F365670

General Info

Members Datasets Scaffolds Average Seq Length
255 169 231 422

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10094633|Ga0105248_100946333
Length 451
Sequence LLQSIKAAAGELDEGDPGMSGPARGNLPPLSLHVPEPHFRPGDPVDYSFIQVPPAGAQPRPDERCPAEQTNPLCFDLVRVLDDDHRAVGPWDPGLDPETLRRMLRTMALTRAFDDRMYRAQRQGKTSFYMKCTGEEATSVAPAMALADDDMVFPSYRQQGLLIARGYPLVEMINQIYSNRADKLKGRQLPVMYSAKDYGFFSISGNLATQYPQAVGWAMASAIKGDTRIAAAWVGEGSTSEGDFHSALTFATVYNAPVVFNVVNNQWAISSFSGFAGAERTTFAARAIGYGMAGLRVDGNDPLAVYAATRWAADRARGNGGPTLIEHFTYRAEGHSTSDDPARYRSAEERQEWPLGDPVTRLKRHLIALGEWSVEAQEVMDKELTDQVREAMRAAEQNGILGHGLHHPFRTMFEDVFEELPWHLREQSEQAIRERRTKWPDWSDEEPWNAP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
6 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
7 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
8 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
9 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
10 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
11 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
12 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
13 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
14 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
15 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
16 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
17 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
18 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
19 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
20 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
21 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
22 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
23 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
24 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
25 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
101 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
115 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
145 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
149 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
150 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
151 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
152 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
153 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
154 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
155 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
156 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
157 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
158 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
159 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
160 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
161 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
162 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
163 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
164 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
165 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
166 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
167 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.59
Metatranscriptomes 0
Isolates 9.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.14
Nodule 0
Rhizoplane 4.71
Rhizosphere 56.08
Stem 0
Stem Tuber 0
Unclassified 16.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_341734 2162886007 Bacteria 5556
2 JGI24034J26672_10004196 3300002239 Bacteria 2032
3 Ga0055536_1009286 3300003781 Bacteria 4089
4 Ga0055530_10008867 3300003791 Bacteria 3959
5 Ga0055531_10010873 3300003794 Bacteria 4468
6 Ga0065704_10001209 3300005289 Bacteria 8906
7 Ga0065704_10070144 3300005289 Bacteria 333223
8 Ga0070658_10000271 3300005327 Bacteria 45607
9 Ga0070670_100001053 3300005331 Bacteria 21912
10 Ga0070666_10029453 3300005335 Bacteria 3609
11 Ga0070661_100000225 3300005344 Bacteria 46793
12 Ga0070668_100000010 3300005347 Bacteria 132833
13 Ga0070668_100000056 3300005347 Bacteria 70052
14 Ga0070668_100027763 3300005347 Bacteria 4296
15 Ga0070669_100001733 3300005353 Bacteria 15750
16 Ga0070669_100019295 3300005353 Bacteria 4870
17 Ga0070669_100097044 3300005353 Bacteria 2218
18 Ga0070671_100000221 3300005355 Bacteria 37988
19 Ga0070671_100000714 3300005355 Bacteria 23894
20 Ga0070671_100005883 3300005355 Bacteria 9773
21 Ga0070659_100101616 3300005366 Bacteria 2314
22 Ga0070667_100000013 3300005367 Bacteria 255674
23 Ga0070667_100000210 3300005367 Bacteria 68040
24 Ga0070667_100000215 3300005367 Bacteria 67317
25 Ga0070667_100000339 3300005367 Bacteria 52285
26 Ga0070667_100000448 3300005367 Bacteria 42754
27 Ga0070667_100094802 3300005367 Bacteria 2572
28 Ga0070663_100187303 3300005455 Bacteria 1609
29 Ga0070665_100015310 3300005548 Bacteria 7701
30 Ga0068855_100009408 3300005563 Bacteria 11801
31 Ga0068857_100111240 3300005577 Bacteria 2462
32 Ga0068854_100002044 3300005578 Bacteria 12371
33 Ga0068852_100000516 3300005616 Bacteria 25438
34 Ga0068859_100022771 3300005617 Bacteria 6282
35 Ga0068859_100035106 3300005617 Bacteria 5031
36 Ga0068863_100000130 3300005841 Bacteria 79433
37 Ga0068863_100008619 3300005841 Bacteria 9967
38 Ga0068863_100034681 3300005841 Bacteria 4806
39 Ga0068863_100132184 3300005841 Bacteria 2383
40 Ga0068858_100002017 3300005842 Bacteria 20748
41 Ga0068858_100003436 3300005842 Bacteria 15740
42 Ga0068860_100000049 3300005843 Bacteria 208782
43 Ga0068860_100000442 3300005843 Bacteria 52295
44 Ga0068860_100002512 3300005843 Bacteria 19256
45 Ga0068860_100055600 3300005843 Bacteria 3763
46 Ga0068862_100000170 3300005844 Bacteria 72214
47 Ga0068862_100031155 3300005844 Bacteria 4499
48 Ga0075368_10001747 3300006042 Bacteria 6990
49 Ga0075363_100000580 3300006048 Bacteria 12038
50 Ga0075363_100000718 3300006048 Bacteria 11245
51 Ga0075364_10045883 3300006051 Bacteria 2844
52 Ga0075362_10000033 3300006177 Bacteria 50782
53 Ga0075362_10014399 3300006177 Bacteria 3192
54 Ga0075369_10000838 3300006186 Bacteria 10143
55 Ga0075366_10002113 3300006195 Bacteria 10110
56 Ga0075366_10010569 3300006195 Bacteria 5181
57 Ga0075370_10000017 3300006353 Bacteria 60451
58 Ga0075370_10008632 3300006353 Bacteria 5252
59 Ga0075370_10018025 3300006353 Bacteria 3824
60 Ga0075370_10085769 3300006353 Bacteria 1813
61 Ga0075434_100118731 3300006871 Bacteria 2659
62 Ga0097620_100022771 3300006931 Bacteria 6282
63 Ga0097620_100035106 3300006931 Bacteria 5031
64 Ga0105240_10005072 3300009093 Bacteria 19743
65 Ga0105248_10009047 3300009177 Bacteria 10954
66 Ga0105248_10094633 3300009177 Bacteria 3364
67 Ga0105238_10016373 3300009551 Bacteria 7504
68 Ga0105246_10001017 3300011119 Bacteria 16103
69 Ga0157326_1000154 3300012513 Bacteria 7542
70 Ga0157373_10023482 3300013100 Bacteria 4469
71 Ga0209676_1002030 3300025292 Bacteria 15876
72 Ga0209050_1000265 3300025298 Bacteria 112618
73 Ga0209257_1000860 3300025304 Bacteria 43237
74 Ga0207680_10002885 3300025903 Bacteria 8057
75 Ga0207647_10011769 3300025904 Bacteria 6120
76 Ga0207705_10000007 3300025909 Bacteria 597387
77 Ga0207695_10003888 3300025913 Bacteria 20678
78 Ga0207649_10000163 3300025920 Bacteria 54311
79 Ga0207681_10000726 3300025923 Bacteria 21659
80 Ga0207681_10076661 3300025923 Bacteria 2348
81 Ga0207650_10000765 3300025925 Bacteria 24666
82 Ga0207644_10000613 3300025931 Bacteria 22703
83 Ga0207644_10002493 3300025931 Bacteria 11851
84 Ga0207644_10006644 3300025931 Bacteria 7537
85 Ga0207644_10047491 3300025931 Bacteria 3064
86 Ga0207690_10032897 3300025932 Bacteria 3331
87 Ga0207711_10005284 3300025941 Bacteria 10948
88 Ga0207667_10007340 3300025949 Bacteria 13267
89 Ga0207668_10000011 3300025972 Bacteria 184484
90 Ga0207668_10000020 3300025972 Bacteria 140737
91 Ga0207668_10018219 3300025972 Bacteria 4413
92 Ga0207640_10007442 3300025981 Bacteria 6043
93 Ga0207658_10000014 3300025986 Bacteria 218248
94 Ga0207658_10000040 3300025986 Bacteria 142099
95 Ga0207658_10000492 3300025986 Bacteria 36290
96 Ga0207658_10003749 3300025986 Bacteria 10703
97 Ga0207658_10003905 3300025986 Bacteria 10479
98 Ga0207658_10053860 3300025986 Bacteria 2975
99 Ga0207703_10001572 3300026035 Bacteria 20696
100 Ga0207703_10109323 3300026035 Bacteria 2356
101 Ga0207678_10111031 3300026067 Bacteria 2339
102 Ga0207641_10000074 3300026088 Bacteria 145908
103 Ga0207641_10005702 3300026088 Bacteria 10590
104 Ga0207641_10028279 3300026088 Bacteria 4632
105 Ga0207641_10045562 3300026088 Bacteria 3693
106 Ga0207641_10193850 3300026088 Bacteria 1869
107 Ga0207674_10017575 3300026116 Bacteria 7800
108 Ga0207698_10000559 3300026142 Bacteria 21705
109 Ga0209813_10000290 3300027866 Bacteria 14003
110 Ga0268266_10064350 3300028379 Bacteria 3168
111 Ga0268265_10000162 3300028380 Bacteria 81713
112 Ga0268264_10000121 3300028381 Bacteria 190368
113 Ga0268264_10000491 3300028381 Bacteria 52312
114 Ga0268264_10039405 3300028381 Bacteria 3904
115 Ga0268264_10178455 3300028381 Bacteria 1927
116 Ga0265331_10000002 3300031250 Bacteria 511481
117 Ga0265331_10000174 3300031250 Bacteria 79071
118 Ga0265327_10000033 3300031251 Bacteria 317182
119 Ga0316579_10013950 3300031691 Bacteria 3466
120 Ga0265314_10003163 3300031711 Bacteria 16138
121 Ga0265314_10110466 3300031711 Bacteria 1748
122 Ga0307405_10001011 3300031731 Bacteria 11360
123 Ga0307410_10037186 3300031852 Bacteria 3177
124 Ga0307412_10010074 3300031911 Bacteria 5436
125 Ga0307416_100480158 3300032002 Bacteria 1303
126 Ga0307411_10018587 3300032005 Bacteria 3992
127 Ga0316582_0014594 3300036647 Bacteria 4464
128 Ga0237819_00903 3300038705 Bacteria 9206
129 Ga0453684_0294406 3300044712 Bacteria 1847
130 Ga0451576_0000007 3300045051 Bacteria 782228
131 Ga0495638_0014424 3300046460 Bacteria 5340
132 Ga0495583_0000010 3300046506 Bacteria 353523
133 Ga0495606_0083655 3300046507 Bacteria 1978
134 Ga0495610_0001244 3300046512 Bacteria 22880
135 Ga0495643_0028997 3300046522 Bacteria 3099
136 Ga0495643_0040003 3300046522 Bacteria 2562
137 Ga0495597_0010365 3300046542 Bacteria 4558
138 Ga0495668_0000001 3300046616 Bacteria 1013420
139 Ga0495668_0003820 3300046616 Bacteria 11029
140 Ga0495625_0000362 3300046660 Bacteria 69497
141 Ga0495669_0057950 3300046684 Bacteria 1748
142 Ga0495686_0020224 3300047472 Bacteria 4440
143 Ga0495615_0000061 3300048090 Bacteria 34133
144 Ga0495626_0000894 3300048091 Bacteria 26418
145 Ga0496100_0014455 3300048903 Bacteria 4582
146 Ga0496100_0105947 3300048903 Bacteria 1945
147 Ga0496101_0014850 3300048904 Bacteria 5240
148 Ga0496103_0000110 3300048906 Bacteria 90202
149 Ga0496104_0000047 3300048907 Bacteria 148896
150 Ga0496105_0000081 3300048908 Bacteria 70237
151 Ga0496106_0001647 3300048909 Bacteria 16758
152 Ga0496107_0001232 3300048910 Bacteria 15636
153 Ga0496109_0134321 3300048912 Bacteria 2311
154 Ga0496112_0010157 3300048915 Bacteria 8529
155 Ga0496113_0000020 3300048916 Bacteria 70677
156 Ga0496113_0000256 3300048916 Bacteria 25073
157 Ga0496116_0000017 3300048919 Bacteria 554463
158 Ga0496117_0000146 3300048920 Bacteria 152244
159 Ga0496117_0042003 3300048920 Bacteria 3342
160 Ga0496118_0027562 3300048921 Bacteria 4804
161 Ga0496119_0000057 3300048922 Bacteria 173746
162 Ga0496120_0008178 3300048923 Bacteria 7667
163 Ga0496121_0002602 3300048924 Bacteria 27252
164 Ga0496121_0006204 3300048924 Bacteria 14982
165 Ga0496122_0000735 3300048925 Bacteria 64114
166 Ga0496122_0004569 3300048925 Bacteria 17058
167 Ga0496122_0004941 3300048925 Bacteria 16167
168 Ga0496123_0000362 3300048926 Bacteria 85587
169 Ga0496123_0000468 3300048926 Bacteria 70822
170 Ga0496123_0001873 3300048926 Bacteria 27552
171 Ga0496123_0027407 3300048926 Bacteria 4244
172 Ga0496124_0001084 3300048927 Bacteria 42949
173 Ga0496124_0020409 3300048927 Bacteria 6122
174 Ga0496124_0098793 3300048927 Bacteria 2368
175 Ga0496125_0000555 3300048928 Bacteria 64263
176 Ga0496125_0014623 3300048928 Bacteria 7631
177 Ga0496125_0081203 3300048928 Bacteria 2478
178 Ga0496126_0000028 3300048929 Bacteria 394082
179 Ga0496126_0000359 3300048929 Bacteria 94946
180 Ga0496126_0039924 3300048929 Bacteria 4352
181 Ga0501032_0058957 3300049569 Bacteria 2576
182 Ga0501033_0025158 3300049570 Bacteria 4484
183 Ga0501034_0119215 3300049571 Bacteria 2625
184 Ga0501046_0060323 3300049580 Bacteria 2968
185 Ga0501046_0077159 3300049580 Bacteria 2580
186 Ga0501080_0134032 3300049742 Bacteria 2293
187 Ga0501080_0262476 3300049742 Bacteria 1573
188 Ga0501035_0151316 3300049822 Bacteria 2013
189 Ga0501044_0000053 3300049823 Bacteria 141732
190 Ga0501044_0045930 3300049823 Bacteria 4523
191 Ga0501044_0065846 3300049823 Bacteria 3695
192 nmdc:mga03683_244_c1 3300050489 Bacteria 17015
193 nmdc:mga03683_366_c1 3300050489 Bacteria 13036
194 nmdc:mga03n38_304_c1 3300050490 Bacteria 11850
195 nmdc:mga03n38_7125_c1 3300050490 Bacteria 3936
196 nmdc:mga00v17_21131_c1 3300050491 Bacteria 3739
197 nmdc:mga0k408_14396_c1 3300050493 Bacteria 4357
198 nmdc:mga0k408_3237_c1 3300050493 Bacteria 8619
199 nmdc:mga0k408_8_c1 3300050493 Bacteria 161211
200 nmdc:mga06z11_3580_c1 3300050494 Bacteria 6021
201 nmdc:mga04h51_486_c1 3300050495 Bacteria 9497
202 nmdc:mga07m45_10599_c1 3300050496 Bacteria 4341
203 nmdc:mga07m45_37003_c1 3300050496 Bacteria 2721
204 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
205 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
206 nmdc:mga07m45_57019_c1 3300050496 Bacteria 2208
207 nmdc:mga0sz30_425_c1 3300050516 Bacteria 15950
208 nmdc:mga0sz30_582_c1 3300050516 Bacteria 13763
209 Ga0500643_002511 3300053087 Bacteria 9398
210 Ga0500643_010418 3300053087 Bacteria 3461
211 Ga0500595_019507 3300053119 Bacteria 2459
212 Ga0500607_000766 3300053121 Bacteria 30929
213 Ga0500608_001498 3300053122 Bacteria 8347
214 Ga0500642_0002133 3300053130 Bacteria 5747
215 Ga0500655_000098 3300053133 Bacteria 22758
216 Ga0500559_0036216 3300053136 Bacteria 2133
217 Ga0500564_032322 3300053138 Bacteria 2413
218 Ga0500564_044294 3300053138 Bacteria 2044
219 Ga0500573_0081301 3300053140 Bacteria 1841
220 Ga0500590_005753 3300053148 Bacteria 5989
221 Ga0500604_0001260 3300053151 Bacteria 7074
222 Ga0500622_0002066 3300053156 Bacteria 14958
223 Ga0500622_0014199 3300053156 Bacteria 4281
224 Ga0500624_000055 3300053157 Bacteria 72708
225 Ga0500624_000329 3300053157 Bacteria 16004
226 Ga0500636_0001327 3300053177 Bacteria 13422
227 Ga0500636_0021953 3300053177 Bacteria 3777
228 Ga0500636_0104269 3300053177 Bacteria 1609
229 Ga0500625_000006 3300053729 Bacteria 206258
230 Ga0500645_004403 3300053730 Bacteria 5413
231 Ga0501082_0133423 3300060353 Bacteria 2155

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_100000225 Ga0070661_10000022523 362
2 3300025920 Ga0207649_10000163 Ga0207649_1000016317 362
3 3300031250 Ga0265331_10000002 Ga0265331_10000002223 362
4 3300031250 Ga0265331_10000174 Ga0265331_1000017424 362
5 3300031251 Ga0265327_10000033 Ga0265327_10000033209 362
6 3300031711 Ga0265314_10003163 Ga0265314_100031634 362
7 3300031711 Ga0265314_10110466 Ga0265314_101104662 362
8 3300049580 Ga0501046_0060323 Ga0501046_0060323_462_1694 362
9 3300049742 Ga0501080_0134032 Ga0501080_0134032_661_1893 362
10 3300049742 Ga0501080_0262476 Ga0501080_0262476_324_1556 362
11 3300049823 Ga0501044_0065846 Ga0501044_0065846_1429_2661 362
12 3300060353 Ga0501082_0133423 Ga0501082_0133423_881_2113 362
13 3300046460 Ga0495638_0014424 Ga0495638_0014424_616_1899 366
14 3300046506 Ga0495583_0000010 Ga0495583_0000010_15578_16861 366
15 iso_pu_bacteria 2582581305 2585259987 367
16 iso_pu_bacteria 2643221541 2643728449 367
17 iso_pu_bacteria 2643221605 2644039468 367
18 iso_pu_bacteria 2643221606 2644042411 367
19 iso_pu_bacteria 2643221671 2644392049 367
20 3300005335 Ga0070666_10029453 Ga0070666_100294532 369
21 3300005355 Ga0070671_100000714 Ga0070671_10000071419 369
22 3300005367 Ga0070667_100094802 Ga0070667_1000948022 369
23 3300005841 Ga0068863_100132184 Ga0068863_1001321842 369
24 3300025931 Ga0207644_10000613 Ga0207644_100006137 369
25 3300025986 Ga0207658_10053860 Ga0207658_100538602 369
26 3300026088 Ga0207641_10028279 Ga0207641_100282792 369
27 3300005331 Ga0070670_100001053 Ga0070670_1000010532 371
28 3300005347 Ga0070668_100000056 Ga0070668_10000005629 371
29 3300005353 Ga0070669_100019295 Ga0070669_1000192952 371
30 3300005355 Ga0070671_100000221 Ga0070671_10000022128 371
31 3300005367 Ga0070667_100000215 Ga0070667_10000021525 371
32 3300005367 Ga0070667_100000339 Ga0070667_10000033940 371
33 3300005617 Ga0068859_100035106 Ga0068859_1000351061 371
34 3300005841 Ga0068863_100008619 Ga0068863_1000086198 371
35 3300005842 Ga0068858_100002017 Ga0068858_10000201718 371
36 3300005843 Ga0068860_100000049 Ga0068860_10000004940 371
37 3300005843 Ga0068860_100000442 Ga0068860_10000044240 371
38 3300005844 Ga0068862_100000170 Ga0068862_1000001702 371
39 3300006931 Ga0097620_100035106 Ga0097620_1000351061 371
40 3300012513 Ga0157326_1000154 Ga0157326_10001545 371
41 3300025925 Ga0207650_10000765 Ga0207650_1000076514 371
42 3300025931 Ga0207644_10002493 Ga0207644_100024939 371
43 3300025941 Ga0207711_10005284 Ga0207711_100052847 371
44 3300025972 Ga0207668_10000011 Ga0207668_10000011179 371
45 3300025986 Ga0207658_10000014 Ga0207658_1000001448 371
46 3300025986 Ga0207658_10000492 Ga0207658_100004923 371
47 3300026035 Ga0207703_10001572 Ga0207703_1000157217 371
48 3300026088 Ga0207641_10005702 Ga0207641_1000570211 371
49 3300026116 Ga0207674_10017575 Ga0207674_100175752 371
50 3300028380 Ga0268265_10000162 Ga0268265_1000016230 371
51 3300028381 Ga0268264_10000121 Ga0268264_1000012128 371
52 3300028381 Ga0268264_10000491 Ga0268264_1000049123 371
53 3300031911 Ga0307412_10010074 Ga0307412_100100744 371
54 3300032002 Ga0307416_100480158 Ga0307416_1004801581 371
55 3300053157 Ga0500624_000055 Ga0500624_000055_9468_10727 371
56 3300053177 Ga0500636_0001327 Ga0500636_0001327_8191_9450 371
57 3300006871 Ga0075434_100118731 Ga0075434_1001187314 372
58 3300045051 Ga0451576_0000007 Ga0451576_0000007_216610_217905 373
59 3300046522 Ga0495643_0028997 Ga0495643_0028997_83_1351 374
60 3300046542 Ga0495597_0010365 Ga0495597_0010365_3019_4287 374
61 3300046684 Ga0495669_0057950 Ga0495669_0057950_141_1409 374
62 3300053087 Ga0500643_010418 Ga0500643_010418_531_1799 374
63 3300053130 Ga0500642_0002133 Ga0500642_0002133_3938_5206 374
64 3300053133 Ga0500655_000098 Ga0500655_000098_3223_4491 374
65 3300053148 Ga0500590_005753 Ga0500590_005753_778_2046 374
66 3300053156 Ga0500622_0014199 Ga0500622_0014199_1414_2682 374
67 iso_pu_bacteria 2738541275 2738711361 374
68 iso_pu_bacteria 2738541301 2738849786 374
69 iso_pu_bacteria 2738541304 2738865515 374
70 iso_pu_bacteria 2738543022 2739298033 374
71 iso_pu_bacteria 2738543033 2739359711 374
72 iso_pu_bacteria 2928100450 2928103247 374
73 iso_pu_bacteria 2928959182 2928962723 374
74 3300025972 Ga0207668_10018219 Ga0207668_100182193 375
75 3300028379 Ga0268266_10064350 Ga0268266_100643503 375
76 3300038705 Ga0237819_00903 Ga0237819_00903_1285_2559 375
77 3300053151 Ga0500604_0001260 Ga0500604_0001260_1943_3214 375
78 3300053157 Ga0500624_000329 Ga0500624_000329_14720_15991 375
79 3300053177 Ga0500636_0021953 Ga0500636_0021953_1574_2845 375
80 3300046616 Ga0495668_0003820 Ga0495668_0003820_363_1637 376
81 3300048926 Ga0496123_0027407 Ga0496123_0027407_2794_4071 376
82 iso_pu_bacteria 2512564014 2512645768 376
83 iso_pu_bacteria 2643221588 2643949118 376
84 iso_pu_bacteria 2775507255 2778123653 376
85 iso_pu_bacteria 3000865235 3000866281 376
86 3300005353 Ga0070669_100001733 Ga0070669_10000173310 378
87 3300005367 Ga0070667_100000210 Ga0070667_10000021056 378
88 3300005548 Ga0070665_100015310 Ga0070665_1000153103 378
89 3300005843 Ga0068860_100055600 Ga0068860_1000556002 378
90 3300005844 Ga0068862_100031155 Ga0068862_1000311555 378
91 3300009177 Ga0105248_10009047 Ga0105248_100090476 378
92 3300025923 Ga0207681_10000726 Ga0207681_1000072615 378
93 3300025931 Ga0207644_10006644 Ga0207644_100066443 378
94 3300025986 Ga0207658_10003749 Ga0207658_1000374911 378
95 3300026088 Ga0207641_10193850 Ga0207641_101938502 378
96 3300028381 Ga0268264_10039405 Ga0268264_100394052 378
97 3300047472 Ga0495686_0020224 Ga0495686_0020224_2972_4252 378
98 3300048928 Ga0496125_0081203 Ga0496125_0081203_492_1772 378
99 3300053119 Ga0500595_019507 Ga0500595_019507_834_2144 378
100 3300005347 Ga0070668_100000010 Ga0070668_1000000108 379
101 3300005353 Ga0070669_100097044 Ga0070669_1000970442 379
102 3300005367 Ga0070667_100000013 Ga0070667_100000013173 379
103 3300005841 Ga0068863_100000130 Ga0068863_10000013072 379
104 3300005843 Ga0068860_100002512 Ga0068860_10000251220 379
105 3300025903 Ga0207680_10002885 Ga0207680_100028853 379
106 3300025923 Ga0207681_10076661 Ga0207681_100766612 379
107 3300025972 Ga0207668_10000020 Ga0207668_100000208 379
108 3300025986 Ga0207658_10000040 Ga0207658_1000004099 379
109 3300026088 Ga0207641_10000074 Ga0207641_10000074136 379
110 3300048927 Ga0496124_0098793 Ga0496124_0098793_677_1966 379
111 3300053087 Ga0500643_002511 Ga0500643_002511_5973_7259 379
112 3300053136 Ga0500559_0036216 Ga0500559_0036216_157_1443 379
113 iso_pu_bacteria 2643221560 2643823291 379
114 iso_pu_bacteria 8054302542 8054307102 379
115 3300005327 Ga0070658_10000271 Ga0070658_1000027114 380
116 3300005563 Ga0068855_100009408 Ga0068855_1000094083 380
117 3300005577 Ga0068857_100111240 Ga0068857_1001112402 380
118 3300005578 Ga0068854_100002044 Ga0068854_1000020443 380
119 3300005616 Ga0068852_100000516 Ga0068852_1000005169 380
120 3300005617 Ga0068859_100022771 Ga0068859_1000227718 380
121 3300005842 Ga0068858_100003436 Ga0068858_10000343617 380
122 3300006931 Ga0097620_100022771 Ga0097620_1000227718 380
123 3300011119 Ga0105246_10001017 Ga0105246_1000101715 380
124 3300013100 Ga0157373_10023482 Ga0157373_100234824 380
125 3300025904 Ga0207647_10011769 Ga0207647_100117693 380
126 3300025909 Ga0207705_10000007 Ga0207705_1000000782 380
127 3300025913 Ga0207695_10003888 Ga0207695_1000388811 380
128 3300025931 Ga0207644_10047491 Ga0207644_100474912 380
129 3300025949 Ga0207667_10007340 Ga0207667_100073403 380
130 3300025981 Ga0207640_10007442 Ga0207640_100074423 380
131 3300026142 Ga0207698_10000559 Ga0207698_1000055913 380
132 3300028381 Ga0268264_10178455 Ga0268264_101784552 380
133 3300048903 Ga0496100_0105947 Ga0496100_0105947_44_1327 380
134 3300048909 Ga0496106_0001647 Ga0496106_0001647_8118_9401 380
135 3300048910 Ga0496107_0001232 Ga0496107_0001232_7569_8852 380
136 3300048912 Ga0496109_0134321 Ga0496109_0134321_510_1793 380
137 3300048916 Ga0496113_0000256 Ga0496113_0000256_14903_16186 380
138 iso_pu_bacteria 2895880812 2895882610 380
139 3300005366 Ga0070659_100101616 Ga0070659_1001016162 381
140 3300005455 Ga0070663_100187303 Ga0070663_1001873032 381
141 3300025932 Ga0207690_10032897 Ga0207690_100328972 381
142 3300026067 Ga0207678_10111031 Ga0207678_101110311 381
143 3300048929 Ga0496126_0039924 Ga0496126_0039924_248_1537 381
144 3300006353 Ga0075370_10008632 Ga0075370_100086325 382
145 3300050496 nmdc:mga07m45_10599_c1 nmdc:mga07m45_10599_c1_285_1595 382
146 3300053156 Ga0500622_0002066 Ga0500622_0002066_8864_10174 382
147 iso_pu_bacteria 2739367664 2739649988 382
148 iso_pu_bacteria 2739367865 2740028461 382
149 iso_pu_bacteria 2818991438 2819550846 382
150 iso_pu_bacteria 2896253425 2896255385 382
151 3300003781 Ga0055536_1009286 Ga0055536_10092863 383
152 3300003794 Ga0055531_10010873 Ga0055531_100108733 383
153 3300025304 Ga0209257_1000860 Ga0209257_100086023 383
154 3300046616 Ga0495668_0000001 Ga0495668_0000001_427223_428518 383
155 3300050493 nmdc:mga0k408_14396_c1 nmdc:mga0k408_14396_c1_1843_3141 383
156 3300031852 Ga0307410_10037186 Ga0307410_100371864 384
157 3300032005 Ga0307411_10018587 Ga0307411_100185873 384
158 iso_pu_bacteria 2852680915 2852681229 384
159 3300009093 Ga0105240_10005072 Ga0105240_1000507210 385
160 3300009551 Ga0105238_10016373 Ga0105238_100163733 385
161 3300002239 JGI24034J26672_10004196 JGI24034J26672_100041962 386
162 3300003791 Ga0055530_10008867 Ga0055530_100088673 386
163 3300005289 Ga0065704_10001209 Ga0065704_100012093 386
164 3300005289 Ga0065704_10070144 Ga0065704_10070144206 386
165 3300005347 Ga0070668_100027763 Ga0070668_1000277633 386
166 3300005355 Ga0070671_100005883 Ga0070671_1000058833 386
167 3300005367 Ga0070667_100000448 Ga0070667_10000044831 386
168 3300005841 Ga0068863_100034681 Ga0068863_1000346814 386
169 3300006042 Ga0075368_10001747 Ga0075368_1000174710 386
170 3300006048 Ga0075363_100000580 Ga0075363_1000005803 386
171 3300006048 Ga0075363_100000718 Ga0075363_10000071811 386
172 3300006051 Ga0075364_10045883 Ga0075364_100458833 386
173 3300006177 Ga0075362_10000033 Ga0075362_1000003355 386
174 3300006177 Ga0075362_10014399 Ga0075362_100143992 386
175 3300006186 Ga0075369_10000838 Ga0075369_100008388 386
176 3300006195 Ga0075366_10002113 Ga0075366_100021134 386
177 3300006195 Ga0075366_10010569 Ga0075366_100105695 386
178 3300006353 Ga0075370_10000017 Ga0075370_1000001732 386
179 3300006353 Ga0075370_10018025 Ga0075370_100180254 386
180 3300006353 Ga0075370_10085769 Ga0075370_100857692 386
181 3300025292 Ga0209676_1002030 Ga0209676_10020303 386
182 3300025298 Ga0209050_1000265 Ga0209050_1000265107 386
183 3300025986 Ga0207658_10003905 Ga0207658_100039059 386
184 3300026035 Ga0207703_10109323 Ga0207703_101093232 386
185 3300026088 Ga0207641_10045562 Ga0207641_100455622 386
186 3300027866 Ga0209813_10000290 Ga0209813_100002904 386
187 3300031691 Ga0316579_10013950 Ga0316579_100139503 386
188 3300031731 Ga0307405_10001011 Ga0307405_100010113 386
189 3300036647 Ga0316582_0014594 Ga0316582_0014594_1888_3198 386
190 3300044712 Ga0453684_0294406 Ga0453684_0294406_435_1739 386
191 3300046507 Ga0495606_0083655 Ga0495606_0083655_317_1615 386
192 3300046512 Ga0495610_0001244 Ga0495610_0001244_18001_19299 386
193 3300046522 Ga0495643_0040003 Ga0495643_0040003_662_1972 386
194 3300046660 Ga0495625_0000362 Ga0495625_0000362_31970_33280 386
195 3300048090 Ga0495615_0000061 Ga0495615_0000061_4117_5427 386
196 3300048091 Ga0495626_0000894 Ga0495626_0000894_3534_4832 386
197 3300048903 Ga0496100_0014455 Ga0496100_0014455_958_2292 386
198 3300048904 Ga0496101_0014850 Ga0496101_0014850_1230_2564 386
199 3300048906 Ga0496103_0000110 Ga0496103_0000110_34062_35396 386
200 3300048907 Ga0496104_0000047 Ga0496104_0000047_54718_56052 386
201 3300048908 Ga0496105_0000081 Ga0496105_0000081_34857_36191 386
202 3300048915 Ga0496112_0010157 Ga0496112_0010157_1489_2823 386
203 3300048916 Ga0496113_0000020 Ga0496113_0000020_36172_37506 386
204 3300048919 Ga0496116_0000017 Ga0496116_0000017_126882_128180 386
205 3300048920 Ga0496117_0000146 Ga0496117_0000146_22512_23846 386
206 3300048920 Ga0496117_0042003 Ga0496117_0042003_1806_3104 386
207 3300048921 Ga0496118_0027562 Ga0496118_0027562_1997_3331 386
208 3300048922 Ga0496119_0000057 Ga0496119_0000057_10083_11417 386
209 3300048923 Ga0496120_0008178 Ga0496120_0008178_1222_2556 386
210 3300048924 Ga0496121_0002602 Ga0496121_0002602_16198_17532 386
211 3300048924 Ga0496121_0006204 Ga0496121_0006204_11775_13073 386
212 3300048925 Ga0496122_0000735 Ga0496122_0000735_29207_30541 386
213 3300048925 Ga0496122_0004569 Ga0496122_0004569_11486_12784 386
214 3300048925 Ga0496122_0004941 Ga0496122_0004941_11768_13078 386
215 3300048926 Ga0496123_0000362 Ga0496123_0000362_56659_57993 386
216 3300048926 Ga0496123_0000468 Ga0496123_0000468_66480_67790 386
217 3300048926 Ga0496123_0001873 Ga0496123_0001873_9579_10877 386
218 3300048927 Ga0496124_0001084 Ga0496124_0001084_26348_27682 386
219 3300048927 Ga0496124_0020409 Ga0496124_0020409_3549_4847 386
220 3300048928 Ga0496125_0000555 Ga0496125_0000555_46857_48191 386
221 3300048928 Ga0496125_0014623 Ga0496125_0014623_2803_4101 386
222 3300048929 Ga0496126_0000028 Ga0496126_0000028_28442_29776 386
223 3300048929 Ga0496126_0000359 Ga0496126_0000359_33187_34485 386
224 3300049569 Ga0501032_0058957 Ga0501032_0058957_1243_2550 386
225 3300049570 Ga0501033_0025158 Ga0501033_0025158_969_2276 386
226 3300049571 Ga0501034_0119215 Ga0501034_0119215_572_1879 386
227 3300049580 Ga0501046_0077159 Ga0501046_0077159_922_2229 386
228 3300049822 Ga0501035_0151316 Ga0501035_0151316_340_1647 386
229 3300049823 Ga0501044_0000053 Ga0501044_0000053_69386_70684 386
230 3300049823 Ga0501044_0045930 Ga0501044_0045930_2025_3332 386
231 3300050489 nmdc:mga03683_244_c1 nmdc:mga03683_244_c1_11228_12526 386
232 3300050489 nmdc:mga03683_366_c1 nmdc:mga03683_366_c1_1748_3046 386
233 3300050490 nmdc:mga03n38_304_c1 nmdc:mga03n38_304_c1_4376_5674 386
234 3300050490 nmdc:mga03n38_7125_c1 nmdc:mga03n38_7125_c1_158_1456 386
235 3300050491 nmdc:mga00v17_21131_c1 nmdc:mga00v17_21131_c1_870_2168 386
236 3300050493 nmdc:mga0k408_3237_c1 nmdc:mga0k408_3237_c1_2949_4247 386
237 3300050493 nmdc:mga0k408_8_c1 nmdc:mga0k408_8_c1_2917_4215 386
238 3300050494 nmdc:mga06z11_3580_c1 nmdc:mga06z11_3580_c1_1663_2961 386
239 3300050495 nmdc:mga04h51_486_c1 nmdc:mga04h51_486_c1_1691_2989 386
240 3300050496 nmdc:mga07m45_37003_c1 nmdc:mga07m45_37003_c1_1379_2677 386
241 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_33959_35257 386
242 3300050496 nmdc:mga07m45_4_c1 nmdc:mga07m45_4_c1_148546_149844 386
243 3300050496 nmdc:mga07m45_57019_c1 nmdc:mga07m45_57019_c1_441_1739 386
244 3300050516 nmdc:mga0sz30_425_c1 nmdc:mga0sz30_425_c1_10791_12089 386
245 3300050516 nmdc:mga0sz30_582_c1 nmdc:mga0sz30_582_c1_8951_10249 386
246 3300053121 Ga0500607_000766 Ga0500607_000766_24172_25470 386
247 3300053138 Ga0500564_032322 Ga0500564_032322_836_2155 386
248 3300053730 Ga0500645_004403 Ga0500645_004403_3049_4347 386
249 3300009177 Ga0105248_10094633 Ga0105248_100946333 398
250 3300053122 Ga0500608_001498 Ga0500608_001498_5022_6398 399
251 3300053138 Ga0500564_044294 Ga0500564_044294_434_1810 399
252 3300053140 Ga0500573_0081301 Ga0500573_0081301_313_1689 399
253 3300053177 Ga0500636_0104269 Ga0500636_0104269_151_1527 399
254 3300053729 Ga0500625_000006 Ga0500625_000006_118117_119493 399
255 2162886007 SwRhRL2b_contig_341734 SwRhRL2b_0071.00007130 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00676

E1_dh

Dehydrogenase E1 component

104

403

0.98

PF12573

OxoDH_E1alpha_N

2-oxoisovalerate dehydrogenase E1 alpha subunit N terminal

28

68

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qs0-assembly1.cif.gz_A-2 crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) 0.8908 28 386
1v1r-assembly1.cif.gz_A-2 crosstalk between cofactor binding and the phosphorylation loop conformation in the bckd machine 0.8849 77 393
3exi-assembly1.cif.gz_A-2 crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex with the subunit-binding domain (sbd) of e2p, but sbd cannot be modeled into the electron density 0.8685 99 382
6cer-assembly1.cif.gz_C human pyruvate dehydrogenase complex e1 component v138m mutation 0.863 99 382
6cer-assembly2.cif.gz_E human pyruvate dehydrogenase complex e1 component v138m mutation 0.8616 99 382
ID Description Score Start End Superfamily
1v1rA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8849 77 393 3.40.50.970
2bp7G00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8704 28 395 3.40.50.970
af_I1KHP5_58_413_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8602 98 378 3.40.50.970
1um9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8577 79 395 3.40.50.970
af_Q2FY52_1_330_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8315 98 395 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A529SZ83-F1-model_v4 2-oxoisovalerate dehydrogenase subunit alpha (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) 0.9191 80 330 GO:0003863
GO:0009083
AF-A0A5C7V525-F1-model_v4 2-oxoisovalerate dehydrogenase subunit alpha (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) 0.9166 30 335 GO:0003863
GO:0009083
AF-A0A381XZC0-F1-model_v4 Dehydrogenase E1 component domain-containing protein 0.9152 74 376 GO:0003863
GO:0009083
AF-A0A529SZ83-F1-model_v4 2-oxoisovalerate dehydrogenase subunit alpha (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) 0.9087 80 330 GO:0003863
GO:0009083
AF-A0A381XZC0-F1-model_v4 Dehydrogenase E1 component domain-containing protein 0.9066 74 376 GO:0003863
GO:0009083

Feature Viewer

pLDDT pTM Quality
77.91 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map