F365709

General Info

Members Datasets Scaffolds Average Seq Length
255 175 510 136

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10206895|Ga0157380_102068952
Length 165
Sequence MKPNWLCALFVISGNPFVVGDWWLNHSMKLDTYLNYRGTCEDAFRFYEQHLGGRIVSLERHGNSPNPNLPADWKDKVLHARIEIGGAIVMGADIPNAEPMRSAYLSLALDNVAEAERVYALLVDGGQIFMKMEETPFAKRFAMLRDKFGTSWMLLHQVHAPADQK

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
125 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
126 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
127 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
128 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
143 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
153 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
154 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
155 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
156 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
160 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
161 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.35
Nodule 0
Rhizoplane 1.18
Rhizosphere 95.29
Stem 0
Stem Tuber 0
Unclassified 29.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10206895 3300014326 Bacteria 1745
2 CNAas_1007479 3300000532 Unclassified 710
3 rootL2_10291350 3300003322 Bacteria 1493
4 rootH1_10022092 3300003323 Bacteria 8514
5 JGI25160J50197_1013919 3300003354 Bacteria 2717
6 Ga0065704_10189991 3300005289 Bacteria 1194
7 Ga0065715_10973252 3300005293 Unclassified 553
8 Ga0070676_10208682 3300005328 Unclassified 1284
9 Ga0070683_100127982 3300005329 Bacteria 2402
10 Ga0070690_100032373 3300005330 Bacteria 3265
11 Ga0070690_100456289 3300005330 Unclassified 949
12 Ga0070690_100465009 3300005330 Unclassified 940
13 Ga0070670_101151418 3300005331 Bacteria 708
14 Ga0070670_101168889 3300005331 Unclassified 703
15 Ga0068869_101836177 3300005334 Unclassified 542
16 Ga0070666_10138125 3300005335 Bacteria 1697
17 Ga0070666_10167238 3300005335 Unclassified 1539
18 Ga0070680_100381438 3300005336 Bacteria 1200
19 Ga0068868_100209924 3300005338 Bacteria 1627
20 Ga0070689_100006475 3300005340 Bacteria 8108
21 Ga0070689_100027048 3300005340 Bacteria 4322
22 Ga0070689_100801569 3300005340 Bacteria 828
23 Ga0070687_100024244 3300005343 Bacteria 2894
24 Ga0070669_100000069 3300005353 Bacteria 100095
25 Ga0070669_100093632 3300005353 Bacteria 2257
26 Ga0070669_100433867 3300005353 Unclassified 1080
27 Ga0070669_100668321 3300005353 Unclassified 875
28 Ga0070675_100019216 3300005354 Bacteria 5443
29 Ga0070675_100172749 3300005354 Bacteria 1864
30 Ga0070675_100203482 3300005354 Bacteria 1719
31 Ga0070673_100106258 3300005364 Unclassified 2321
32 Ga0070688_100022004 3300005365 Bacteria 3730
33 Ga0070667_100097869 3300005367 Bacteria 2531
34 Ga0070711_100772309 3300005439 Unclassified 813
35 Ga0070700_100799157 3300005441 Unclassified 759
36 Ga0070694_100450243 3300005444 Bacteria 1016
37 Ga0070678_100812198 3300005456 Unclassified 850
38 Ga0070681_10050224 3300005458 Bacteria 4162
39 Ga0070685_10026078 3300005466 Bacteria 3219
40 Ga0070685_10029183 3300005466 Bacteria 3062
41 Ga0070679_100310230 3300005530 Unclassified 1527
42 Ga0070679_100411259 3300005530 Unclassified 1298
43 Ga0070684_100065160 3300005535 Unclassified 3197
44 Ga0070672_100032452 3300005543 Bacteria 3940
45 Ga0070672_101754336 3300005543 Bacteria 558
46 Ga0070686_100448109 3300005544 Bacteria 992
47 Ga0070693_100963236 3300005547 Bacteria 643
48 Ga0070665_100134650 3300005548 Bacteria 2473
49 Ga0070665_100198132 3300005548 Unclassified 2009
50 Ga0070704_100149194 3300005549 Bacteria 1836
51 Ga0070704_100995654 3300005549 Unclassified 758
52 Ga0068855_100548323 3300005563 Unclassified 1252
53 Ga0070664_100023103 3300005564 Bacteria 5133
54 Ga0070702_100198450 3300005615 Bacteria 1326
55 Ga0068864_101488456 3300005618 Unclassified 680
56 Ga0068870_10100082 3300005840 Bacteria 1636
57 Ga0068863_101136069 3300005841 Bacteria 786
58 Ga0068858_100610973 3300005842 Bacteria 1058
59 Ga0068860_101351355 3300005843 Bacteria 734
60 Ga0075364_10434113 3300006051 Bacteria 897
61 Ga0075362_10493722 3300006177 Bacteria 625
62 Ga0068871_101879066 3300006358 Unclassified 569
63 Ga0075428_100658884 3300006844 Unclassified 1116
64 Ga0075430_100438124 3300006846 Bacteria 1079
65 Ga0075430_100886684 3300006846 Bacteria 735
66 Ga0075430_101030119 3300006846 Unclassified 678
67 Ga0075430_101151181 3300006846 Bacteria 639
68 Ga0075431_100032902 3300006847 Bacteria 5343
69 Ga0075431_100597175 3300006847 Bacteria 1088
70 Ga0075433_10441502 3300006852 Bacteria 1147
71 Ga0075429_100498925 3300006880 Unclassified 1066
72 Ga0075436_100792714 3300006914 Bacteria 705
73 Ga0075435_100018779 3300007076 Bacteria 5267
74 Ga0075435_100988265 3300007076 Bacteria 735
75 Ga0111539_10034149 3300009094 Bacteria 6171
76 Ga0111539_10453869 3300009094 Bacteria 1493
77 Ga0105245_11019233 3300009098 Bacteria 873
78 Ga0114129_10775197 3300009147 Bacteria 1225
79 Ga0114129_12785677 3300009147 Unclassified 581
80 Ga0105243_10317436 3300009148 Bacteria 1418
81 Ga0105243_10333742 3300009148 Bacteria 1386
82 Ga0105243_10601270 3300009148 Bacteria 1059
83 Ga0105243_11036105 3300009148 Bacteria 825
84 Ga0105241_10256389 3300009174 Bacteria 1485
85 Ga0105242_10041290 3300009176 Bacteria 3720
86 Ga0105248_11139945 3300009177 Unclassified 881
87 Ga0105237_10048805 3300009545 Bacteria 4255
88 Ga0105237_10220569 3300009545 Bacteria 1896
89 Ga0105238_10000230 3300009551 Bacteria 62396
90 Ga0105238_10048746 3300009551 Bacteria 4267
91 Ga0105249_12627770 3300009553 Unclassified 576
92 Ga0105246_10251551 3300011119 Bacteria 1403
93 Ga0157373_10316714 3300013100 Unclassified 1109
94 Ga0163162_10379703 3300013306 Bacteria 1546
95 Ga0157372_10415273 3300013307 Bacteria 1568
96 Ga0157375_10005483 3300013308 Bacteria 11032
97 Ga0163163_11755353 3300014325 Unclassified 681
98 Ga0157380_10036251 3300014326 Bacteria 3815
99 Ga0157380_10173928 3300014326 Bacteria 1885
100 Ga0157380_10913893 3300014326 Unclassified 905
101 Ga0157380_11023085 3300014326 Unclassified 861
102 Ga0157380_12271773 3300014326 Bacteria 607
103 Ga0157377_10007777 3300014745 Bacteria 5196
104 Ga0157379_11068047 3300014968 Bacteria 772
105 Ga0207426_1000009 3300025302 Bacteria 797229
106 Ga0207680_10090449 3300025903 Bacteria 1945
107 Ga0207680_10412454 3300025903 Unclassified 956
108 Ga0207645_10167197 3300025907 Unclassified 1440
109 Ga0207643_10024461 3300025908 Bacteria 3333
110 Ga0207707_11539094 3300025912 Unclassified 526
111 Ga0207671_10181049 3300025914 Bacteria 1640
112 Ga0207663_11159995 3300025916 Unclassified 622
113 Ga0207662_10029693 3300025918 Bacteria 3169
114 Ga0207662_10249863 3300025918 Bacteria 1164
115 Ga0207652_10158369 3300025921 Bacteria 2029
116 Ga0207681_10000034 3300025923 Bacteria 163792
117 Ga0207681_10402140 3300025923 Unclassified 1106
118 Ga0207681_10627020 3300025923 Unclassified 890
119 Ga0207694_10000087 3300025924 Bacteria 107288
120 Ga0207694_10042740 3300025924 Bacteria 3497
121 Ga0207650_10442863 3300025925 Bacteria 1080
122 Ga0207659_10049994 3300025926 Bacteria 2968
123 Ga0207659_10139612 3300025926 Bacteria 1880
124 Ga0207644_10208332 3300025931 Bacteria 1545
125 Ga0207690_10722707 3300025932 Bacteria 820
126 Ga0207709_10216400 3300025935 Bacteria 1379
127 Ga0207709_10253979 3300025935 Bacteria 1285
128 Ga0207670_10011448 3300025936 Bacteria 5152
129 Ga0207670_10352168 3300025936 Bacteria 1166
130 Ga0207670_10719287 3300025936 Bacteria 828
131 Ga0207704_10183613 3300025938 Bacteria 1514
132 Ga0207691_10033391 3300025940 Bacteria 4790
133 Ga0207689_10062299 3300025942 Bacteria 3067
134 Ga0207661_10326069 3300025944 Bacteria 1381
135 Ga0207661_10654599 3300025944 Bacteria 965
136 Ga0207679_10049706 3300025945 Bacteria 3061
137 Ga0207679_10069718 3300025945 Bacteria 2647
138 Ga0207712_11642447 3300025961 Unclassified 576
139 Ga0207677_10217259 3300026023 Bacteria 1531
140 Ga0207703_10176095 3300026035 Bacteria 1885
141 Ga0207703_10528835 3300026035 Bacteria 1110
142 Ga0207708_10327522 3300026075 Bacteria 1251
143 Ga0207641_10256384 3300026088 Bacteria 1636
144 Ga0207641_11252444 3300026088 Unclassified 742
145 Ga0207648_10185292 3300026089 Bacteria 1843
146 Ga0207676_12000646 3300026095 Unclassified 578
147 Ga0207683_10185491 3300026121 Bacteria 1887
148 Ga0207683_10317974 3300026121 Bacteria 1426
149 Ga0268266_10132063 3300028379 Bacteria 2234
150 Ga0268266_11199838 3300028379 Unclassified 734
151 Ga0265338_10813663 3300028800 Unclassified 640
152 Ga0265316_10300314 3300031344 Unclassified 1170
153 Ga0307408_100010434 3300031548 Bacteria 6127
154 Ga0307408_100792716 3300031548 Bacteria 859
155 Ga0307405_10979858 3300031731 Unclassified 720
156 Ga0307413_10002287 3300031824 Bacteria 7747
157 Ga0307413_11110326 3300031824 Unclassified 683
158 Ga0307410_10001981 3300031852 Bacteria 9632
159 Ga0307410_10125808 3300031852 Bacteria 1876
160 Ga0307410_10896627 3300031852 Unclassified 759
161 Ga0307410_11990743 3300031852 Unclassified 518
162 Ga0307406_10011885 3300031901 Bacteria 4947
163 Ga0307406_10170640 3300031901 Bacteria 1574
164 Ga0307406_10476608 3300031901 Bacteria 1007
165 Ga0307406_10820149 3300031901 Bacteria 786
166 Ga0307407_10592576 3300031903 Bacteria 824
167 Ga0307412_10566015 3300031911 Bacteria 957
168 Ga0307409_100004959 3300031995 Bacteria 7576
169 Ga0307409_100030136 3300031995 Bacteria 3894
170 Ga0307409_100048615 3300031995 Bacteria 3230
171 Ga0307409_100474441 3300031995 Bacteria 1212
172 Ga0307409_100854944 3300031995 Bacteria 921
173 Ga0307409_101611572 3300031995 Bacteria 677
174 Ga0307416_100000912 3300032002 Bacteria 15587
175 Ga0307416_100321113 3300032002 Bacteria 1550
176 Ga0307416_100438910 3300032002 Unclassified 1355
177 Ga0307416_100495621 3300032002 Bacteria 1285
178 Ga0307416_101490903 3300032002 Bacteria 782
179 Ga0307414_10147197 3300032004 Bacteria 1852
180 Ga0307414_10645151 3300032004 Bacteria 954
181 Ga0307411_10011633 3300032005 Bacteria 4762
182 Ga0307411_10083582 3300032005 Bacteria 2205
183 Ga0307411_10255012 3300032005 Bacteria 1382
184 Ga0307411_10755125 3300032005 Bacteria 852
185 Ga0307415_100003546 3300032126 Bacteria 7959
186 Ga0307415_100494398 3300032126 Bacteria 1068
187 Ga0307415_100660444 3300032126 Bacteria 938
188 Ga0307415_100740188 3300032126 Bacteria 891
189 Ga0307415_101241267 3300032126 Bacteria 704
190 Ga0373934_0359049 3300035086 Unclassified 607
191 Ga0373936_0023401 3300035113 Bacteria 2408
192 Ga0373937_0262420 3300036401 Bacteria 1629
193 Ga0395905_0106482 3300037471 Bacteria 2633
194 Ga0436363_1330964 3300039450 Unclassified 827
195 Ga0451802_2103872 3300041460 Unclassified 687
196 Ga0451807_0920789 3300041486 Unclassified 509
197 Ga0439431_0005282 3300041997 Bacteria 2850
198 Ga0439462_0095949 3300042015 Bacteria 815
199 Ga0450923_133249 3300042125 Bacteria 593
200 Ga0439446_0078200 3300042156 Unclassified 1021
201 Ga0439434_0028420 3300042435 Bacteria 1693
202 Ga0466960_0214026 3300044901 Bacteria 1058
203 Ga0466958_0235918 3300045836 Bacteria 1168
204 Ga0495592_0266318 3300046454 Bacteria 1126
205 Ga0495629_0541176 3300046459 Unclassified 782
206 Ga0495582_0010028 3300046473 Bacteria 5214
207 Ga0495628_0326312 3300046516 Bacteria 1132
208 Ga0495598_0316156 3300046537 Unclassified 594
209 Ga0495611_0281738 3300046648 Bacteria 768
210 Ga0495599_0412019 3300046678 Unclassified 804
211 Ga0495658_0523786 3300046683 Unclassified 759
212 Ga0495613_0788243 3300046689 Unclassified 621
213 Ga0495684_0712669 3300047471 Unclassified 664
214 Ga0496100_0194988 3300048903 Bacteria 1473
215 Ga0501291_026340 3300049514 Bacteria 957
216 Ga0501299_056856 3300049522 Unclassified 820
217 Ga0501299_178494 3300049522 Unclassified 553
218 Ga0501042_0476364 3300049578 Unclassified 906
219 Ga0501046_0847434 3300049580 Unclassified 639
220 Ga0501067_0081396 3300049583 Unclassified 1795
221 Ga0501069_0191108 3300049585 Bacteria 1185
222 Ga0501071_0232482 3300049587 Bacteria 1389
223 Ga0501072_1142059 3300049588 Unclassified 606
224 Ga0501074_0628453 3300049590 Unclassified 759
225 Ga0501075_0684176 3300049591 Bacteria 782
226 Ga0501075_1465073 3300049591 Bacteria 517
227 Ga0501217_074564 3300049661 Unclassified 929
228 Ga0501217_139568 3300049661 Unclassified 717
229 Ga0501249_115001 3300049679 Unclassified 653
230 Ga0501259_062317 3300049688 Unclassified 782
231 Ga0501219_027273 3300049703 Unclassified 523
232 Ga0501234_096754 3300049707 Unclassified 534
233 Ga0501079_1537614 3300049741 Unclassified 523
234 Ga0501081_0182138 3300049743 Bacteria 1520
235 Ga0501268_050589 3300049765 Bacteria 803
236 Ga0501283_025403 3300049779 Bacteria 970
237 nmdc:mga03683_443633_c1 3300050489 Bacteria 624
238 nmdc:mga00v17_573714_c1 3300050491 Bacteria 728
239 nmdc:mga09592_147156_c1 3300050508 Bacteria 2031
240 nmdc:mga0qj67_123679_c1 3300050509 Bacteria 2093
241 nmdc:mga0qj67_259926_c1 3300050509 Bacteria 1408
242 nmdc:mga0qj67_898243_c1 3300050509 Bacteria 698
243 nmdc:mga06r32_576591_c1 3300050510 Bacteria 1097
244 nmdc:mga06r32_59354_c1 3300050510 Bacteria 3678
245 nmdc:mga08y16_1130630_c1 3300050511 Bacteria 757
246 nmdc:mga08y16_25394_c1 3300050511 Bacteria 6248
247 nmdc:mga0n895_752758_c1 3300050512 Bacteria 967
248 nmdc:mga0rr50_32219_c1 3300050513 Bacteria 3732
249 nmdc:mga08x19_1095674_c1 3300050514 Unclassified 565
250 nmdc:mga0a205_510850_c1 3300050515 Bacteria 1058
251 Ga0501084_0398488 3300054114 Bacteria 1163
252 Ga0590071_000621 3300059421 Bacteria 10117
253 Ga0590074_002654 3300059423 Bacteria 2935
254 Ga0590075_053202 3300059424 Bacteria 1039
255 Ga0501082_1545657 3300060353 Unclassified 579
256 Ga0157380_10206895
257 CNAas_1007479
258 rootL2_10291350
259 rootH1_10022092
260 JGI25160J50197_1013919
261 Ga0065704_10189991
262 Ga0065715_10973252
263 Ga0070676_10208682
264 Ga0070683_100127982
265 Ga0070690_100032373
266 Ga0070690_100456289
267 Ga0070690_100465009
268 Ga0070670_101151418
269 Ga0070670_101168889
270 Ga0068869_101836177
271 Ga0070666_10138125
272 Ga0070666_10167238
273 Ga0070680_100381438
274 Ga0068868_100209924
275 Ga0070689_100006475
276 Ga0070689_100027048
277 Ga0070689_100801569
278 Ga0070687_100024244
279 Ga0070669_100000069
280 Ga0070669_100093632
281 Ga0070669_100433867
282 Ga0070669_100668321
283 Ga0070675_100019216
284 Ga0070675_100172749
285 Ga0070675_100203482
286 Ga0070673_100106258
287 Ga0070688_100022004
288 Ga0070667_100097869
289 Ga0070711_100772309
290 Ga0070700_100799157
291 Ga0070694_100450243
292 Ga0070678_100812198
293 Ga0070681_10050224
294 Ga0070685_10026078
295 Ga0070685_10029183
296 Ga0070679_100310230
297 Ga0070679_100411259
298 Ga0070684_100065160
299 Ga0070672_100032452
300 Ga0070672_101754336
301 Ga0070686_100448109
302 Ga0070693_100963236
303 Ga0070665_100134650
304 Ga0070665_100198132
305 Ga0070704_100149194
306 Ga0070704_100995654
307 Ga0068855_100548323
308 Ga0070664_100023103
309 Ga0070702_100198450
310 Ga0068864_101488456
311 Ga0068870_10100082
312 Ga0068863_101136069
313 Ga0068858_100610973
314 Ga0068860_101351355
315 Ga0075364_10434113
316 Ga0075362_10493722
317 Ga0068871_101879066
318 Ga0075428_100658884
319 Ga0075430_100438124
320 Ga0075430_100886684
321 Ga0075430_101030119
322 Ga0075430_101151181
323 Ga0075431_100032902
324 Ga0075431_100597175
325 Ga0075433_10441502
326 Ga0075429_100498925
327 Ga0075436_100792714
328 Ga0075435_100018779
329 Ga0075435_100988265
330 Ga0111539_10034149
331 Ga0111539_10453869
332 Ga0105245_11019233
333 Ga0114129_10775197
334 Ga0114129_12785677
335 Ga0105243_10317436
336 Ga0105243_10333742
337 Ga0105243_10601270
338 Ga0105243_11036105
339 Ga0105241_10256389
340 Ga0105242_10041290
341 Ga0105248_11139945
342 Ga0105237_10048805
343 Ga0105237_10220569
344 Ga0105238_10000230
345 Ga0105238_10048746
346 Ga0105249_12627770
347 Ga0105246_10251551
348 Ga0157373_10316714
349 Ga0163162_10379703
350 Ga0157372_10415273
351 Ga0157375_10005483
352 Ga0163163_11755353
353 Ga0157380_10036251
354 Ga0157380_10173928
355 Ga0157380_10913893
356 Ga0157380_11023085
357 Ga0157380_12271773
358 Ga0157377_10007777
359 Ga0157379_11068047
360 Ga0207426_1000009
361 Ga0207680_10090449
362 Ga0207680_10412454
363 Ga0207645_10167197
364 Ga0207643_10024461
365 Ga0207707_11539094
366 Ga0207671_10181049
367 Ga0207663_11159995
368 Ga0207662_10029693
369 Ga0207662_10249863
370 Ga0207652_10158369
371 Ga0207681_10000034
372 Ga0207681_10402140
373 Ga0207681_10627020
374 Ga0207694_10000087
375 Ga0207694_10042740
376 Ga0207650_10442863
377 Ga0207659_10049994
378 Ga0207659_10139612
379 Ga0207644_10208332
380 Ga0207690_10722707
381 Ga0207709_10216400
382 Ga0207709_10253979
383 Ga0207670_10011448
384 Ga0207670_10352168
385 Ga0207670_10719287
386 Ga0207704_10183613
387 Ga0207691_10033391
388 Ga0207689_10062299
389 Ga0207661_10326069
390 Ga0207661_10654599
391 Ga0207679_10049706
392 Ga0207679_10069718
393 Ga0207712_11642447
394 Ga0207677_10217259
395 Ga0207703_10176095
396 Ga0207703_10528835
397 Ga0207708_10327522
398 Ga0207641_10256384
399 Ga0207641_11252444
400 Ga0207648_10185292
401 Ga0207676_12000646
402 Ga0207683_10185491
403 Ga0207683_10317974
404 Ga0268266_10132063
405 Ga0268266_11199838
406 Ga0265338_10813663
407 Ga0265316_10300314
408 Ga0307408_100010434
409 Ga0307408_100792716
410 Ga0307405_10979858
411 Ga0307413_10002287
412 Ga0307413_11110326
413 Ga0307410_10001981
414 Ga0307410_10125808
415 Ga0307410_10896627
416 Ga0307410_11990743
417 Ga0307406_10011885
418 Ga0307406_10170640
419 Ga0307406_10476608
420 Ga0307406_10820149
421 Ga0307407_10592576
422 Ga0307412_10566015
423 Ga0307409_100004959
424 Ga0307409_100030136
425 Ga0307409_100048615
426 Ga0307409_100474441
427 Ga0307409_100854944
428 Ga0307409_101611572
429 Ga0307416_100000912
430 Ga0307416_100321113
431 Ga0307416_100438910
432 Ga0307416_100495621
433 Ga0307416_101490903
434 Ga0307414_10147197
435 Ga0307414_10645151
436 Ga0307411_10011633
437 Ga0307411_10083582
438 Ga0307411_10255012
439 Ga0307411_10755125
440 Ga0307415_100003546
441 Ga0307415_100494398
442 Ga0307415_100660444
443 Ga0307415_100740188
444 Ga0307415_101241267
445 Ga0373934_0359049
446 Ga0373936_0023401
447 Ga0373937_0262420
448 Ga0395905_0106482
449 Ga0436363_1330964
450 Ga0451802_2103872
451 Ga0451807_0920789
452 Ga0439431_0005282
453 Ga0439462_0095949
454 Ga0450923_133249
455 Ga0439446_0078200
456 Ga0439434_0028420
457 Ga0466960_0214026
458 Ga0466958_0235918
459 Ga0495592_0266318
460 Ga0495629_0541176
461 Ga0495582_0010028
462 Ga0495628_0326312
463 Ga0495598_0316156
464 Ga0495611_0281738
465 Ga0495599_0412019
466 Ga0495658_0523786
467 Ga0495613_0788243
468 Ga0495684_0712669
469 Ga0496100_0194988
470 Ga0501291_026340
471 Ga0501299_056856
472 Ga0501299_178494
473 Ga0501042_0476364
474 Ga0501046_0847434
475 Ga0501067_0081396
476 Ga0501069_0191108
477 Ga0501071_0232482
478 Ga0501072_1142059
479 Ga0501074_0628453
480 Ga0501075_0684176
481 Ga0501075_1465073
482 Ga0501217_074564
483 Ga0501217_139568
484 Ga0501249_115001
485 Ga0501259_062317
486 Ga0501219_027273
487 Ga0501234_096754
488 Ga0501079_1537614
489 Ga0501081_0182138
490 Ga0501268_050589
491 Ga0501283_025403
492 nmdc:mga03683_443633_c1
493 nmdc:mga00v17_573714_c1
494 nmdc:mga09592_147156_c1
495 nmdc:mga0qj67_123679_c1
496 nmdc:mga0qj67_259926_c1
497 nmdc:mga0qj67_898243_c1
498 nmdc:mga06r32_576591_c1
499 nmdc:mga06r32_59354_c1
500 nmdc:mga08y16_1130630_c1
501 nmdc:mga08y16_25394_c1
502 nmdc:mga0n895_752758_c1
503 nmdc:mga0rr50_32219_c1
504 nmdc:mga08x19_1095674_c1
505 nmdc:mga0a205_510850_c1
506 Ga0501084_0398488
507 Ga0590071_000621
508 Ga0590074_002654
509 Ga0590075_053202
510 Ga0501082_1545657

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

29

154

0.95

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

28

155

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8859 1 130
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.866 1 129
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.861 1 130
1u7i-assembly1.cif.gz_B crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa 0.8597 1 131
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.8525 1 129
ID Description Score Start End Superfamily
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.934 75 129 3.30.720.110
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9012 69 129 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8729 8 130 3.10.180.10
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8724 69 129 3.30.720.110
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8657 1 129 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A0U4C6G2-F1-model_v4 PhnB-like domain-containing protein 0.9626 73 131
AF-A0A519TSY8-F1-model_v4 PhnB-like domain-containing protein 0.9602 73 131
AF-A0A1T4JP92-F1-model_v4 PhnB protein 0.9488 1 130
AF-A0A6M4FTM7-F1-model_v4 VOC family protein 0.9481 73 131
AF-A0A257Z3W3-F1-model_v4 Uncharacterized protein 0.9478 70 133

Map