F365640

General Info

Members Datasets Scaffolds Average Seq Length
255 175 510 316

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10000452|Ga0111539_1000045212
Length 333
Sequence MASWAKKRVIVTGGSGFLGGHLVRQLRQEGAVVRAPSSQECDLLRFDHAARLFEDGPDVVFHLAARVGGIDANRRAPGTFFRDNLLMGIHVLEACRQKKVGRLVQVGTVCSYPKHTPVPFREEALFDGYPEETNAPYGIAKRALLVGGRAYEKEFGLSVVNVLLLNLYGEEDHFDLETSHVIPALIRKCLEAKEEGRPVVDVWGDGSATRGFLYVRDAVRGIAAAGLRMNSSEPVNLGAPGEISIRDLAQCIGELCDYTGTFRFDPSKPAGQPRRSLDCEKAEQLFGFRAQTTLRDGLQRTIEWAKARHEQEKLFPQVAGRSLATVEKNRSDA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
77 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
80 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
150 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
151 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
166 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
169 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
170 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
171 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
172 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.53
Nodule 0
Rhizoplane 2.35
Rhizosphere 92.94
Stem 0
Stem Tuber 0
Unclassified 3.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10000452 3300009094 Bacteria 51485
2 Ga0070676_10006077 3300005328 Bacteria 6445
3 Ga0070690_100009756 3300005330 Bacteria 5569
4 Ga0068869_100385782 3300005334 Bacteria 1149
5 Ga0070682_100188957 3300005337 Bacteria 1445
6 Ga0070689_100112855 3300005340 Bacteria 2164
7 Ga0070691_10001200 3300005341 Bacteria 10868
8 Ga0070687_100170254 3300005343 Bacteria 1296
9 Ga0070668_100072075 3300005347 Bacteria 2691
10 Ga0070675_100000260 3300005354 Bacteria 34640
11 Ga0070674_100020220 3300005356 Bacteria 4247
12 Ga0070674_100173324 3300005356 Bacteria 1647
13 Ga0070673_100027852 3300005364 Bacteria 4194
14 Ga0070688_100001291 3300005365 Bacteria 12481
15 Ga0070688_100052545 3300005365 Bacteria 2545
16 Ga0070667_100263117 3300005367 Bacteria 1545
17 Ga0070701_10016365 3300005438 Bacteria 3446
18 Ga0070705_100033420 3300005440 Bacteria 2867
19 Ga0070706_100016493 3300005467 Bacteria 6826
20 Ga0070707_100079220 3300005468 Bacteria 3170
21 Ga0070698_100001352 3300005471 Bacteria 27269
22 Ga0070699_100149840 3300005518 Bacteria 2062
23 Ga0070679_100088578 3300005530 Bacteria 3082
24 Ga0070684_100009426 3300005535 Bacteria 7688
25 Ga0070697_100183626 3300005536 Bacteria 1773
26 Ga0068853_100227827 3300005539 Bacteria 1704
27 Ga0068853_100250846 3300005539 Bacteria 1624
28 Ga0070672_100262524 3300005543 Bacteria 1457
29 Ga0070686_100436301 3300005544 Bacteria 1004
30 Ga0070696_100033425 3300005546 Bacteria 3533
31 Ga0070665_100108073 3300005548 Archaea 2784
32 Ga0068857_100111278 3300005577 Bacteria 2462
33 Ga0068856_100017134 3300005614 Bacteria 7023
34 Ga0068864_100080088 3300005618 Unclassified 2861
35 Ga0068861_100010609 3300005719 Bacteria 6397
36 Ga0068858_100096004 3300005842 Unclassified 2762
37 Ga0068862_100240931 3300005844 Bacteria 1644
38 Ga0081538_10036712 3300005981 Bacteria 3192
39 Ga0081539_10017267 3300005985 Bacteria 5078
40 Ga0097621_100110831 3300006237 Bacteria 2319
41 Ga0068871_100070959 3300006358 Bacteria 2864
42 Ga0075433_10012805 3300006852 Bacteria 6795
43 Ga0075433_10030590 3300006852 Bacteria 4595
44 Ga0075433_10149502 3300006852 Bacteria 2077
45 Ga0075434_100017930 3300006871 Bacteria 6830
46 Ga0075434_100029768 3300006871 Bacteria 5374
47 Ga0075434_100036921 3300006871 Bacteria 4834
48 Ga0075434_100366087 3300006871 Bacteria 1462
49 Ga0075436_100018274 3300006914 Bacteria 4802
50 Ga0075436_100024896 3300006914 Bacteria 4115
51 Ga0075436_100044756 3300006914 Bacteria 3053
52 Ga0075436_100093154 3300006914 Bacteria 2095
53 Ga0075435_100004839 3300007076 Bacteria 9320
54 Ga0075435_100041570 3300007076 Bacteria 3675
55 Ga0075435_100055203 3300007076 Bacteria 3207
56 Ga0075435_100058647 3300007076 Bacteria 3118
57 Ga0075435_100129790 3300007076 Bacteria 2109
58 Ga0105240_10051971 3300009093 Bacteria 5153
59 Ga0111539_10544982 3300009094 Bacteria 1351
60 Ga0111539_10650756 3300009094 Bacteria 1227
61 Ga0114129_10003991 3300009147 Bacteria 20841
62 Ga0114129_10043578 3300009147 Bacteria 6313
63 Ga0114129_10061166 3300009147 Bacteria 5263
64 Ga0105242_10026309 3300009176 Bacteria 4611
65 Ga0105248_10040352 3300009177 Bacteria 5232
66 Ga0105237_10474215 3300009545 Bacteria 1257
67 Ga0105249_10143220 3300009553 Bacteria 2294
68 Ga0157374_10028936 3300013296 Bacteria 5009
69 Ga0157378_10211582 3300013297 Bacteria 1839
70 Ga0157372_10473065 3300013307 Bacteria 1461
71 Ga0163163_10129365 3300014325 Bacteria 2565
72 Ga0163163_10293424 3300014325 Bacteria 1678
73 Ga0157380_10219876 3300014326 Bacteria 1699
74 Ga0207666_1006439 3300025271 Bacteria 1524
75 Ga0207642_10027966 3300025899 Bacteria 2315
76 Ga0207645_10005863 3300025907 Bacteria 8850
77 Ga0207707_10015422 3300025912 Bacteria 6655
78 Ga0207652_10059176 3300025921 Bacteria 3302
79 Ga0207646_10170817 3300025922 Bacteria 1963
80 Ga0207650_10008362 3300025925 Bacteria 7063
81 Ga0207659_10000050 3300025926 Bacteria 82225
82 Ga0207644_10076266 3300025931 Unclassified 2466
83 Ga0207686_10057201 3300025934 Bacteria 2454
84 Ga0207669_10080203 3300025937 Bacteria 2086
85 Ga0207691_10003458 3300025940 Bacteria 15365
86 Ga0207691_10044772 3300025940 Bacteria 4072
87 Ga0207661_10039270 3300025944 Bacteria 3714
88 Ga0207651_10000299 3300025960 Bacteria 21268
89 Ga0207677_10065087 3300026023 Bacteria 2542
90 Ga0207677_10078955 3300026023 Bacteria 2352
91 Ga0207708_10018794 3300026075 Bacteria 5205
92 Ga0207702_10052362 3300026078 Bacteria 3454
93 Ga0207648_10025670 3300026089 Bacteria 5245
94 Ga0207648_10104801 3300026089 Bacteria 2481
95 Ga0207676_10064941 3300026095 Unclassified 2905
96 Ga0207675_100043613 3300026118 Bacteria 4189
97 Ga0207683_10076222 3300026121 Bacteria 2969
98 Ga0207683_10202854 3300026121 Bacteria 1803
99 Ga0207428_10002889 3300027907 Bacteria 17025
100 Ga0265337_1030907 3300028556 Bacteria 1592
101 Ga0265326_10015559 3300028558 Bacteria 2205
102 Ga0265318_10065353 3300028577 Bacteria 1353
103 Ga0265323_10009224 3300028653 Bacteria 4042
104 Ga0265322_10014971 3300028654 Bacteria 2241
105 Ga0265338_10065966 3300028800 Bacteria 3136
106 Ga0265324_10000045 3300029957 Bacteria 107095
107 Ga0265324_10025976 3300029957 Bacteria 2074
108 Ga0307511_10164187 3300030521 Bacteria 1238
109 Ga0265330_10003657 3300031235 Bacteria 7994
110 Ga0265330_10011666 3300031235 Bacteria 4118
111 Ga0265330_10020066 3300031235 Bacteria 3055
112 Ga0265332_10015917 3300031238 Bacteria 3319
113 Ga0265320_10130453 3300031240 Bacteria 1142
114 Ga0265325_10002758 3300031241 Bacteria 11735
115 Ga0265325_10058956 3300031241 Bacteria 1953
116 Ga0265329_10000026 3300031242 Bacteria 61009
117 Ga0265340_10003597 3300031247 Bacteria 8719
118 Ga0265339_10000002 3300031249 Bacteria 416322
119 Ga0265339_10019499 3300031249 Bacteria 3981
120 Ga0265339_10023097 3300031249 Bacteria 3597
121 Ga0265339_10029756 3300031249 Bacteria 3096
122 Ga0265331_10001848 3300031250 Bacteria 14966
123 Ga0265316_10000041 3300031344 Bacteria 137206
124 Ga0265316_10008900 3300031344 Bacteria 9270
125 Ga0265316_10056874 3300031344 Bacteria 3052
126 Ga0307509_10010657 3300031507 Bacteria 11219
127 Ga0265313_10002905 3300031595 Bacteria 14326
128 Ga0265314_10000040 3300031711 Bacteria 218764
129 Ga0265314_10003754 3300031711 Bacteria 14539
130 Ga0265314_10120618 3300031711 Bacteria 1651
131 Ga0265342_10000053 3300031712 Bacteria 121955
132 Ga0265342_10004321 3300031712 Bacteria 11243
133 Ga0265342_10006489 3300031712 Bacteria 8706
134 Ga0265342_10013471 3300031712 Bacteria 5484
135 Ga0265342_10029540 3300031712 Bacteria 3403
136 Ga0307405_10098605 3300031731 Bacteria 1954
137 Ga0307412_10263156 3300031911 Bacteria 1346
138 Ga0307409_100089794 3300031995 Bacteria 2513
139 Ga0307409_100224439 3300031995 Bacteria 1698
140 Ga0307416_100034992 3300032002 Bacteria 3830
141 Ga0307415_100147289 3300032126 Bacteria 1807
142 Ga0373950_0000016 3300034818 Bacteria 277879
143 Ga0373950_0000024 3300034818 Bacteria 186458
144 Ga0373953_0092185 3300035117 Bacteria 1268
145 Ga0373954_0008332 3300035118 Bacteria 4547
146 Ga0373957_0016255 3300035120 Bacteria 2574
147 Ga0373955_0001747 3300035172 Bacteria 9328
148 Ga0373933_0000599 3300035724 Bacteria 22562
149 Ga0373933_0123623 3300035724 Bacteria 1622
150 Ga0373937_0001061 3300036401 Bacteria 23193
151 Ga0373937_0061728 3300036401 Bacteria 3445
152 Ga0395900_0423192 3300037418 Bacteria 1292
153 Ga0395901_0029401 3300038443 Bacteria 5658
154 Ga0400491_16071 3300038727 Bacteria 9667
155 Ga0436360_0056674 3300039438 Bacteria 1826
156 Ga0453684_0174791 3300044712 Bacteria 2527
157 Ga0451576_0092748 3300045051 Bacteria 3141
158 Ga0495603_0190051 3300046455 Bacteria 1187
159 Ga0495582_0072569 3300046473 Bacteria 1905
160 Ga0495594_0031026 3300046499 Bacteria 2896
161 Ga0495586_0085322 3300046535 Bacteria 1740
162 Ga0495622_0094808 3300046557 Bacteria 1370
163 Ga0495658_0152831 3300046683 Unclassified 1419
164 Ga0495600_0076063 3300046809 Bacteria 2192
165 Ga0496100_0225432 3300048903 Bacteria 1377
166 Ga0496105_0067962 3300048908 Bacteria 2943
167 Ga0496105_0345222 3300048908 Bacteria 1190
168 Ga0496114_0014625 3300048917 Bacteria 6305
169 Ga0496114_0108382 3300048917 Bacteria 2377
170 Ga0496115_0025803 3300048918 Bacteria 4580
171 Ga0501298_031379 3300049521 Bacteria 1044
172 Ga0501032_0056994 3300049569 Unclassified 2625
173 Ga0501032_0063764 3300049569 Bacteria 2467
174 Ga0501034_0000096 3300049571 Bacteria 161155
175 Ga0501034_0425898 3300049571 Bacteria 1248
176 Ga0501036_0009152 3300049572 Bacteria 8143
177 Ga0501036_0052626 3300049572 Bacteria 3448
178 Ga0501037_0014178 3300049573 Bacteria 5868
179 Ga0501038_0135376 3300049574 Bacteria 2019
180 Ga0501039_0068653 3300049575 Unclassified 2751
181 Ga0501039_0122318 3300049575 Bacteria 2040
182 Ga0501040_0028639 3300049576 Bacteria 3756
183 Ga0501041_0003330 3300049577 Bacteria 9245
184 Ga0501042_0003674 3300049578 Bacteria 9673
185 Ga0501043_0028544 3300049579 Bacteria 4380
186 Ga0501046_0000712 3300049580 Bacteria 32095
187 Ga0501046_0062467 3300049580 Viruses 2910
188 Ga0501047_0000008 3300049581 Bacteria 441758
189 Ga0501048_0001551 3300049582 Bacteria 17452
190 Ga0501048_0062589 3300049582 Bacteria 2633
191 Ga0501067_0000064 3300049583 Bacteria 60217
192 Ga0501068_0034811 3300049584 Bacteria 3005
193 Ga0501068_0086520 3300049584 Bacteria 1929
194 Ga0501069_0097311 3300049585 Bacteria 1668
195 Ga0501069_0165536 3300049585 Bacteria 1274
196 Ga0501070_0000064 3300049586 Bacteria 89114
197 Ga0501070_0037074 3300049586 Bacteria 4070
198 Ga0501070_0050252 3300049586 Bacteria 3461
199 Ga0501070_0062510 3300049586 Bacteria 3084
200 Ga0501072_0000824 3300049588 Bacteria 22815
201 Ga0501073_0001179 3300049589 Bacteria 19091
202 Ga0501073_0017025 3300049589 Bacteria 5267
203 Ga0501073_0022300 3300049589 Bacteria 4561
204 Ga0501073_0028047 3300049589 Bacteria 4022
205 Ga0501073_0088583 3300049589 Bacteria 2152
206 Ga0501074_0000513 3300049590 Bacteria 23785
207 Ga0501075_0001031 3300049591 Bacteria 17865
208 Ga0501076_0000009 3300049592 Bacteria 117970
209 Ga0501076_0545298 3300049592 Unclassified 956
210 Ga0501207_018565 3300049654 Bacteria 1095
211 Ga0501217_053788 3300049661 Bacteria 1059
212 Ga0501225_0022702 3300049705 Bacteria 1732
213 Ga0501079_0003761 3300049741 Bacteria 11207
214 Ga0501079_0056347 3300049741 Bacteria 3033
215 Ga0501079_0080945 3300049741 Bacteria 2511
216 Ga0501080_0054343 3300049742 Bacteria 3729
217 Ga0501081_0011352 3300049743 Bacteria 5830
218 Ga0501081_0042068 3300049743 Bacteria 3131
219 Ga0501081_0160908 3300049743 Bacteria 1618
220 Ga0501083_0082806 3300049744 Bacteria 2125
221 Ga0501035_0042161 3300049822 Bacteria 4117
222 Ga0501035_0202389 3300049822 Bacteria 1702
223 Ga0501045_0042105 3300049824 Bacteria 3324
224 nmdc:mga05p37_34825_c1 3300050507 Bacteria 6168
225 nmdc:mga05p37_56408_c1 3300050507 Bacteria 4837
226 nmdc:mga05p37_9762_c1 3300050507 Bacteria 11385
227 nmdc:mga09592_219456_c1 3300050508 Bacteria 1647
228 nmdc:mga08y16_530716_c1 3300050511 Bacteria 1193
229 nmdc:mga08y16_885_c1 3300050511 Bacteria 28887
230 nmdc:mga0n895_144529_c1 3300050512 Bacteria 2408
231 nmdc:mga0n895_364236_c1 3300050512 Bacteria 1464
232 nmdc:mga0rr50_10666_c1 3300050513 Bacteria 5846
233 nmdc:mga0rr50_125675_c1 3300050513 Bacteria 2048
234 nmdc:mga0rr50_198928_c1 3300050513 Bacteria 1646
235 nmdc:mga0rr50_374248_c1 3300050513 Bacteria 1200
236 nmdc:mga0rr50_48222_c1 3300050513 Bacteria 3148
237 nmdc:mga08x19_185240_c1 3300050514 Bacteria 1423
238 nmdc:mga08x19_20735_c1 3300050514 Bacteria 4050
239 nmdc:mga08x19_59057_c1 3300050514 Bacteria 2483
240 nmdc:mga08x19_73203_c1 3300050514 Bacteria 2236
241 nmdc:mga0a205_104281_c1 3300050515 Bacteria 2735
242 nmdc:mga0a205_34292_c1 3300050515 Bacteria 4871
243 Ga0500635_0000116 3300053080 Bacteria 47759
244 Ga0500597_004228 3300053120 Bacteria 4406
245 Ga0500568_0019218 3300053139 Bacteria 2974
246 Ga0500619_000400 3300053154 Bacteria 7898
247 Ga0500638_000008 3300053162 Bacteria 116543
248 Ga0500639_000094 3300053163 Bacteria 41731
249 Ga0500636_0000078 3300053177 Bacteria 47973
250 Ga0500636_0034718 3300053177 Bacteria 2985
251 Ga0500601_000065 3300053737 Bacteria 21897
252 Ga0501084_0000089 3300054114 Bacteria 66547
253 Ga0501082_0002402 3300060353 Bacteria 16423
254 Ga0501082_0052792 3300060353 Bacteria 3504
255 Ga0530510_0000023 3300061734 Bacteria 72578
256 Ga0111539_10000452
257 Ga0070676_10006077
258 Ga0070690_100009756
259 Ga0068869_100385782
260 Ga0070682_100188957
261 Ga0070689_100112855
262 Ga0070691_10001200
263 Ga0070687_100170254
264 Ga0070668_100072075
265 Ga0070675_100000260
266 Ga0070674_100020220
267 Ga0070674_100173324
268 Ga0070673_100027852
269 Ga0070688_100001291
270 Ga0070688_100052545
271 Ga0070667_100263117
272 Ga0070701_10016365
273 Ga0070705_100033420
274 Ga0070706_100016493
275 Ga0070707_100079220
276 Ga0070698_100001352
277 Ga0070699_100149840
278 Ga0070679_100088578
279 Ga0070684_100009426
280 Ga0070697_100183626
281 Ga0068853_100227827
282 Ga0068853_100250846
283 Ga0070672_100262524
284 Ga0070686_100436301
285 Ga0070696_100033425
286 Ga0070665_100108073
287 Ga0068857_100111278
288 Ga0068856_100017134
289 Ga0068864_100080088
290 Ga0068861_100010609
291 Ga0068858_100096004
292 Ga0068862_100240931
293 Ga0081538_10036712
294 Ga0081539_10017267
295 Ga0097621_100110831
296 Ga0068871_100070959
297 Ga0075433_10012805
298 Ga0075433_10030590
299 Ga0075433_10149502
300 Ga0075434_100017930
301 Ga0075434_100029768
302 Ga0075434_100036921
303 Ga0075434_100366087
304 Ga0075436_100018274
305 Ga0075436_100024896
306 Ga0075436_100044756
307 Ga0075436_100093154
308 Ga0075435_100004839
309 Ga0075435_100041570
310 Ga0075435_100055203
311 Ga0075435_100058647
312 Ga0075435_100129790
313 Ga0105240_10051971
314 Ga0111539_10544982
315 Ga0111539_10650756
316 Ga0114129_10003991
317 Ga0114129_10043578
318 Ga0114129_10061166
319 Ga0105242_10026309
320 Ga0105248_10040352
321 Ga0105237_10474215
322 Ga0105249_10143220
323 Ga0157374_10028936
324 Ga0157378_10211582
325 Ga0157372_10473065
326 Ga0163163_10129365
327 Ga0163163_10293424
328 Ga0157380_10219876
329 Ga0207666_1006439
330 Ga0207642_10027966
331 Ga0207645_10005863
332 Ga0207707_10015422
333 Ga0207652_10059176
334 Ga0207646_10170817
335 Ga0207650_10008362
336 Ga0207659_10000050
337 Ga0207644_10076266
338 Ga0207686_10057201
339 Ga0207669_10080203
340 Ga0207691_10003458
341 Ga0207691_10044772
342 Ga0207661_10039270
343 Ga0207651_10000299
344 Ga0207677_10065087
345 Ga0207677_10078955
346 Ga0207708_10018794
347 Ga0207702_10052362
348 Ga0207648_10025670
349 Ga0207648_10104801
350 Ga0207676_10064941
351 Ga0207675_100043613
352 Ga0207683_10076222
353 Ga0207683_10202854
354 Ga0207428_10002889
355 Ga0265337_1030907
356 Ga0265326_10015559
357 Ga0265318_10065353
358 Ga0265323_10009224
359 Ga0265322_10014971
360 Ga0265338_10065966
361 Ga0265324_10000045
362 Ga0265324_10025976
363 Ga0307511_10164187
364 Ga0265330_10003657
365 Ga0265330_10011666
366 Ga0265330_10020066
367 Ga0265332_10015917
368 Ga0265320_10130453
369 Ga0265325_10002758
370 Ga0265325_10058956
371 Ga0265329_10000026
372 Ga0265340_10003597
373 Ga0265339_10000002
374 Ga0265339_10019499
375 Ga0265339_10023097
376 Ga0265339_10029756
377 Ga0265331_10001848
378 Ga0265316_10000041
379 Ga0265316_10008900
380 Ga0265316_10056874
381 Ga0307509_10010657
382 Ga0265313_10002905
383 Ga0265314_10000040
384 Ga0265314_10003754
385 Ga0265314_10120618
386 Ga0265342_10000053
387 Ga0265342_10004321
388 Ga0265342_10006489
389 Ga0265342_10013471
390 Ga0265342_10029540
391 Ga0307405_10098605
392 Ga0307412_10263156
393 Ga0307409_100089794
394 Ga0307409_100224439
395 Ga0307416_100034992
396 Ga0307415_100147289
397 Ga0373950_0000016
398 Ga0373950_0000024
399 Ga0373953_0092185
400 Ga0373954_0008332
401 Ga0373957_0016255
402 Ga0373955_0001747
403 Ga0373933_0000599
404 Ga0373933_0123623
405 Ga0373937_0001061
406 Ga0373937_0061728
407 Ga0395900_0423192
408 Ga0395901_0029401
409 Ga0400491_16071
410 Ga0436360_0056674
411 Ga0453684_0174791
412 Ga0451576_0092748
413 Ga0495603_0190051
414 Ga0495582_0072569
415 Ga0495594_0031026
416 Ga0495586_0085322
417 Ga0495622_0094808
418 Ga0495658_0152831
419 Ga0495600_0076063
420 Ga0496100_0225432
421 Ga0496105_0067962
422 Ga0496105_0345222
423 Ga0496114_0014625
424 Ga0496114_0108382
425 Ga0496115_0025803
426 Ga0501298_031379
427 Ga0501032_0056994
428 Ga0501032_0063764
429 Ga0501034_0000096
430 Ga0501034_0425898
431 Ga0501036_0009152
432 Ga0501036_0052626
433 Ga0501037_0014178
434 Ga0501038_0135376
435 Ga0501039_0068653
436 Ga0501039_0122318
437 Ga0501040_0028639
438 Ga0501041_0003330
439 Ga0501042_0003674
440 Ga0501043_0028544
441 Ga0501046_0000712
442 Ga0501046_0062467
443 Ga0501047_0000008
444 Ga0501048_0001551
445 Ga0501048_0062589
446 Ga0501067_0000064
447 Ga0501068_0034811
448 Ga0501068_0086520
449 Ga0501069_0097311
450 Ga0501069_0165536
451 Ga0501070_0000064
452 Ga0501070_0037074
453 Ga0501070_0050252
454 Ga0501070_0062510
455 Ga0501072_0000824
456 Ga0501073_0001179
457 Ga0501073_0017025
458 Ga0501073_0022300
459 Ga0501073_0028047
460 Ga0501073_0088583
461 Ga0501074_0000513
462 Ga0501075_0001031
463 Ga0501076_0000009
464 Ga0501076_0545298
465 Ga0501207_018565
466 Ga0501217_053788
467 Ga0501225_0022702
468 Ga0501079_0003761
469 Ga0501079_0056347
470 Ga0501079_0080945
471 Ga0501080_0054343
472 Ga0501081_0011352
473 Ga0501081_0042068
474 Ga0501081_0160908
475 Ga0501083_0082806
476 Ga0501035_0042161
477 Ga0501035_0202389
478 Ga0501045_0042105
479 nmdc:mga05p37_34825_c1
480 nmdc:mga05p37_56408_c1
481 nmdc:mga05p37_9762_c1
482 nmdc:mga09592_219456_c1
483 nmdc:mga08y16_530716_c1
484 nmdc:mga08y16_885_c1
485 nmdc:mga0n895_144529_c1
486 nmdc:mga0n895_364236_c1
487 nmdc:mga0rr50_10666_c1
488 nmdc:mga0rr50_125675_c1
489 nmdc:mga0rr50_198928_c1
490 nmdc:mga0rr50_374248_c1
491 nmdc:mga0rr50_48222_c1
492 nmdc:mga08x19_185240_c1
493 nmdc:mga08x19_20735_c1
494 nmdc:mga08x19_59057_c1
495 nmdc:mga08x19_73203_c1
496 nmdc:mga0a205_104281_c1
497 nmdc:mga0a205_34292_c1
498 Ga0500635_0000116
499 Ga0500597_004228
500 Ga0500568_0019218
501 Ga0500619_000400
502 Ga0500638_000008
503 Ga0500639_000094
504 Ga0500636_0000078
505 Ga0500636_0034718
506 Ga0500601_000065
507 Ga0501084_0000089
508 Ga0501082_0002402
509 Ga0501082_0052792
510 Ga0530510_0000023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

9

238

0.94

PF04321

RmlD_sub_bind

RmlD substrate binding domain

7

142

0.8

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

35

301

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ewu-assembly1.cif.gz_A x-ray structure of the gdp-6-deoxy-4-keto-d-lyxo-heptose-4-reductase from campylobacter jejuni hs:15 0.9381 1 311
4bl5-assembly6.cif.gz_C crystal structure of human gdp-l-fucose synthase with bound nadp and product gdp-l-fucose 0.9367 1 313
7ll6-assembly1.cif.gz_A-2 crystal structure of fucose synthetase family protein from brucella suis atcc 23445 0.9329 5 309
4b8w-assembly1.cif.gz_B crystal structure of human gdp-l-fucose synthase with bound nadp and gdp, tetragonal crystal form 0.9326 4 309
8du0-assembly1.cif.gz_A crystal structure of nadp bound gdp-l-fucose synthase from brucella ovis 0.9319 5 309
ID Description Score Start End Superfamily
1e6uA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9134 171 311 3.90.25.10
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9084 119 311 3.40.50.720
1e6uA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9044 171 311 3.90.25.10
1bwsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8964 7 294 3.40.50.720
1bwsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8924 7 294 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A532DI86-F1-model_v4 Multifunctional fusion protein [Includes: GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase); GDP-L-fucose synthase (EC 1.1.1.271) (GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase)] 0.9847 1 315 GO:0008446
GO:0016853
GO:0042351
GO:0050577
GO:0070401
AF-A0A6J6QI12-F1-model_v4 Unannotated protein 0.9792 9 314 GO:0016020
GO:0016853
GO:0050577
AF-A0A7C2Y559-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9782 139 310 GO:0050577
AF-A0A832UCS8-F1-model_v4 GDP-L-fucose synthase (EC 1.1.1.271) (GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase) 0.9777 2 313 GO:0016853
GO:0042351
GO:0050577
GO:0070401
AF-A0A532DI86-F1-model_v4 Multifunctional fusion protein [Includes: GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase); GDP-L-fucose synthase (EC 1.1.1.271) (GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase)] 0.9754 1 315 GO:0008446
GO:0016853
GO:0042351
GO:0050577
GO:0070401

Map