F366041

General Info

Members Datasets Scaffolds Average Seq Length
255 135 510 82

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_1097427|Ga0501072_1097427_33_305
Length 90
Sequence MTIYPNCMTMLSFRVDDRTVGDVQRWAARLGIDRSELLREALRRHLDRLASEDDAVTWRDQPLEDGERALAEIADWGPAEDWSDWADAAG

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
71 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
72 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
78 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
79 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
80 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
81 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
132 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 2.75
Rhizosphere 94.9
Stem 0
Stem Tuber 0
Unclassified 24.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_1097427 3300049588 Bacteria 619
2 JGI24751J29686_10013512 3300002459 Bacteria 1685
3 JGI25406J46586_10041296 3300003203 Bacteria 1625
4 Ga0070683_100119087 3300005329 Bacteria 2494
5 Ga0070670_100175029 3300005331 Unclassified 1862
6 Ga0070680_100768587 3300005336 Unclassified 830
7 Ga0070682_100504691 3300005337 Unclassified 938
8 Ga0068868_100402099 3300005338 Bacteria 1182
9 Ga0070661_100653444 3300005344 Unclassified 854
10 Ga0070671_100096887 3300005355 Unclassified 2474
11 Ga0070674_102193811 3300005356 Unclassified 504
12 Ga0070667_101830007 3300005367 Unclassified 571
13 Ga0070708_100048668 3300005445 Bacteria 3748
14 Ga0070708_100574373 3300005445 Unclassified 1063
15 Ga0070663_101044173 3300005455 Bacteria 712
16 Ga0070678_101212962 3300005456 Unclassified 700
17 Ga0070681_11107917 3300005458 Unclassified 713
18 Ga0070706_100063104 3300005467 Unclassified 3424
19 Ga0070706_100386083 3300005467 Bacteria 1304
20 Ga0070706_101164554 3300005467 Bacteria 709
21 Ga0070707_100028001 3300005468 Bacteria 5360
22 Ga0070707_100464197 3300005468 Bacteria 1227
23 Ga0070707_100828246 3300005468 Bacteria 889
24 Ga0070684_100275634 3300005535 Bacteria 1540
25 Ga0070684_100698126 3300005535 Bacteria 946
26 Ga0070697_101042460 3300005536 Unclassified 727
27 Ga0070686_101588497 3300005544 Bacteria 553
28 Ga0070665_100675498 3300005548 Bacteria 1046
29 Ga0068857_102130376 3300005577 Unclassified 550
30 Ga0068852_100328817 3300005616 Bacteria 1487
31 Ga0068859_100636291 3300005617 Bacteria 1159
32 Ga0068870_10188837 3300005840 Unclassified 1242
33 Ga0068858_100035445 3300005842 Bacteria 4628
34 Ga0068858_100342882 3300005842 Bacteria 1430
35 Ga0068860_100053932 3300005843 Bacteria 3822
36 Ga0068862_102310106 3300005844 Unclassified 549
37 Ga0081539_10000200 3300005985 Bacteria 139291
38 Ga0081539_10000440 3300005985 Bacteria 88238
39 Ga0075428_100001628 3300006844 Bacteria 23967
40 Ga0075428_100378435 3300006844 Bacteria 1518
41 Ga0075430_100000151 3300006846 Bacteria 44886
42 Ga0075430_100449231 3300006846 Bacteria 1064
43 Ga0075431_100000040 3300006847 Bacteria 67199
44 Ga0075431_101132824 3300006847 Bacteria 746
45 Ga0075434_101731826 3300006871 Unclassified 632
46 Ga0075429_100000328 3300006880 Bacteria 34278
47 Ga0097620_100636208 3300006931 Bacteria 1159
48 Ga0075435_101532288 3300007076 Bacteria 585
49 Ga0105245_10000455 3300009098 Bacteria 37524
50 Ga0105245_12237791 3300009098 Bacteria 600
51 Ga0114129_10000157 3300009147 Bacteria 72630
52 Ga0114129_13343155 3300009147 Bacteria 517
53 Ga0105243_10832601 3300009148 Bacteria 912
54 Ga0105243_11280381 3300009148 Unclassified 749
55 Ga0105248_11557184 3300009177 Bacteria 748
56 Ga0105248_13263532 3300009177 Unclassified 516
57 Ga0105239_10496041 3300010375 Bacteria 1388
58 Ga0105239_11046507 3300010375 Unclassified 939
59 Ga0105246_10384539 3300011119 Unclassified 1161
60 Ga0157372_10474887 3300013307 Bacteria 1458
61 Ga0157375_11971454 3300013308 Bacteria 694
62 Ga0157380_10227135 3300014326 Bacteria 1674
63 Ga0157380_12455639 3300014326 Bacteria 587
64 Ga0157379_10427241 3300014968 Bacteria 1221
65 Ga0157376_11829130 3300014969 Unclassified 644
66 Ga0207699_10862327 3300025906 Bacteria 667
67 Ga0207643_10227752 3300025908 Unclassified 1143
68 Ga0207684_10071295 3300025910 Unclassified 2953
69 Ga0207684_11032542 3300025910 Bacteria 687
70 Ga0207684_11290626 3300025910 Bacteria 601
71 Ga0207649_10036458 3300025920 Bacteria 2962
72 Ga0207652_10519901 3300025921 Bacteria 1071
73 Ga0207646_10051458 3300025922 Bacteria 3686
74 Ga0207646_10731719 3300025922 Bacteria 883
75 Ga0207646_11094780 3300025922 Unclassified 701
76 Ga0207650_10999141 3300025925 Bacteria 712
77 Ga0207687_10172668 3300025927 Bacteria 1669
78 Ga0207644_10080251 3300025931 Unclassified 2409
79 Ga0207686_10691255 3300025934 Bacteria 810
80 Ga0207658_11195583 3300025986 Unclassified 695
81 Ga0207677_10490915 3300026023 Unclassified 1060
82 Ga0207703_10047798 3300026035 Bacteria 3451
83 Ga0207703_10514864 3300026035 Archaea 1125
84 Ga0207703_10898032 3300026035 Unclassified 848
85 Ga0207678_10985446 3300026067 Bacteria 746
86 Ga0268265_12649295 3300028380 Unclassified 507
87 Ga0268264_10182186 3300028381 Unclassified 1908
88 Ga0307513_10481547 3300031456 Bacteria 961
89 Ga0316575_10355620 3300031665 Bacteria 624
90 Ga0316578_10154296 3300031728 Bacteria 1384
91 Ga0307410_10491993 3300031852 Unclassified 1008
92 Ga0307411_10430899 3300032005 Bacteria 1098
93 Ga0373950_0135872 3300034818 Bacteria 554
94 Ga0316574_0053931 3300035398 Bacteria 2511
95 Ga0316574_0055930 3300035398 Bacteria 2467
96 Ga0316574_0105159 3300035398 Unclassified 1808
97 Ga0316574_0367628 3300035398 Bacteria 909
98 Ga0316584_0633709 3300036712 Bacteria 738
99 Ga0436364_1176730 3300037853 Bacteria 110313
100 Ga0436365_0209028 3300039437 Bacteria 989
101 Ga0436365_1862142 3300039437 Bacteria 1514
102 Ga0436361_0788816 3300039447 Bacteria 1285
103 Ga0436362_0167490 3300039453 Bacteria 528
104 Ga0436362_0349361 3300039453 Bacteria 726
105 Ga0436362_0963868 3300039453 Bacteria 666
106 Ga0451800_0249016 3300041459 Unclassified 662
107 Ga0451807_1066267 3300041486 Bacteria 654
108 Ga0451845_0787054 3300041501 Unclassified 699
109 Ga0450914_006868 3300042118 Unclassified 1012
110 Ga0450915_009085 3300042119 Unclassified 674
111 Ga0466960_0650283 3300044901 Bacteria 629
112 Ga0495603_0047255 3300046455 Bacteria 2564
113 Ga0495629_0797782 3300046459 Bacteria 623
114 Ga0495628_0245749 3300046516 Bacteria 1337
115 Ga0495666_0083419 3300046526 Unclassified 1511
116 Ga0495652_0335115 3300046529 Bacteria 1089
117 Ga0495624_0731688 3300046690 Bacteria 586
118 Ga0496102_1467806 3300048905 Unclassified 601
119 Ga0496104_1008103 3300048907 Unclassified 737
120 Ga0496109_0387318 3300048912 Unclassified 1321
121 Ga0496109_1498208 3300048912 Unclassified 609
122 Ga0496110_0040657 3300048913 Bacteria 4053
123 Ga0501031_0007148 3300049568 Bacteria 7287
124 Ga0501031_0155755 3300049568 Bacteria 1493
125 Ga0501031_0925877 3300049568 Unclassified 558
126 Ga0501032_0001285 3300049569 Bacteria 20138
127 Ga0501032_0041295 3300049569 Bacteria 3133
128 Ga0501032_0740421 3300049569 Bacteria 622
129 Ga0501032_0821395 3300049569 Unclassified 587
130 Ga0501033_0060270 3300049570 Bacteria 2800
131 Ga0501033_0084184 3300049570 Bacteria 2331
132 Ga0501033_0374591 3300049570 Bacteria 995
133 Ga0501034_0025573 3300049571 Bacteria 6011
134 Ga0501034_0184493 3300049571 Bacteria 2050
135 Ga0501034_0568073 3300049571 Bacteria 1042
136 Ga0501034_1365782 3300049571 Unclassified 584
137 Ga0501036_0004702 3300049572 Bacteria 11023
138 Ga0501036_0036831 3300049572 Bacteria 4139
139 Ga0501036_0305194 3300049572 Unclassified 1331
140 Ga0501036_0627960 3300049572 Bacteria 890
141 Ga0501037_0001495 3300049573 Bacteria 17092
142 Ga0501037_0006954 3300049573 Bacteria 8265
143 Ga0501037_0397880 3300049573 Bacteria 945
144 Ga0501038_0035116 3300049574 Bacteria 4404
145 Ga0501038_0056951 3300049574 Bacteria 3357
146 Ga0501039_0014493 3300049575 Bacteria 6036
147 Ga0501039_0046043 3300049575 Bacteria 3370
148 Ga0501039_0050311 3300049575 Bacteria 3223
149 Ga0501039_0632067 3300049575 Unclassified 838
150 Ga0501040_0012118 3300049576 Bacteria 5644
151 Ga0501040_0109632 3300049576 Bacteria 1930
152 Ga0501040_0274957 3300049576 Bacteria 1203
153 Ga0501040_0333257 3300049576 Unclassified 1086
154 Ga0501040_0498738 3300049576 Bacteria 877
155 Ga0501040_1092148 3300049576 Bacteria 579
156 Ga0501041_0003625 3300049577 Bacteria 8878
157 Ga0501041_0071380 3300049577 Bacteria 2132
158 Ga0501041_0207004 3300049577 Bacteria 1230
159 Ga0501041_0777129 3300049577 Unclassified 614
160 Ga0501042_0167528 3300049578 Bacteria 1585
161 Ga0501042_0184370 3300049578 Bacteria 1505
162 Ga0501042_0207613 3300049578 Bacteria 1412
163 Ga0501042_0436976 3300049578 Bacteria 949
164 Ga0501042_0617692 3300049578 Bacteria 788
165 Ga0501043_0004591 3300049579 Bacteria 11202
166 Ga0501043_0018269 3300049579 Bacteria 5498
167 Ga0501043_0647829 3300049579 Bacteria 776
168 Ga0501046_0012367 3300049580 Bacteria 7270
169 Ga0501046_0017671 3300049580 Bacteria 5948
170 Ga0501046_0027092 3300049580 Bacteria 4680
171 Ga0501047_0052821 3300049581 Bacteria 3928
172 Ga0501047_0165654 3300049581 Bacteria 2081
173 Ga0501047_0174478 3300049581 Bacteria 2018
174 Ga0501047_1046854 3300049581 Unclassified 629
175 Ga0501048_0006165 3300049582 Bacteria 9128
176 Ga0501048_0016957 3300049582 Bacteria 5368
177 Ga0501048_0047963 3300049582 Unclassified 3047
178 Ga0501048_0551530 3300049582 Bacteria 827
179 Ga0501048_0746221 3300049582 Bacteria 703
180 Ga0501067_0019112 3300049583 Bacteria 3793
181 Ga0501067_0707449 3300049583 Bacteria 566
182 Ga0501068_0006420 3300049584 Bacteria 6481
183 Ga0501068_0040791 3300049584 Bacteria 2788
184 Ga0501069_0011212 3300049585 Bacteria 4754
185 Ga0501070_0001535 3300049586 Bacteria 20528
186 Ga0501070_0025414 3300049586 Bacteria 4967
187 Ga0501070_0350841 3300049586 Bacteria 1197
188 Ga0501070_0365248 3300049586 Bacteria 1170
189 Ga0501070_0856007 3300049586 Unclassified 711
190 Ga0501071_0013826 3300049587 Bacteria 5508
191 Ga0501071_0169453 3300049587 Bacteria 1634
192 Ga0501071_0532907 3300049587 Unclassified 901
193 Ga0501072_0023759 3300049588 Bacteria 4761
194 Ga0501072_0051972 3300049588 Bacteria 3226
195 Ga0501072_0334459 3300049588 Bacteria 1203
196 Ga0501072_1358304 3300049588 Unclassified 550
197 Ga0501073_0018970 3300049589 Bacteria 4970
198 Ga0501073_0485901 3300049589 Unclassified 854
199 Ga0501074_0006494 3300049590 Bacteria 8445
200 Ga0501074_0010074 3300049590 Bacteria 6863
201 Ga0501074_1024914 3300049590 Bacteria 580
202 Ga0501075_0028374 3300049591 Bacteria 4131
203 Ga0501075_0818133 3300049591 Bacteria 709
204 Ga0501076_0015871 3300049592 Bacteria 5699
205 Ga0501076_0046934 3300049592 Bacteria 3413
206 Ga0501076_0247917 3300049592 Bacteria 1457
207 Ga0501076_0643629 3300049592 Bacteria 875
208 Ga0501076_1073049 3300049592 Unclassified 663
209 Ga0501077_0006820 3300049593 Bacteria 7026
210 Ga0501077_0470404 3300049593 Bacteria 805
211 Ga0501079_0129130 3300049741 Bacteria 1966
212 Ga0501079_0650507 3300049741 Unclassified 830
213 Ga0501079_0812417 3300049741 Bacteria 736
214 Ga0501080_0042990 3300049742 Bacteria 4206
215 Ga0501080_0215189 3300049742 Bacteria 1760
216 Ga0501080_0319816 3300049742 Bacteria 1405
217 Ga0501081_0012841 3300049743 Bacteria 5506
218 Ga0501081_0081381 3300049743 Bacteria 2268
219 Ga0501083_0010021 3300049744 Bacteria 6686
220 Ga0501083_0675123 3300049744 Bacteria 672
221 Ga0501271_031456 3300049768 Unclassified 658
222 Ga0501035_0028824 3300049822 Bacteria 5065
223 Ga0501035_0518334 3300049822 Bacteria 980
224 Ga0501035_0617503 3300049822 Unclassified 882
225 Ga0501035_1004501 3300049822 Unclassified 656
226 Ga0501044_0001233 3300049823 Bacteria 30387
227 Ga0501044_0031392 3300049823 Bacteria 5592
228 Ga0501044_0324707 3300049823 Bacteria 1463
229 Ga0501044_0470588 3300049823 Bacteria 1161
230 Ga0501045_0025925 3300049824 Bacteria 4214
231 Ga0501045_0028486 3300049824 Bacteria 4029
232 Ga0501045_0067171 3300049824 Unclassified 2633
233 Ga0501045_0142026 3300049824 Bacteria 1785
234 Ga0501045_0549587 3300049824 Unclassified 856
235 nmdc:mga05p37_825_c1 3300050507 Bacteria 34757
236 nmdc:mga09592_1191602_c1 3300050508 Bacteria 630
237 nmdc:mga09592_3396_c1 3300050508 Bacteria 12869
238 nmdc:mga0qj67_1785_c1 3300050509 Bacteria 15215
239 nmdc:mga0qj67_504836_c1 3300050509 Bacteria 972
240 nmdc:mga06r32_2487_c1 3300050510 Bacteria 16493
241 nmdc:mga06r32_55300_c1 3300050510 Bacteria 3807
242 Ga0495601_0115968 3300053077 Bacteria 1737
243 Ga0495612_0224223 3300053078 Bacteria 833
244 Ga0500620_285576 3300053155 Bacteria 539
245 Ga0501084_0034721 3300054114 Bacteria 4216
246 Ga0501084_0061140 3300054114 Bacteria 3153
247 Ga0501084_0067668 3300054114 Bacteria 2989
248 Ga0501082_0020179 3300060353 Bacteria 5743
249 Ga0501082_0035905 3300060353 Bacteria 4271
250 Ga0501082_0287247 3300060353 Bacteria 1432
251 Ga0501082_0548720 3300060353 Bacteria 1011
252 Ga0530510_0019950 3300061734 Bacteria 4763
253 Ga0530510_0042990 3300061734 Bacteria 3264
254 Ga0530510_0090405 3300061734 Bacteria 2233
255 Ga0530510_0925602 3300061734 Unclassified 666
256 Ga0501072_1097427
257 JGI24751J29686_10013512
258 JGI25406J46586_10041296
259 Ga0070683_100119087
260 Ga0070670_100175029
261 Ga0070680_100768587
262 Ga0070682_100504691
263 Ga0068868_100402099
264 Ga0070661_100653444
265 Ga0070671_100096887
266 Ga0070674_102193811
267 Ga0070667_101830007
268 Ga0070708_100048668
269 Ga0070708_100574373
270 Ga0070663_101044173
271 Ga0070678_101212962
272 Ga0070681_11107917
273 Ga0070706_100063104
274 Ga0070706_100386083
275 Ga0070706_101164554
276 Ga0070707_100028001
277 Ga0070707_100464197
278 Ga0070707_100828246
279 Ga0070684_100275634
280 Ga0070684_100698126
281 Ga0070697_101042460
282 Ga0070686_101588497
283 Ga0070665_100675498
284 Ga0068857_102130376
285 Ga0068852_100328817
286 Ga0068859_100636291
287 Ga0068870_10188837
288 Ga0068858_100035445
289 Ga0068858_100342882
290 Ga0068860_100053932
291 Ga0068862_102310106
292 Ga0081539_10000200
293 Ga0081539_10000440
294 Ga0075428_100001628
295 Ga0075428_100378435
296 Ga0075430_100000151
297 Ga0075430_100449231
298 Ga0075431_100000040
299 Ga0075431_101132824
300 Ga0075434_101731826
301 Ga0075429_100000328
302 Ga0097620_100636208
303 Ga0075435_101532288
304 Ga0105245_10000455
305 Ga0105245_12237791
306 Ga0114129_10000157
307 Ga0114129_13343155
308 Ga0105243_10832601
309 Ga0105243_11280381
310 Ga0105248_11557184
311 Ga0105248_13263532
312 Ga0105239_10496041
313 Ga0105239_11046507
314 Ga0105246_10384539
315 Ga0157372_10474887
316 Ga0157375_11971454
317 Ga0157380_10227135
318 Ga0157380_12455639
319 Ga0157379_10427241
320 Ga0157376_11829130
321 Ga0207699_10862327
322 Ga0207643_10227752
323 Ga0207684_10071295
324 Ga0207684_11032542
325 Ga0207684_11290626
326 Ga0207649_10036458
327 Ga0207652_10519901
328 Ga0207646_10051458
329 Ga0207646_10731719
330 Ga0207646_11094780
331 Ga0207650_10999141
332 Ga0207687_10172668
333 Ga0207644_10080251
334 Ga0207686_10691255
335 Ga0207658_11195583
336 Ga0207677_10490915
337 Ga0207703_10047798
338 Ga0207703_10514864
339 Ga0207703_10898032
340 Ga0207678_10985446
341 Ga0268265_12649295
342 Ga0268264_10182186
343 Ga0307513_10481547
344 Ga0316575_10355620
345 Ga0316578_10154296
346 Ga0307410_10491993
347 Ga0307411_10430899
348 Ga0373950_0135872
349 Ga0316574_0053931
350 Ga0316574_0055930
351 Ga0316574_0105159
352 Ga0316574_0367628
353 Ga0316584_0633709
354 Ga0436364_1176730
355 Ga0436365_0209028
356 Ga0436365_1862142
357 Ga0436361_0788816
358 Ga0436362_0167490
359 Ga0436362_0349361
360 Ga0436362_0963868
361 Ga0451800_0249016
362 Ga0451807_1066267
363 Ga0451845_0787054
364 Ga0450914_006868
365 Ga0450915_009085
366 Ga0466960_0650283
367 Ga0495603_0047255
368 Ga0495629_0797782
369 Ga0495628_0245749
370 Ga0495666_0083419
371 Ga0495652_0335115
372 Ga0495624_0731688
373 Ga0496102_1467806
374 Ga0496104_1008103
375 Ga0496109_0387318
376 Ga0496109_1498208
377 Ga0496110_0040657
378 Ga0501031_0007148
379 Ga0501031_0155755
380 Ga0501031_0925877
381 Ga0501032_0001285
382 Ga0501032_0041295
383 Ga0501032_0740421
384 Ga0501032_0821395
385 Ga0501033_0060270
386 Ga0501033_0084184
387 Ga0501033_0374591
388 Ga0501034_0025573
389 Ga0501034_0184493
390 Ga0501034_0568073
391 Ga0501034_1365782
392 Ga0501036_0004702
393 Ga0501036_0036831
394 Ga0501036_0305194
395 Ga0501036_0627960
396 Ga0501037_0001495
397 Ga0501037_0006954
398 Ga0501037_0397880
399 Ga0501038_0035116
400 Ga0501038_0056951
401 Ga0501039_0014493
402 Ga0501039_0046043
403 Ga0501039_0050311
404 Ga0501039_0632067
405 Ga0501040_0012118
406 Ga0501040_0109632
407 Ga0501040_0274957
408 Ga0501040_0333257
409 Ga0501040_0498738
410 Ga0501040_1092148
411 Ga0501041_0003625
412 Ga0501041_0071380
413 Ga0501041_0207004
414 Ga0501041_0777129
415 Ga0501042_0167528
416 Ga0501042_0184370
417 Ga0501042_0207613
418 Ga0501042_0436976
419 Ga0501042_0617692
420 Ga0501043_0004591
421 Ga0501043_0018269
422 Ga0501043_0647829
423 Ga0501046_0012367
424 Ga0501046_0017671
425 Ga0501046_0027092
426 Ga0501047_0052821
427 Ga0501047_0165654
428 Ga0501047_0174478
429 Ga0501047_1046854
430 Ga0501048_0006165
431 Ga0501048_0016957
432 Ga0501048_0047963
433 Ga0501048_0551530
434 Ga0501048_0746221
435 Ga0501067_0019112
436 Ga0501067_0707449
437 Ga0501068_0006420
438 Ga0501068_0040791
439 Ga0501069_0011212
440 Ga0501070_0001535
441 Ga0501070_0025414
442 Ga0501070_0350841
443 Ga0501070_0365248
444 Ga0501070_0856007
445 Ga0501071_0013826
446 Ga0501071_0169453
447 Ga0501071_0532907
448 Ga0501072_0023759
449 Ga0501072_0051972
450 Ga0501072_0334459
451 Ga0501072_1358304
452 Ga0501073_0018970
453 Ga0501073_0485901
454 Ga0501074_0006494
455 Ga0501074_0010074
456 Ga0501074_1024914
457 Ga0501075_0028374
458 Ga0501075_0818133
459 Ga0501076_0015871
460 Ga0501076_0046934
461 Ga0501076_0247917
462 Ga0501076_0643629
463 Ga0501076_1073049
464 Ga0501077_0006820
465 Ga0501077_0470404
466 Ga0501079_0129130
467 Ga0501079_0650507
468 Ga0501079_0812417
469 Ga0501080_0042990
470 Ga0501080_0215189
471 Ga0501080_0319816
472 Ga0501081_0012841
473 Ga0501081_0081381
474 Ga0501083_0010021
475 Ga0501083_0675123
476 Ga0501271_031456
477 Ga0501035_0028824
478 Ga0501035_0518334
479 Ga0501035_0617503
480 Ga0501035_1004501
481 Ga0501044_0001233
482 Ga0501044_0031392
483 Ga0501044_0324707
484 Ga0501044_0470588
485 Ga0501045_0025925
486 Ga0501045_0028486
487 Ga0501045_0067171
488 Ga0501045_0142026
489 Ga0501045_0549587
490 nmdc:mga05p37_825_c1
491 nmdc:mga09592_1191602_c1
492 nmdc:mga09592_3396_c1
493 nmdc:mga0qj67_1785_c1
494 nmdc:mga0qj67_504836_c1
495 nmdc:mga06r32_2487_c1
496 nmdc:mga06r32_55300_c1
497 Ga0495601_0115968
498 Ga0495612_0224223
499 Ga0500620_285576
500 Ga0501084_0034721
501 Ga0501084_0061140
502 Ga0501084_0067668
503 Ga0501082_0020179
504 Ga0501082_0035905
505 Ga0501082_0287247
506 Ga0501082_0548720
507 Ga0530510_0019950
508 Ga0530510_0042990
509 Ga0530510_0090405
510 Ga0530510_0925602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01402

RHH_1

Ribbon-helix-helix protein, copG family

11

48

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ft7-assembly1.cif.gz_B crystal structure of an extremely stable dimeric protein from sulfolobus islandicus 0.9533 1 41
6iya-assembly3.cif.gz_E-2 structure of the dna binding domain of antitoxin copaso 0.9508 1 45
6iya-assembly1.cif.gz_B structure of the dna binding domain of antitoxin copaso 0.9487 1 45
6iya-assembly2.cif.gz_D structure of the dna binding domain of antitoxin copaso 0.9474 1 45
2rbf-assembly1.cif.gz_A structure of the ribbon-helix-helix domain of escherichia coli puta (puta52) complexed with operator dna (o2) 0.9438 1 43
ID Description Score Start End Superfamily
3ft7B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.9533 1 41 1.10.1220.10
2ba3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.9447 9 35 1.10.1220.10
2ba3B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.9443 9 35 1.10.1220.10
1p94A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.9279 1 41 1.10.1220.10
2hzvC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.9239 2 45 1.10.1220.10
ID Description Score Start End GO Terms
AF-A0A2W6BYG1-F1-model_v4 Ribbon-helix-helix protein, CopG family 0.966 1 39
AF-A0A7R7GJI1-F1-model_v4 CopG-like ribbon-helix-helix domain-containing protein 0.9645 1 47 GO:0006355
AF-A0A209A5D5-F1-model_v4 Arc-like DNA binding domain-containing protein 0.9539 1 47 GO:0006355
GO:0043565
AF-A0A534T7B9-F1-model_v4 Ribbon-helix-helix protein, CopG family 0.9528 2 41 GO:0006355
AF-A0A535SF41-F1-model_v4 Arc family DNA-binding protein 0.9349 1 48 GO:0003677
GO:0006355

Map