F365644

General Info

Members Datasets Scaffolds Average Seq Length
255 182 254 138

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_11224584|Ga0111539_112245841
Length 135
Sequence MTFHVERIDHVVLRVRDLPAMVRFYEQALGFKVERTLERLKLVQMRAGASMLDLIQGERPADSRIGGGGNMDHLCFRIEPFERSTIESRLSPLGIAIGETVERYGAEGTGLSVYFNDPEGNQIELKGPPKTPASP

Samples

Sample ID Description Type Environment
1 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
139 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
140 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
141 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
142 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
176 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
177 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
178 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
179 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
180 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
181 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.55
Nodule 0.78
Rhizoplane 1.57
Rhizosphere 78.82
Stem 0
Stem Tuber 0
Unclassified 6.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1008277 3300002705 Bacteria 2635
2 JGI25156J39149_1026337 3300002705 Bacteria 923
3 JGI25154J39366_1001935 3300002738 Bacteria 6174
4 JGI25157J39369_1000020 3300002741 Bacteria 173287
5 rootH1_10001648 3300003316 Bacteria 9110
6 rootH1_10052607 3300003316 Bacteria 1799
7 Ga0055539_1000155 3300003752 Bacteria 65927
8 Ga0055539_1000799 3300003752 Bacteria 7472
9 Ga0055533_1000028 3300003756 Bacteria 311012
10 Ga0055525_1001410 3300003759 Bacteria 4509
11 Ga0055535_1000575 3300003761 Bacteria 30861
12 Ga0055529_1000619 3300003763 Bacteria 26617
13 Ga0055540_1006831 3300003792 Bacteria 4442
14 Ga0070658_10116658 3300005327 Bacteria 2216
15 Ga0070658_10721514 3300005327 Bacteria 866
16 Ga0070690_100010988 3300005330 Bacteria 5286
17 Ga0070670_100035261 3300005331 Bacteria 4308
18 Ga0070670_101448685 3300005331 Bacteria 630
19 Ga0068869_100029346 3300005334 Bacteria 3853
20 Ga0070660_100049466 3300005339 Bacteria 3232
21 Ga0070660_100066561 3300005339 Bacteria 2805
22 Ga0070660_100597276 3300005339 Bacteria 923
23 Ga0070689_100758985 3300005340 Bacteria 851
24 Ga0070661_100685532 3300005344 Bacteria 834
25 Ga0070661_101026939 3300005344 Bacteria 685
26 Ga0070669_100638754 3300005353 Bacteria 895
27 Ga0070673_100011577 3300005364 Bacteria 6026
28 Ga0070659_100138104 3300005366 Unclassified 1983
29 Ga0070659_100170522 3300005366 Bacteria 1782
30 Ga0070667_101612840 3300005367 Bacteria 610
31 Ga0070709_10250393 3300005434 Bacteria 1276
32 Ga0070705_100009083 3300005440 Bacteria 4933
33 Ga0070678_101502843 3300005456 Bacteria 631
34 Ga0070706_100119968 3300005467 Bacteria 2451
35 Ga0070698_100521524 3300005471 Bacteria 1127
36 Ga0070699_100255554 3300005518 Bacteria 1566
37 Ga0070699_100288918 3300005518 Bacteria 1470
38 Ga0070679_100069708 3300005530 Bacteria 3507
39 Ga0070684_100133551 3300005535 Bacteria 2240
40 Ga0068853_101351219 3300005539 Bacteria 689
41 Ga0070686_100333398 3300005544 Bacteria 1135
42 Ga0070696_100115465 3300005546 Bacteria 1937
43 Ga0070693_100030140 3300005547 Bacteria 2964
44 Ga0070665_100694277 3300005548 Bacteria 1031
45 Ga0068855_100000405 3300005563 Bacteria 53352
46 Ga0068855_100034980 3300005563 Bacteria 5986
47 Ga0068855_100064160 3300005563 Bacteria 4284
48 Ga0068855_100113381 3300005563 Bacteria 3110
49 Ga0068855_100495913 3300005563 Bacteria 1328
50 Ga0068857_100085793 3300005577 Bacteria 2814
51 Ga0068857_100156241 3300005577 Bacteria 2068
52 Ga0068854_100010301 3300005578 Bacteria 6058
53 Ga0068854_100571592 3300005578 Bacteria 961
54 Ga0068854_100687542 3300005578 Bacteria 882
55 Ga0068856_100000790 3300005614 Bacteria 34216
56 Ga0068852_101581869 3300005616 Bacteria 678
57 Ga0068859_101025292 3300005617 Bacteria 907
58 Ga0068866_10637124 3300005718 Bacteria 724
59 Ga0068863_100220007 3300005841 Bacteria 1829
60 Ga0068858_100858741 3300005842 Bacteria 887
61 Ga0068862_100801136 3300005844 Bacteria 920
62 Ga0081455_10056681 3300005937 Bacteria 3326
63 Ga0070716_100036919 3300006173 Bacteria 2697
64 Ga0075366_10097626 3300006195 Bacteria 1762
65 Ga0075370_10175841 3300006353 Bacteria 1259
66 Ga0068865_100372664 3300006881 Unclassified 1162
67 Ga0097620_101025266 3300006931 Bacteria 907
68 Ga0099826_10000002 3300006948 Bacteria 1125830
69 Ga0105240_10020464 3300009093 Bacteria 8824
70 Ga0105240_10324480 3300009093 Bacteria 1754
71 Ga0105240_10549022 3300009093 Unclassified 1279
72 Ga0105240_10978589 3300009093 Bacteria 906
73 Ga0105240_12643712 3300009093 Bacteria 518
74 Ga0111539_11108100 3300009094 Bacteria 920
75 Ga0111539_11224584 3300009094 Bacteria 872
76 Ga0105245_10314785 3300009098 Bacteria 1540
77 Ga0105245_10882202 3300009098 Bacteria 936
78 Ga0105245_12539471 3300009098 Bacteria 566
79 Ga0105243_12467268 3300009148 Bacteria 559
80 Ga0105241_10084118 3300009174 Bacteria 2497
81 Ga0105241_10179366 3300009174 Bacteria 1756
82 Ga0105242_10300376 3300009176 Bacteria 1465
83 Ga0105242_11867120 3300009176 Bacteria 640
84 Ga0105248_10372306 3300009177 Bacteria 1608
85 Ga0105237_10181081 3300009545 Bacteria 2107
86 Ga0105237_10406232 3300009545 Bacteria 1367
87 Ga0105237_10481311 3300009545 Bacteria 1247
88 Ga0105238_10060386 3300009551 Bacteria 3795
89 Ga0105238_10073985 3300009551 Bacteria 3401
90 Ga0105238_11540756 3300009551 Bacteria 694
91 Ga0105239_10043505 3300010375 Bacteria 4923
92 Ga0105246_10091790 3300011119 Bacteria 2190
93 Ga0157369_10080478 3300013105 Bacteria 3488
94 Ga0157374_10740116 3300013296 Bacteria 998
95 Ga0163162_10982017 3300013306 Bacteria 954
96 Ga0157372_10306545 3300013307 Bacteria 1848
97 Ga0157372_12490873 3300013307 Bacteria 594
98 Ga0163163_10341652 3300014325 Bacteria 1552
99 Ga0157377_11394711 3300014745 Bacteria 552
100 Ga0157379_11053404 3300014968 Bacteria 777
101 Ga0157379_11543200 3300014968 Bacteria 647
102 Ga0209674_100007 3300025226 Bacteria 1077082
103 Ga0209563_100033 3300025230 Bacteria 457883
104 Ga0207427_100501 3300025231 Bacteria 20836
105 Ga0209258_100575 3300025242 Bacteria 30925
106 Ga0209258_100655 3300025242 Bacteria 25327
107 Ga0209646_1000062 3300025246 Bacteria 252045
108 Ga0209026_1000026 3300025250 Bacteria 352109
109 Ga0209677_100082 3300025253 Bacteria 118875
110 Ga0209677_100116 3300025253 Bacteria 82606
111 Ga0209759_1000050 3300025256 Bacteria 215979
112 Ga0209759_1000916 3300025256 Bacteria 21727
113 Ga0209759_1001283 3300025256 Bacteria 15000
114 Ga0209455_1000093 3300025272 Bacteria 220487
115 Ga0207426_1023642 3300025302 Bacteria 2095
116 Ga0209051_1000770 3300025303 Bacteria 33998
117 Ga0207699_10149990 3300025906 Bacteria 1542
118 Ga0207699_10560349 3300025906 Bacteria 829
119 Ga0207705_10181726 3300025909 Bacteria 1588
120 Ga0207705_10601875 3300025909 Bacteria 855
121 Ga0207705_10808593 3300025909 Bacteria 727
122 Ga0207684_10142603 3300025910 Bacteria 2060
123 Ga0207654_10026132 3300025911 Bacteria 3158
124 Ga0207707_10027939 3300025912 Bacteria 4933
125 Ga0207695_10140687 3300025913 Bacteria 2362
126 Ga0207695_10219043 3300025913 Bacteria 1811
127 Ga0207671_10032164 3300025914 Bacteria 3905
128 Ga0207663_10255028 3300025916 Bacteria 1293
129 Ga0207657_10017817 3300025919 Bacteria 6800
130 Ga0207657_10185979 3300025919 Bacteria 1678
131 Ga0207657_10272513 3300025919 Bacteria 1345
132 Ga0207657_10598023 3300025919 Bacteria 861
133 Ga0207646_10051565 3300025922 Bacteria 3681
134 Ga0207694_10055336 3300025924 Bacteria 3080
135 Ga0207694_10712643 3300025924 Bacteria 846
136 Ga0207650_10024260 3300025925 Bacteria 4310
137 Ga0207650_10573057 3300025925 Bacteria 948
138 Ga0207687_10934562 3300025927 Bacteria 743
139 Ga0207690_10084774 3300025932 Unclassified 2222
140 Ga0207690_10131065 3300025932 Bacteria 1835
141 Ga0207686_10436386 3300025934 Bacteria 1005
142 Ga0207686_11246334 3300025934 Bacteria 610
143 Ga0207686_11292485 3300025934 Bacteria 599
144 Ga0207686_11318943 3300025934 Bacteria 593
145 Ga0207669_10047773 3300025937 Bacteria 2538
146 Ga0207704_10638826 3300025938 Unclassified 875
147 Ga0207665_10004052 3300025939 Bacteria 9780
148 Ga0207689_10179515 3300025942 Bacteria 1746
149 Ga0207661_10481517 3300025944 Bacteria 1133
150 Ga0207679_11576786 3300025945 Bacteria 602
151 Ga0207667_10007080 3300025949 Bacteria 13546
152 Ga0207667_10042485 3300025949 Bacteria 4831
153 Ga0207667_10170087 3300025949 Bacteria 2240
154 Ga0207667_11439959 3300025949 Bacteria 661
155 Ga0207651_10004487 3300025960 Bacteria 7041
156 Ga0207640_10012768 3300025981 Bacteria 4795
157 Ga0207640_10143625 3300025981 Bacteria 1743
158 Ga0207703_10457478 3300026035 Bacteria 1193
159 Ga0207639_10036115 3300026041 Bacteria 3660
160 Ga0207639_10171704 3300026041 Bacteria 1837
161 Ga0207678_10057539 3300026067 Bacteria 3346
162 Ga0207702_10000225 3300026078 Bacteria 65968
163 Ga0207641_10138704 3300026088 Bacteria 2191
164 Ga0207641_11394612 3300026088 Bacteria 702
165 Ga0207676_10366824 3300026095 Bacteria 1336
166 Ga0207676_12388257 3300026095 Bacteria 526
167 Ga0207674_10133252 3300026116 Bacteria 2448
168 Ga0207674_10182940 3300026116 Bacteria 2047
169 Ga0207683_11528677 3300026121 Bacteria 616
170 Ga0207698_10923945 3300026142 Bacteria 881
171 Ga0209282_1000001 3300027666 Bacteria 2450367
172 Ga0268266_11065071 3300028379 Bacteria 782
173 Ga0268266_11865756 3300028379 Bacteria 575
174 Ga0268265_10553042 3300028380 Bacteria 1093
175 Ga0265336_10000016 3300028666 Bacteria 238832
176 Ga0265324_10021228 3300029957 Bacteria 2329
177 Ga0265331_10380390 3300031250 Bacteria 633
178 Ga0265327_10001501 3300031251 Bacteria 28923
179 Ga0307509_10333411 3300031507 Bacteria 1248
180 Ga0307516_10009750 3300031730 Bacteria 10654
181 Ga0307516_10716734 3300031730 Bacteria 658
182 Ga0307416_101775643 3300032002 Bacteria 721
183 Ga0373928_0183550 3300035084 Bacteria 596
184 Ga0373934_0019432 3300035086 Bacteria 2607
185 Ga0373932_0249930 3300035112 Unclassified 647
186 Ga0373962_0383685 3300035242 Bacteria 514
187 Ga0373927_0303299 3300035695 Bacteria 1051
188 Ga0373933_0490512 3300035724 Bacteria 805
189 Ga0373937_0017678 3300036401 Bacteria 6362
190 Ga0395899_0021301 3300037312 Bacteria 4917
191 Ga0395899_0107933 3300037312 Bacteria 2003
192 Ga0395900_0063289 3300037418 Bacteria 3802
193 Ga0395900_0287337 3300037418 Bacteria 1634
194 Ga0395898_0473009 3300037466 Bacteria 1192
195 Ga0395905_0268768 3300037471 Bacteria 1591
196 Ga0395905_0355664 3300037471 Bacteria 1357
197 Ga0395905_0617475 3300037471 Bacteria 986
198 Ga0395901_0038816 3300038443 Bacteria 4925
199 Ga0395901_0245902 3300038443 Bacteria 1864
200 Ga0439436_0009986 3300041404 Bacteria 2903
201 Ga0439465_0000493 3300041413 Bacteria 11758
202 Ga0451797_1177379 3300041453 Bacteria 574
203 Ga0451839_1385730 3300041496 Bacteria 708
204 Ga0439441_016755 3300042001 Bacteria 1309
205 Ga0439445_0003749 3300042004 Bacteria 3412
206 Ga0439449_0000143 3300042007 Bacteria 24455
207 Ga0466969_0006300 3300044656 Bacteria 6312
208 Ga0466961_0037576 3300044693 Bacteria 3106
209 Ga0466963_0078464 3300044694 Bacteria 2232
210 Ga0466964_0377816 3300044706 Bacteria 735
211 Ga0466970_0095261 3300044765 Bacteria 1618
212 Ga0466970_0101034 3300044765 Bacteria 1570
213 Ga0466957_0173056 3300044842 Bacteria 1407
214 Ga0466959_0025797 3300045049 Bacteria 4358
215 Ga0495651_0572880 3300046462 Bacteria 715
216 Ga0495650_0021279 3300046471 Bacteria 3140
217 Ga0495639_0004933 3300046475 Bacteria 5722
218 Ga0495583_0000245 3300046506 Bacteria 89398
219 Ga0495648_0045731 3300046524 Bacteria 2720
220 Ga0495652_0165198 3300046529 Bacteria 1714
221 Ga0495668_0140548 3300046616 Bacteria 1321
222 Ga0495625_0003582 3300046660 Bacteria 15309
223 Ga0495649_0000400 3300046694 Bacteria 37554
224 Ga0495589_0105957 3300046794 Bacteria 1358
225 Ga0495626_0003688 3300048091 Bacteria 9703
226 Ga0496101_0304001 3300048904 Bacteria 1250
227 Ga0496104_1177963 3300048907 Bacteria 670
228 Ga0496107_0171394 3300048910 Bacteria 1611
229 Ga0501034_0003452 3300049571 Bacteria 18019
230 Ga0501034_0042042 3300049571 Bacteria 4625
231 Ga0501034_0933300 3300049571 Bacteria 754
232 Ga0501034_1710024 3300049571 Bacteria 501
233 Ga0501043_0384892 3300049579 Bacteria 1061
234 Ga0501068_0025378 3300049584 Bacteria 3486
235 Ga0501070_0080081 3300049586 Bacteria 2703
236 Ga0501071_0480983 3300049587 Unclassified 952
237 Ga0501072_0197751 3300049588 Bacteria 1603
238 Ga0501073_1133019 3300049589 Bacteria 537
239 Ga0501044_0070231 3300049823 Bacteria 3563
240 Ga0501044_0186660 3300049823 Bacteria 2038
241 nmdc:mga0k408_295602_c1 3300050493 Bacteria 966
242 nmdc:mga0k408_82923_c1 3300050493 Bacteria 1879
243 nmdc:mga07m45_281614_c1 3300050496 Bacteria 967
244 nmdc:mga07m45_93888_c1 3300050496 Bacteria 1720
245 Ga0500635_0000160 3300053080 Bacteria 36139
246 Ga0500635_0003547 3300053080 Bacteria 3941
247 Ga0500578_0316535 3300053086 Bacteria 921
248 Ga0500583_0256917 3300053092 Bacteria 862
249 Ga0500641_0181984 3300053096 Bacteria 902
250 Ga0500636_0053413 3300053177 Bacteria 2371
251 Ga0500645_000337 3300053730 Bacteria 33437
252 Ga0500661_007922 3300055283 Bacteria 1958
253 Ga0500661_043584 3300055283 Bacteria 796
254 Ga0466962_0367597 3300061719 Bacteria 717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10324480 Ga0105240_103244802 118
2 3300005340 Ga0070689_100758985 Ga0070689_1007589852 124
3 3300005353 Ga0070669_100638754 Ga0070669_1006387542 124
4 3300025906 Ga0207699_10560349 Ga0207699_105603492 124
5 3300005331 Ga0070670_101448685 Ga0070670_1014486851 125
6 3300005344 Ga0070661_100685532 Ga0070661_1006855322 125
7 3300005367 Ga0070667_101612840 Ga0070667_1016128401 125
8 3300005434 Ga0070709_10250393 Ga0070709_102503932 125
9 3300005548 Ga0070665_100694277 Ga0070665_1006942772 125
10 3300005563 Ga0068855_100113381 Ga0068855_1001133811 125
11 3300005617 Ga0068859_101025292 Ga0068859_1010252922 125
12 3300005842 Ga0068858_100858741 Ga0068858_1008587412 125
13 3300005937 Ga0081455_10056681 Ga0081455_100566813 125
14 3300006931 Ga0097620_101025266 Ga0097620_1010252662 125
15 3300009094 Ga0111539_11108100 Ga0111539_111081001 125
16 3300009176 Ga0105242_10300376 Ga0105242_103003762 125
17 3300013306 Ga0163162_10982017 Ga0163162_109820172 125
18 3300014745 Ga0157377_11394711 Ga0157377_113947111 125
19 3300014968 Ga0157379_11543200 Ga0157379_115432001 125
20 3300025302 Ga0207426_1023642 Ga0207426_10236422 125
21 3300025925 Ga0207650_10573057 Ga0207650_105730572 125
22 3300025934 Ga0207686_11246334 Ga0207686_112463341 125
23 3300026035 Ga0207703_10457478 Ga0207703_104574781 125
24 3300026088 Ga0207641_11394612 Ga0207641_113946121 125
25 3300028379 Ga0268266_11065071 Ga0268266_110650712 125
26 3300028379 Ga0268266_11865756 Ga0268266_118657561 125
27 3300037312 Ga0395899_0021301 Ga0395899_0021301_833_1225 125
28 3300037312 Ga0395899_0107933 Ga0395899_0107933_309_701 125
29 3300037418 Ga0395900_0063289 Ga0395900_0063289_2543_2935 125
30 3300037418 Ga0395900_0287337 Ga0395900_0287337_933_1325 125
31 3300037466 Ga0395898_0473009 Ga0395898_0473009_691_1083 125
32 3300037471 Ga0395905_0268768 Ga0395905_0268768_771_1163 125
33 3300038443 Ga0395901_0245902 Ga0395901_0245902_703_1095 125
34 3300044694 Ga0466963_0078464 Ga0466963_0078464_255_662 125
35 3300049571 Ga0501034_0003452 Ga0501034_0003452_9783_10175 125
36 3300049571 Ga0501034_0042042 Ga0501034_0042042_3572_3979 125
37 3300049571 Ga0501034_0933300 Ga0501034_0933300_277_675 125
38 3300049571 Ga0501034_1710024 Ga0501034_1710024_41_448 125
39 3300049579 Ga0501043_0384892 Ga0501043_0384892_288_686 125
40 3300049584 Ga0501068_0025378 Ga0501068_0025378_2243_2650 125
41 3300049586 Ga0501070_0080081 Ga0501070_0080081_2020_2427 125
42 3300049587 Ga0501071_0480983 Ga0501071_0480983_161_559 125
43 3300049588 Ga0501072_0197751 Ga0501072_0197751_955_1347 125
44 3300049589 Ga0501073_1133019 Ga0501073_1133019_45_443 125
45 3300049823 Ga0501044_0070231 Ga0501044_0070231_1256_1663 125
46 3300049823 Ga0501044_0186660 Ga0501044_0186660_1148_1546 125
47 3300009094 Ga0111539_11224584 Ga0111539_112245841 130
48 3300005440 Ga0070705_100009083 Ga0070705_1000090834 133
49 3300005467 Ga0070706_100119968 Ga0070706_1001199683 133
50 3300005518 Ga0070699_100255554 Ga0070699_1002555542 133
51 3300005530 Ga0070679_100069708 Ga0070679_1000697087 133
52 3300005546 Ga0070696_100115465 Ga0070696_1001154652 133
53 3300005547 Ga0070693_100030140 Ga0070693_1000301403 133
54 3300005578 Ga0068854_100571592 Ga0068854_1005715922 133
55 3300006173 Ga0070716_100036919 Ga0070716_1000369192 133
56 3300006881 Ga0068865_100372664 Ga0068865_1003726643 133
57 3300009093 Ga0105240_10549022 Ga0105240_105490222 133
58 3300009098 Ga0105245_12539471 Ga0105245_125394712 133
59 3300009148 Ga0105243_12467268 Ga0105243_124672681 133
60 3300009177 Ga0105248_10372306 Ga0105248_103723062 133
61 3300025906 Ga0207699_10149990 Ga0207699_101499902 133
62 3300025909 Ga0207705_10808593 Ga0207705_108085932 133
63 3300025912 Ga0207707_10027939 Ga0207707_100279393 133
64 3300025916 Ga0207663_10255028 Ga0207663_102550282 133
65 3300025922 Ga0207646_10051565 Ga0207646_100515654 133
66 3300025938 Ga0207704_10638826 Ga0207704_106388263 133
67 3300025939 Ga0207665_10004052 Ga0207665_100040529 133
68 3300025981 Ga0207640_10143625 Ga0207640_101436253 133
69 3300026067 Ga0207678_10057539 Ga0207678_100575393 133
70 3300048910 Ga0496107_0171394 Ga0496107_0171394_1039_1461 133
71 iso_pu_bacteria 2643221650 2644284996 133
72 3300005344 Ga0070661_101026939 Ga0070661_1010269391 134
73 3300005578 Ga0068854_100687542 Ga0068854_1006875422 134
74 3300025937 Ga0207669_10047773 Ga0207669_100477731 134
75 3300026121 Ga0207683_11528677 Ga0207683_115286772 134
76 3300042001 Ga0439441_016755 Ga0439441_016755_559_963 134
77 3300002705 JGI25156J39149_1008277 JGI25156J39149_10082774 135
78 3300002705 JGI25156J39149_1026337 JGI25156J39149_10263371 135
79 3300002738 JGI25154J39366_1001935 JGI25154J39366_10019354 135
80 3300002741 JGI25157J39369_1000020 JGI25157J39369_1000020129 135
81 3300003316 rootH1_10001648 rootH1_1000164810 135
82 3300003316 rootH1_10052607 rootH1_100526071 135
83 3300003752 Ga0055539_1000155 Ga0055539_100015544 135
84 3300003752 Ga0055539_1000799 Ga0055539_10007997 135
85 3300003756 Ga0055533_1000028 Ga0055533_1000028129 135
86 3300003759 Ga0055525_1001410 Ga0055525_10014103 135
87 3300003761 Ga0055535_1000575 Ga0055535_100057516 135
88 3300003763 Ga0055529_1000619 Ga0055529_100061912 135
89 3300003792 Ga0055540_1006831 Ga0055540_10068314 135
90 3300005327 Ga0070658_10116658 Ga0070658_101166581 135
91 3300005327 Ga0070658_10721514 Ga0070658_107215141 135
92 3300005330 Ga0070690_100010988 Ga0070690_1000109882 135
93 3300005331 Ga0070670_100035261 Ga0070670_1000352612 135
94 3300005334 Ga0068869_100029346 Ga0068869_1000293465 135
95 3300005339 Ga0070660_100049466 Ga0070660_1000494662 135
96 3300005339 Ga0070660_100066561 Ga0070660_1000665614 135
97 3300005339 Ga0070660_100597276 Ga0070660_1005972761 135
98 3300005364 Ga0070673_100011577 Ga0070673_1000115775 135
99 3300005366 Ga0070659_100138104 Ga0070659_1001381042 135
100 3300005366 Ga0070659_100170522 Ga0070659_1001705222 135
101 3300005456 Ga0070678_101502843 Ga0070678_1015028432 135
102 3300005471 Ga0070698_100521524 Ga0070698_1005215241 135
103 3300005518 Ga0070699_100288918 Ga0070699_1002889182 135
104 3300005535 Ga0070684_100133551 Ga0070684_1001335511 135
105 3300005539 Ga0068853_101351219 Ga0068853_1013512191 135
106 3300005544 Ga0070686_100333398 Ga0070686_1003333982 135
107 3300005563 Ga0068855_100000405 Ga0068855_10000040544 135
108 3300005563 Ga0068855_100034980 Ga0068855_1000349806 135
109 3300005563 Ga0068855_100064160 Ga0068855_1000641602 135
110 3300005563 Ga0068855_100495913 Ga0068855_1004959132 135
111 3300005577 Ga0068857_100085793 Ga0068857_1000857935 135
112 3300005577 Ga0068857_100156241 Ga0068857_1001562412 135
113 3300005578 Ga0068854_100010301 Ga0068854_1000103016 135
114 3300005614 Ga0068856_100000790 Ga0068856_1000007906 135
115 3300005616 Ga0068852_101581869 Ga0068852_1015818691 135
116 3300005718 Ga0068866_10637124 Ga0068866_106371242 135
117 3300005841 Ga0068863_100220007 Ga0068863_1002200072 135
118 3300005844 Ga0068862_100801136 Ga0068862_1008011362 135
119 3300006195 Ga0075366_10097626 Ga0075366_100976262 135
120 3300006353 Ga0075370_10175841 Ga0075370_101758412 135
121 3300006948 Ga0099826_10000002 Ga0099826_100000021036 135
122 3300009093 Ga0105240_10020464 Ga0105240_100204646 135
123 3300009093 Ga0105240_10978589 Ga0105240_109785892 135
124 3300009093 Ga0105240_12643712 Ga0105240_126437121 135
125 3300009098 Ga0105245_10314785 Ga0105245_103147853 135
126 3300009098 Ga0105245_10882202 Ga0105245_108822022 135
127 3300009174 Ga0105241_10084118 Ga0105241_100841182 135
128 3300009174 Ga0105241_10179366 Ga0105241_101793662 135
129 3300009176 Ga0105242_11867120 Ga0105242_118671202 135
130 3300009545 Ga0105237_10181081 Ga0105237_101810813 135
131 3300009545 Ga0105237_10406232 Ga0105237_104062321 135
132 3300009545 Ga0105237_10481311 Ga0105237_104813111 135
133 3300009551 Ga0105238_10060386 Ga0105238_100603861 135
134 3300009551 Ga0105238_10073985 Ga0105238_100739852 135
135 3300009551 Ga0105238_11540756 Ga0105238_115407561 135
136 3300010375 Ga0105239_10043505 Ga0105239_100435056 135
137 3300011119 Ga0105246_10091790 Ga0105246_100917903 135
138 3300013105 Ga0157369_10080478 Ga0157369_100804783 135
139 3300013296 Ga0157374_10740116 Ga0157374_107401162 135
140 3300013307 Ga0157372_10306545 Ga0157372_103065453 135
141 3300013307 Ga0157372_12490873 Ga0157372_124908731 135
142 3300014325 Ga0163163_10341652 Ga0163163_103416522 135
143 3300014968 Ga0157379_11053404 Ga0157379_110534042 135
144 3300025226 Ga0209674_100007 Ga0209674_100007914 135
145 3300025230 Ga0209563_100033 Ga0209563_100033127 135
146 3300025231 Ga0207427_100501 Ga0207427_10050111 135
147 3300025242 Ga0209258_100575 Ga0209258_10057516 135
148 3300025242 Ga0209258_100655 Ga0209258_10065511 135
149 3300025246 Ga0209646_1000062 Ga0209646_100006263 135
150 3300025250 Ga0209026_1000026 Ga0209026_1000026150 135
151 3300025253 Ga0209677_100082 Ga0209677_10008262 135
152 3300025253 Ga0209677_100116 Ga0209677_10011640 135
153 3300025256 Ga0209759_1000050 Ga0209759_100005032 135
154 3300025256 Ga0209759_1000916 Ga0209759_10009165 135
155 3300025256 Ga0209759_1001283 Ga0209759_10012836 135
156 3300025272 Ga0209455_1000093 Ga0209455_1000093172 135
157 3300025303 Ga0209051_1000770 Ga0209051_100077022 135
158 3300025909 Ga0207705_10181726 Ga0207705_101817263 135
159 3300025909 Ga0207705_10601875 Ga0207705_106018752 135
160 3300025910 Ga0207684_10142603 Ga0207684_101426032 135
161 3300025911 Ga0207654_10026132 Ga0207654_100261322 135
162 3300025913 Ga0207695_10140687 Ga0207695_101406872 135
163 3300025913 Ga0207695_10219043 Ga0207695_102190433 135
164 3300025914 Ga0207671_10032164 Ga0207671_100321641 135
165 3300025919 Ga0207657_10017817 Ga0207657_100178176 135
166 3300025919 Ga0207657_10185979 Ga0207657_101859793 135
167 3300025919 Ga0207657_10272513 Ga0207657_102725132 135
168 3300025919 Ga0207657_10598023 Ga0207657_105980232 135
169 3300025924 Ga0207694_10055336 Ga0207694_100553362 135
170 3300025924 Ga0207694_10712643 Ga0207694_107126431 135
171 3300025925 Ga0207650_10024260 Ga0207650_100242607 135
172 3300025927 Ga0207687_10934562 Ga0207687_109345622 135
173 3300025932 Ga0207690_10084774 Ga0207690_100847744 135
174 3300025932 Ga0207690_10131065 Ga0207690_101310652 135
175 3300025934 Ga0207686_10436386 Ga0207686_104363862 135
176 3300025934 Ga0207686_11292485 Ga0207686_112924852 135
177 3300025934 Ga0207686_11318943 Ga0207686_113189431 135
178 3300025942 Ga0207689_10179515 Ga0207689_101795153 135
179 3300025944 Ga0207661_10481517 Ga0207661_104815171 135
180 3300025945 Ga0207679_11576786 Ga0207679_115767862 135
181 3300025949 Ga0207667_10007080 Ga0207667_100070803 135
182 3300025949 Ga0207667_10042485 Ga0207667_100424856 135
183 3300025949 Ga0207667_10170087 Ga0207667_101700872 135
184 3300025949 Ga0207667_11439959 Ga0207667_114399591 135
185 3300025960 Ga0207651_10004487 Ga0207651_100044872 135
186 3300025981 Ga0207640_10012768 Ga0207640_100127682 135
187 3300026041 Ga0207639_10036115 Ga0207639_100361153 135
188 3300026041 Ga0207639_10171704 Ga0207639_101717043 135
189 3300026078 Ga0207702_10000225 Ga0207702_1000022529 135
190 3300026088 Ga0207641_10138704 Ga0207641_101387044 135
191 3300026095 Ga0207676_10366824 Ga0207676_103668242 135
192 3300026095 Ga0207676_12388257 Ga0207676_123882571 135
193 3300026116 Ga0207674_10133252 Ga0207674_101332522 135
194 3300026116 Ga0207674_10182940 Ga0207674_101829402 135
195 3300026142 Ga0207698_10923945 Ga0207698_109239451 135
196 3300027666 Ga0209282_1000001 Ga0209282_1000001125 135
197 3300028380 Ga0268265_10553042 Ga0268265_105530422 135
198 3300028666 Ga0265336_10000016 Ga0265336_10000016133 135
199 3300029957 Ga0265324_10021228 Ga0265324_100212283 135
200 3300031250 Ga0265331_10380390 Ga0265331_103803902 135
201 3300031251 Ga0265327_10001501 Ga0265327_1000150130 135
202 3300031507 Ga0307509_10333411 Ga0307509_103334112 135
203 3300031730 Ga0307516_10009750 Ga0307516_100097507 135
204 3300031730 Ga0307516_10716734 Ga0307516_107167341 135
205 3300032002 Ga0307416_101775643 Ga0307416_1017756432 135
206 3300035084 Ga0373928_0183550 Ga0373928_0183550_68_478 135
207 3300035086 Ga0373934_0019432 Ga0373934_0019432_1541_1948 135
208 3300035112 Ga0373932_0249930 Ga0373932_0249930_201_611 135
209 3300035242 Ga0373962_0383685 Ga0373962_0383685_47_457 135
210 3300035695 Ga0373927_0303299 Ga0373927_0303299_103_510 135
211 3300035724 Ga0373933_0490512 Ga0373933_0490512_62_475 135
212 3300036401 Ga0373937_0017678 Ga0373937_0017678_1768_2181 135
213 3300037471 Ga0395905_0355664 Ga0395905_0355664_271_747 135
214 3300037471 Ga0395905_0617475 Ga0395905_0617475_46_453 135
215 3300038443 Ga0395901_0038816 Ga0395901_0038816_3331_3738 135
216 3300041404 Ga0439436_0009986 Ga0439436_0009986_631_1086 135
217 3300041413 Ga0439465_0000493 Ga0439465_0000493_4891_5334 135
218 3300041453 Ga0451797_1177379 Ga0451797_1177379_129_536 135
219 3300041496 Ga0451839_1385730 Ga0451839_1385730_173_586 135
220 3300042004 Ga0439445_0003749 Ga0439445_0003749_849_1292 135
221 3300042007 Ga0439449_0000143 Ga0439449_0000143_16791_17234 135
222 3300044656 Ga0466969_0006300 Ga0466969_0006300_1628_2041 135
223 3300044693 Ga0466961_0037576 Ga0466961_0037576_2457_2870 135
224 3300044706 Ga0466964_0377816 Ga0466964_0377816_150_572 135
225 3300044765 Ga0466970_0095261 Ga0466970_0095261_1162_1575 135
226 3300044765 Ga0466970_0101034 Ga0466970_0101034_611_1030 135
227 3300044842 Ga0466957_0173056 Ga0466957_0173056_837_1265 135
228 3300045049 Ga0466959_0025797 Ga0466959_0025797_3135_3548 135
229 3300046462 Ga0495651_0572880 Ga0495651_0572880_295_702 135
230 3300046471 Ga0495650_0021279 Ga0495650_0021279_1074_1481 135
231 3300046475 Ga0495639_0004933 Ga0495639_0004933_3410_3817 135
232 3300046506 Ga0495583_0000245 Ga0495583_0000245_78116_78523 135
233 3300046524 Ga0495648_0045731 Ga0495648_0045731_73_513 135
234 3300046529 Ga0495652_0165198 Ga0495652_0165198_1213_1620 135
235 3300046616 Ga0495668_0140548 Ga0495668_0140548_356_763 135
236 3300046660 Ga0495625_0003582 Ga0495625_0003582_10114_10521 135
237 3300046694 Ga0495649_0000400 Ga0495649_0000400_10924_11331 135
238 3300046794 Ga0495589_0105957 Ga0495589_0105957_510_917 135
239 3300048091 Ga0495626_0003688 Ga0495626_0003688_8454_8894 135
240 3300048904 Ga0496101_0304001 Ga0496101_0304001_376_783 135
241 3300048907 Ga0496104_1177963 Ga0496104_1177963_253_660 135
242 3300050493 nmdc:mga0k408_295602_c1 nmdc:mga0k408_295602_c1_508_918 135
243 3300050493 nmdc:mga0k408_82923_c1 nmdc:mga0k408_82923_c1_1252_1659 135
244 3300050496 nmdc:mga07m45_281614_c1 nmdc:mga07m45_281614_c1_399_806 135
245 3300050496 nmdc:mga07m45_93888_c1 nmdc:mga07m45_93888_c1_223_630 135
246 3300053080 Ga0500635_0000160 Ga0500635_0000160_29760_30167 135
247 3300053080 Ga0500635_0003547 Ga0500635_0003547_2342_2749 135
248 3300053086 Ga0500578_0316535 Ga0500578_0316535_161_568 135
249 3300053092 Ga0500583_0256917 Ga0500583_0256917_371_793 135
250 3300053096 Ga0500641_0181984 Ga0500641_0181984_385_810 135
251 3300053177 Ga0500636_0053413 Ga0500636_0053413_1643_2050 135
252 3300053730 Ga0500645_000337 Ga0500645_000337_22616_23038 135
253 3300055283 Ga0500661_007922 Ga0500661_007922_518_925 135
254 3300055283 Ga0500661_043584 Ga0500661_043584_89_496 135
255 3300061719 Ga0466962_0367597 Ga0466962_0367597_147_560 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

7

125

0.91

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

9

115

0.89

PF18029

Glyoxalase_6

Glyoxalase-like domain

10

126

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.8595 3 131
3zw5-assembly1.cif.gz_B crystal structure of the human glyoxalase domain-containing protein 5 0.8589 4 131
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.8463 3 131
3zw5-assembly1.cif.gz_B crystal structure of the human glyoxalase domain-containing protein 5 0.8461 4 131
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8352 1 129
ID Description Score Start End Superfamily
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8622 8 131 3.10.180.10
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8489 8 131 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8069 4 131 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7943 4 131 3.10.180.10
af_Q9VRD4_137_278_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7919 5 131 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A318JBT1-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 0.9719 1 135 GO:0051213
AF-A0A7U5XVR3-F1-model_v4 VOC family protein 0.9717 1 134
AF-A0A0T2YNG5-F1-model_v4 Lactoylglutathione lyase 0.9657 20 134 GO:0016829
AF-A0A6A5LIS9-F1-model_v4 deleted 0.9653 2 135
AF-A0A562PEL1-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 0.9653 1 134 GO:0051213

Feature Viewer

pLDDT pTM Quality
92.31 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map