 Bacteria 104355
220 Ga0495625_0001186 3300046660 Bacteria 33408
221 Ga0495625_0002144 3300046660 Bacteria 21944
222 Ga0495661_0001360 3300046665 Bacteria 20657
223 Ga0495661_0015325 3300046665 Bacteria 5118
224 Ga0495649_0000003 3300046694 Bacteria 880817
225 Ga0495600_0026176 3300046809 Bacteria 3763
226 Ga0495636_0000446 3300047318 Bacteria 15278
227 Ga0495687_002367 3300047443 Bacteria 15256
228 Ga0495677_0055187 3300047445 Bacteria 1466
229 Ga0495686_0001122 3300047472 Bacteria 31676
230 Ga0495686_0046959 3300047472 Bacteria 2728
231 Ga0496114_0418430 3300048917 Bacteria 1187
232 Ga0495678_010545 3300049459 Bacteria 4486
233 nmdc:mga0k408_51_c1 3300050493 Bacteria 15009
234 nmdc:mga0k408_7355_c1 3300050493 Bacteria 5881
235 nmdc:mga05p37_23296_c2 3300050507 Bacteria 4315
236 nmdc:mga09592_66506_c1 3300050508 Bacteria 3055
237 nmdc:mga06r32_4922_c1 3300050510 Bacteria 12034
238 Ga0500635_0000678 3300053080 Bacteria 8618
239 Ga0500608_005011 3300053122 Bacteria 5204
240 Ga0500618_000003 3300053125 Bacteria 338706

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10201583 Ga0070658_102015833 269
2 3300025909 Ga0207705_10161618 Ga0207705_101616182 269
3 3300009093 Ga0105240_10208449 Ga0105240_102084491 292
4 3300047472 Ga0495686_0046959 Ga0495686_0046959_16_900 294
5 3300026041 Ga0207639_10346484 Ga0207639_103464842 309
6 3300048917 Ga0496114_0418430 Ga0496114_0418430_240_1169 309
7 iso_pu_bacteria 2738541284 2738761461 319
8 iso_pu_bacteria 2852627209 2852628110 319
9 iso_pu_bacteria 2910245624 2910247850 319
10 3300013307 Ga0157372_10029405 Ga0157372_100294052 320
11 3300028800 Ga0265338_10001011 Ga0265338_1000101128 321
12 iso_pu_bacteria 2902048731 2902050712 321
13 3300009545 Ga0105237_10001948 Ga0105237_100019489 322
14 3300013104 Ga0157370_10030370 Ga0157370_100303702 322
15 3300014497 Ga0182008_10000025 Ga0182008_10000025128 322
16 3300017792 Ga0163161_10308308 Ga0163161_103083082 322
17 3300031251 Ga0265327_10000248 Ga0265327_1000024841 322
18 3300032004 Ga0307414_10001471 Ga0307414_100014713 322
19 iso_pu_bacteria 2739367663 2739648075 322
20 iso_pu_bacteria 2849281842 2849283553 322
21 iso_pu_bacteria 2857627736 2857630510 322
22 iso_pu_bacteria 2881955468 2881957557 322
23 3300031852 Ga0307410_10060760 Ga0307410_100607602 323
24 3300047318 Ga0495636_0000446 Ga0495636_0000446_14271_15254 323
25 iso_pu_bacteria 2977232053 2977232888 323
26 iso_pu_bacteria 8055588893 8055591253 323
27 3300003323 rootH1_10256108 rootH1_102561082 324
28 3300005355 Ga0070671_100042113 Ga0070671_1000421133 324
29 3300013308 Ga0157375_10033488 Ga0157375_100334883 324
30 3300047443 Ga0495687_002367 Ga0495687_002367_8624_9616 324
31 iso_pu_bacteria 2739367656 2739614666 324
32 iso_pu_bacteria 2919437846 2919441317 324
33 3300005354 Ga0070675_100051700 Ga0070675_1000517002 325
34 3300005578 Ga0068854_100278374 Ga0068854_1002783741 325
35 3300005843 Ga0068860_100056476 Ga0068860_1000564764 325
36 3300006847 Ga0075431_100005370 Ga0075431_1000053702 325
37 3300009147 Ga0114129_10012446 Ga0114129_100124465 325
38 3300013100 Ga0157373_10002482 Ga0157373_1000248214 325
39 3300013102 Ga0157371_10000216 Ga0157371_1000021642 325
40 3300013104 Ga0157370_10002361 Ga0157370_1000236121 325
41 3300013104 Ga0157370_10021398 Ga0157370_100213984 325
42 3300025960 Ga0207651_10219916 Ga0207651_102199162 325
43 3300028381 Ga0268264_10031052 Ga0268264_100310524 325
44 3300050507 nmdc:mga05p37_23296_c2 nmdc:mga05p37_23296_c2_551_1540 325
45 3300050508 nmdc:mga09592_66506_c1 nmdc:mga09592_66506_c1_15_1004 325
46 3300050510 nmdc:mga06r32_4922_c1 nmdc:mga06r32_4922_c1_8334_9323 325
47 3300001991 JGI24743J22301_10020279 JGI24743J22301_100202791 326
48 3300002077 JGI24744J21845_10007642 JGI24744J21845_100076423 326
49 3300002737 JGI25162J39368_1000024 JGI25162J39368_1000024148 326
50 3300002741 JGI25157J39369_1008109 JGI25157J39369_10081091 326
51 3300003316 rootH1_10034281 rootH1_100342813 326
52 3300003320 rootH2_10005719 rootH2_1000571983 326
53 3300003320 rootH2_10037397 rootH2_100373971 326
54 3300003320 rootH2_10051333 rootH2_100513333 326
55 3300005328 Ga0070676_10000277 Ga0070676_100002776 326
56 3300005338 Ga0068868_100005721 Ga0068868_1000057218 326
57 3300005339 Ga0070660_100047390 Ga0070660_1000473903 326
58 3300005364 Ga0070673_100003782 Ga0070673_1000037824 326
59 3300005366 Ga0070659_100263994 Ga0070659_1002639942 326
60 3300005456 Ga0070678_100006236 Ga0070678_1000062365 326
61 3300005457 Ga0070662_100000032 Ga0070662_10000003256 326
62 3300005459 Ga0068867_100009759 Ga0068867_1000097596 326
63 3300005539 Ga0068853_100008727 Ga0068853_1000087274 326
64 3300005539 Ga0068853_100038977 Ga0068853_1000389773 326
65 3300005548 Ga0070665_100000003 Ga0070665_100000003692 326
66 3300005563 Ga0068855_100032170 Ga0068855_1000321702 326
67 3300005616 Ga0068852_100002452 Ga0068852_1000024524 326
68 3300005616 Ga0068852_100139862 Ga0068852_1001398622 326
69 3300006195 Ga0075366_10000804 Ga0075366_100008043 326
70 3300006237 Ga0097621_100000165 Ga0097621_10000016517 326
71 3300006358 Ga0068871_100000018 Ga0068871_10000001826 326
72 3300006881 Ga0068865_100000396 Ga0068865_1000003967 326
73 3300009093 Ga0105240_10022011 Ga0105240_100220117 326
74 3300009093 Ga0105240_10029393 Ga0105240_100293936 326
75 3300009093 Ga0105240_10293589 Ga0105240_102935893 326
76 3300009148 Ga0105243_10249038 Ga0105243_102490382 326
77 3300009174 Ga0105241_10007004 Ga0105241_100070046 326
78 3300009174 Ga0105241_10030640 Ga0105241_100306404 326
79 3300009176 Ga0105242_10005497 Ga0105242_1000549712 326
80 3300009545 Ga0105237_10000224 Ga0105237_1000022434 326
81 3300009545 Ga0105237_10061353 Ga0105237_100613533 326
82 3300009545 Ga0105237_10061401 Ga0105237_100614013 326
83 3300009551 Ga0105238_10037769 Ga0105238_100377696 326
84 3300009551 Ga0105238_10081151 Ga0105238_100811513 326
85 3300010375 Ga0105239_10001207 Ga0105239_100012074 326
86 3300010375 Ga0105239_10006888 Ga0105239_100068885 326
87 3300010375 Ga0105239_10014078 Ga0105239_100140783 326
88 3300010375 Ga0105239_10391458 Ga0105239_103914582 326
89 3300011119 Ga0105246_10161741 Ga0105246_101617412 326
90 3300013100 Ga0157373_10025856 Ga0157373_100258564 326
91 3300013100 Ga0157373_10032956 Ga0157373_100329563 326
92 3300013102 Ga0157371_10066358 Ga0157371_100663582 326
93 3300013104 Ga0157370_10108740 Ga0157370_101087402 326
94 3300013105 Ga0157369_10000046 Ga0157369_1000004688 326
95 3300013296 Ga0157374_10000348 Ga0157374_1000034818 326
96 3300013296 Ga0157374_10010541 Ga0157374_100105415 326
97 3300013297 Ga0157378_10035235 Ga0157378_100352352 326
98 3300013306 Ga0163162_10000031 Ga0163162_1000003198 326
99 3300013306 Ga0163162_10485823 Ga0163162_104858232 326
100 3300013308 Ga0157375_10118550 Ga0157375_101185503 326
101 3300014745 Ga0157377_10036751 Ga0157377_100367513 326
102 3300014969 Ga0157376_10044224 Ga0157376_100442243 326
103 3300015262 Ga0182007_10050298 Ga0182007_100502982 326
104 3300015682 Ga0183373_1008 Ga0183373_1008166 326
105 3300017792 Ga0163161_10029615 Ga0163161_100296153 326
106 3300021361 Ga0213872_10035880 Ga0213872_100358802 326
107 3300025233 Ga0209437_100017 Ga0209437_100017145 326
108 3300025258 Ga0209129_1008535 Ga0209129_10085353 326
109 3300025261 Ga0209233_1011737 Ga0209233_10117373 326
110 3300025904 Ga0207647_10028212 Ga0207647_100282123 326
111 3300025907 Ga0207645_10000650 Ga0207645_1000065017 326
112 3300025911 Ga0207654_10007717 Ga0207654_100077175 326
113 3300025911 Ga0207654_10012469 Ga0207654_100124692 326
114 3300025913 Ga0207695_10005995 Ga0207695_1000599511 326
115 3300025913 Ga0207695_10012058 Ga0207695_100120586 326
116 3300025913 Ga0207695_10389267 Ga0207695_103892672 326
117 3300025914 Ga0207671_10002707 Ga0207671_100027076 326
118 3300025914 Ga0207671_10010699 Ga0207671_100106993 326
119 3300025914 Ga0207671_10015114 Ga0207671_100151143 326
120 3300025914 Ga0207671_10059455 Ga0207671_100594552 326
121 3300025919 Ga0207657_10057706 Ga0207657_100577062 326
122 3300025924 Ga0207694_10295411 Ga0207694_102954111 326
123 3300025933 Ga0207706_10000191 Ga0207706_1000019114 326
124 3300025935 Ga0207709_10071013 Ga0207709_100710132 326
125 3300025938 Ga0207704_10000053 Ga0207704_1000005318 326
126 3300025949 Ga0207667_10054870 Ga0207667_100548702 326
127 3300026041 Ga0207639_10006469 Ga0207639_100064694 326
128 3300026041 Ga0207639_10141665 Ga0207639_101416652 326
129 3300026078 Ga0207702_10024798 Ga0207702_100247985 326
130 3300026089 Ga0207648_10000175 Ga0207648_1000017524 326
131 3300026142 Ga0207698_10004722 Ga0207698_100047224 326
132 3300028379 Ga0268266_10000018 Ga0268266_1000001812 326
133 3300028786 Ga0307517_10002197 Ga0307517_1000219727 326
134 3300028794 Ga0307515_10000927 Ga0307515_1000092716 326
135 3300028794 Ga0307515_10001771 Ga0307515_1000177131 326
136 3300031251 Ga0265327_10015148 Ga0265327_100151485 326
137 3300033180 Ga0307510_10000328 Ga0307510_1000032835 326
138 3300037312 Ga0395899_0000033 Ga0395899_0000033_54522_55517 326
139 3300037312 Ga0395899_0001077 Ga0395899_0001077_6778_7776 326
140 3300037312 Ga0395899_0065670 Ga0395899_0065670_363_1358 326
141 3300037418 Ga0395900_0001393 Ga0395900_0001393_25627_26637 326
142 3300037418 Ga0395900_0003225 Ga0395900_0003225_2992_3990 326
143 3300037466 Ga0395898_0013831 Ga0395898_0013831_4448_5446 326
144 3300037471 Ga0395905_0001914 Ga0395905_0001914_3627_4622 326
145 3300038443 Ga0395901_0017854 Ga0395901_0017854_2541_3539 326
146 3300038443 Ga0395901_0323341 Ga0395901_0323341_565_1560 326
147 3300039447 Ga0436361_0307685 Ga0436361_0307685_3177_4175 326
148 3300046453 Ga0495627_023291 Ga0495627_023291_179_1159 326
149 3300046507 Ga0495606_0122159 Ga0495606_0122159_471_1469 326
150 3300046518 Ga0495631_0037702 Ga0495631_0037702_363_1361 326
151 3300046523 Ga0495644_0018713 Ga0495644_0018713_223_1221 326
152 3300046524 Ga0495648_0034727 Ga0495648_0034727_1360_2358 326
153 3300046660 Ga0495625_0002144 Ga0495625_0002144_7522_8520 326
154 3300047445 Ga0495677_0055187 Ga0495677_0055187_62_1060 326
155 3300050493 nmdc:mga0k408_51_c1 nmdc:mga0k408_51_c1_12853_13851 326
156 3300053122 Ga0500608_005011 Ga0500608_005011_720_1718 326
157 3300001990 JGI24737J22298_10015760 JGI24737J22298_100157603 327
158 3300002067 JGI24735J21928_10005097 JGI24735J21928_100050973 327
159 3300002737 JGI25162J39368_1001318 JGI25162J39368_10013189 327
160 3300002772 JGI25164J39214_1000855 JGI25164J39214_10008557 327
161 3300003214 JGI25165J46597_1001051 JGI25165J46597_10010512 327
162 3300003323 rootH1_10012302 rootH1_100123022 327
163 3300005366 Ga0070659_100002083 Ga0070659_1000020839 327
164 3300005577 Ga0068857_100045223 Ga0068857_1000452235 327
165 3300010375 Ga0105239_10000002 Ga0105239_10000002394 327
166 3300013105 Ga0157369_10089547 Ga0157369_100895473 327
167 3300013307 Ga0157372_10003090 Ga0157372_100030901 327
168 3300025231 Ga0207427_100103 Ga0207427_10010324 327
169 3300025233 Ga0209437_100101 Ga0209437_10010145 327
170 3300025250 Ga0209026_1003574 Ga0209026_10035746 327
171 3300025261 Ga0209233_1000124 Ga0209233_1000124191 327
172 3300025261 Ga0209233_1003362 Ga0209233_10033622 327
173 3300025904 Ga0207647_10000104 Ga0207647_1000010440 327
174 3300025932 Ga0207690_10003150 Ga0207690_100031507 327
175 3300031911 Ga0307412_10459637 Ga0307412_104596371 327
176 3300032004 Ga0307414_10034737 Ga0307414_100347373 327
177 3300032004 Ga0307414_10046227 Ga0307414_100462274 327
178 3300038443 Ga0395901_0111873 Ga0395901_0111873_1276_2259 327
179 3300028558 Ga0265326_10027091 Ga0265326_100270911 329
180 3300046665 Ga0495661_0001360 Ga0495661_0001360_11757_12755 329
181 3300047472 Ga0495686_0001122 Ga0495686_0001122_18431_19429 329
182 3300053080 Ga0500635_0000678 Ga0500635_0000678_51_1049 329
183 3300002741 JGI25157J39369_1004360 JGI25157J39369_10043601 330
184 3300006881 Ga0068865_100407076 Ga0068865_1004070761 330
185 3300009093 Ga0105240_10477687 Ga0105240_104776872 330
186 3300009545 Ga0105237_10000963 Ga0105237_1000096314 330
187 3300010375 Ga0105239_10000013 Ga0105239_10000013199 330
188 3300025250 Ga0209026_1002049 Ga0209026_10020498 330
189 3300025911 Ga0207654_10019327 Ga0207654_100193273 330
190 3300025913 Ga0207695_10295943 Ga0207695_102959432 330
191 3300025913 Ga0207695_10339707 Ga0207695_103397071 330
192 3300025914 Ga0207671_10005976 Ga0207671_100059765 330
193 3300046507 Ga0495606_0023782 Ga0495606_0023782_3307_4359 331
194 3300046507 Ga0495606_0000116 Ga0495606_0000116_111558_112556 332
195 3300046507 Ga0495606_0026181 Ga0495606_0026181_2244_3242 332
196 iso_pu_bacteria 2599185184 2599478629 332
197 iso_pu_bacteria 2928078545 2928080313 332
198 iso_pu_bacteria 2928147474 2928149512 332
199 iso_pu_bacteria 2932082852 2932083343 332
200 3300003323 rootH1_10207268 rootH1_102072682 333
201 3300013100 Ga0157373_10000256 Ga0157373_100002568 333
202 3300013307 Ga0157372_10038494 Ga0157372_100384944 333
203 3300005614 Ga0068856_100040048 Ga0068856_1000400485 334
204 3300009545 Ga0105237_10019011 Ga0105237_100190117 334
205 3300010375 Ga0105239_10016752 Ga0105239_100167522 334
206 3300025914 Ga0207671_10162419 Ga0207671_101624192 334
207 3300026078 Ga0207702_10206281 Ga0207702_102062811 334
208 3300031507 Ga0307509_10045900 Ga0307509_100459004 334
209 3300003323 rootH1_10002666 rootH1_1000266617 335
210 3300003323 rootH1_10062121 rootH1_100621212 335
211 3300005339 Ga0070660_100015693 Ga0070660_1000156936 335
212 3300005366 Ga0070659_100000449 Ga0070659_1000004493 335
213 3300025919 Ga0207657_10029952 Ga0207657_100299527 335
214 3300025932 Ga0207690_10030854 Ga0207690_100308543 335
215 3300001989 JGI24739J22299_10004155 JGI24739J22299_100041553 336
216 3300001990 JGI24737J22298_10002537 JGI24737J22298_100025376 336
217 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002315 336
218 3300003316 rootH1_10034282 rootH1_100342822 336
219 3300003323 rootH1_10009087 rootH1_100090873 336
220 3300003323 rootH1_10150387 rootH1_101503873 336
221 3300003323 rootH1_10229938 rootH1_102299382 336
222 3300005288 Ga0065714_10007893 Ga0065714_100078932 336
223 3300005327 Ga0070658_10000011 Ga0070658_1000001126 336
224 3300005563 Ga0068855_100010454 Ga0068855_1000104543 336
225 3300006195 Ga0075366_10045142 Ga0075366_100451422 336
226 3300009093 Ga0105240_10000237 Ga0105240_100002377 336
227 3300009174 Ga0105241_10021319 Ga0105241_100213193 336
228 3300010375 Ga0105239_10004436 Ga0105239_100044363 336
229 3300010375 Ga0105239_10136791 Ga0105239_101367914 336
230 3300013102 Ga0157371_10027826 Ga0157371_100278262 336
231 3300013105 Ga0157369_10115336 Ga0157369_101153363 336
232 3300013306 Ga0163162_10009851 Ga0163162_100098513 336
233 3300013307 Ga0157372_10023256 Ga0157372_100232563 336
234 3300025909 Ga0207705_10000015 Ga0207705_1000001527 336
235 3300025913 Ga0207695_10000013 Ga0207695_100000138 336
236 3300025949 Ga0207667_10066475 Ga0207667_100664752 336
237 3300033179 Ga0307507_10000064 Ga0307507_1000006423 336
238 3300046471 Ga0495650_0000003 Ga0495650_0000003_738300_739337 336
239 3300046492 Ga0495585_0000079 Ga0495585_0000079_3424_4461 336
240 3300046492 Ga0495585_0000411 Ga0495585_0000411_26063_27100 336
241 3300046506 Ga0495583_0041858 Ga0495583_0041858_656_1693 336
242 3300046507 Ga0495606_0012165 Ga0495606_0012165_5328_6362 336
243 3300046512 Ga0495610_0004188 Ga0495610_0004188_3715_4752 336
244 3300046513 Ga0495616_0008226 Ga0495616_0008226_3287_4324 336
245 3300046524 Ga0495648_0002877 Ga0495648_0002877_8835_9872 336
246 3300046538 Ga0495609_0033930 Ga0495609_0033930_548_1585 336
247 3300046557 Ga0495622_0045381 Ga0495622_0045381_969_2006 336
248 3300046558 Ga0495633_0000056 Ga0495633_0000056_48449_49486 336
249 3300046660 Ga0495625_0000159 Ga0495625_0000159_25287_26324 336
250 3300046660 Ga0495625_0001186 Ga0495625_0001186_9395_10432 336
251 3300046665 Ga0495661_0015325 Ga0495661_0015325_3993_5030 336
252 3300046694 Ga0495649_0000003 Ga0495649_0000003_854490_855527 336
253 3300046809 Ga0495600_0026176 Ga0495600_0026176_37_1074 336
254 3300049459 Ga0495678_010545 Ga0495678_010545_143_1192 336
255 3300050493 nmdc:mga0k408_7355_c1 nmdc:mga0k408_7355_c1_1234_2271 336
256 3300053125 Ga0500618_000003 Ga0500618_000003_98860_99897 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

167

326

0.96

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

24

159

0.96

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

176

329

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cvo-assembly1.cif.gz_C crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) 0.8901 12 332
8afv-assembly1.cif.gz_B daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.881 13 329
1vkn-assembly1.cif.gz_B crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution 0.8803 12 332
1vkn-assembly1.cif.gz_C crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution 0.8775 12 332
8afv-assembly2.cif.gz_C daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.8771 13 328
ID Description Score Start End Superfamily
af_Q10SL7_36_116_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9002 13 55 3.40.50.720
2i3gB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8725 144 303 3.30.360.10
3dr3A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8681 145 305 3.30.360.10
af_G5ECJ8_3_395_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8677 11 49 3.50.50.60
af_Q2G1H4_146_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8666 145 303 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A4Q3R1R8-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 1.001 12 105 GO:0006526
GO:0016620
GO:0051287
AF-A0A520H2P5-F1-model_v4 Semialdehyde dehydrogenase NAD-binding domain-containing protein 0.9987 12 110 GO:0006526
GO:0016620
GO:0051287
AF-A0A3D1I3L4-F1-model_v4 deleted 0.9924 12 95
AF-A0A4Q3TDH7-F1-model_v4 deleted 0.987 9 165
AF-A0A3D1I3L4-F1-model_v4 deleted 0.9808 12 95

Feature Viewer

pLDDT pTM Quality
88.99 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map