F365537

General Info

Members Datasets Scaffolds Average Seq Length
255 150 510 344

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100128879|Ga0070672_1001288791
Length 379
Sequence MRRRRQSFCKTTWTNVRKLLYVAAVLIVLLGAVGIALWRGLHEPYKGYSGTEQFVTIRQGASSSEIGRQLATAQVVRDPRLFRAALWWTGRGRSLRAGEYRFDHALTPLEVLDVLVRGDVYTLRLTFPEGLNIEEMSKLYESHGFGKASDFVVAARNVKRIRELDDKASDLEGYLFPETYSLPRQMSAARLVDLMVDRFLAVYDERMRARASAEGLTTRQAVTLASLIEKETGKAEERPIVAAVYRNRMKIGMPMQADPTVVYALLRAHRYDGNIRRDDLSMDSPYNTYKYAGLPPGPIASAGKASLEAALAPADAPYLYFVSRNDGSHVFAQTLDEHNANVRKYQVDFFRQQRQAKAASAPPTSASRGAARSSRARVP

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
104 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
105 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
106 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
144 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
145 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 0
Rhizosphere 98.04
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100128879 3300005543 Bacteria 2078
2 Ga0065707_10098904 3300005295 Bacteria 3047
3 Ga0070676_10025385 3300005328 Bacteria 3349
4 Ga0070683_100010292 3300005329 Bacteria 8042
5 Ga0070670_100095147 3300005331 Bacteria 2562
6 Ga0068869_100001798 3300005334 Bacteria 12866
7 Ga0070666_10127170 3300005335 Bacteria 1769
8 Ga0070680_100144836 3300005336 Bacteria 1993
9 Ga0070689_100093940 3300005340 Bacteria 2367
10 Ga0070687_100013566 3300005343 Bacteria 3635
11 Ga0070687_100036529 3300005343 Bacteria 2449
12 Ga0070661_100121358 3300005344 Bacteria 1958
13 Ga0070668_100389074 3300005347 Bacteria 1188
14 Ga0070669_100002727 3300005353 Bacteria 12739
15 Ga0070669_100011077 3300005353 Bacteria 6401
16 Ga0070669_100051692 3300005353 Bacteria 3005
17 Ga0070675_100000537 3300005354 Bacteria 25951
18 Ga0070675_100006081 3300005354 Bacteria 9250
19 Ga0070675_100013258 3300005354 Bacteria 6477
20 Ga0070675_100105098 3300005354 Bacteria 2383
21 Ga0070671_100014309 3300005355 Bacteria 6408
22 Ga0070674_100016590 3300005356 Bacteria 4617
23 Ga0070674_100215445 3300005356 Bacteria 1491
24 Ga0070673_100014639 3300005364 Bacteria 5474
25 Ga0070673_100097504 3300005364 Bacteria 2414
26 Ga0070673_100145646 3300005364 Bacteria 2002
27 Ga0070688_100143039 3300005365 Bacteria 1627
28 Ga0070701_10004199 3300005438 Bacteria 5801
29 Ga0070705_100001006 3300005440 Bacteria 15697
30 Ga0070700_100018136 3300005441 Bacteria 4041
31 Ga0070700_100019280 3300005441 Bacteria 3934
32 Ga0070694_100001224 3300005444 Bacteria 14823
33 Ga0070694_100045175 3300005444 Bacteria 2951
34 Ga0070694_100110847 3300005444 Bacteria 1955
35 Ga0070694_100149924 3300005444 Bacteria 1702
36 Ga0070678_100067402 3300005456 Bacteria 2664
37 Ga0070678_100150415 3300005456 Bacteria 1875
38 Ga0070681_10045119 3300005458 Bacteria 4411
39 Ga0068867_100000147 3300005459 Bacteria 45184
40 Ga0068867_100037628 3300005459 Bacteria 3517
41 Ga0070707_100301551 3300005468 Bacteria 1557
42 Ga0070699_100000339 3300005518 Bacteria 45340
43 Ga0070699_100012945 3300005518 Bacteria 7190
44 Ga0070699_100033837 3300005518 Bacteria 4416
45 Ga0070679_100254488 3300005530 Bacteria 1712
46 Ga0070684_100015033 3300005535 Bacteria 6289
47 Ga0070672_100017006 3300005543 Bacteria 5222
48 Ga0070672_100046142 3300005543 Bacteria 3375
49 Ga0070672_100088757 3300005543 Bacteria 2490
50 Ga0070695_100000425 3300005545 Bacteria 21837
51 Ga0070695_100045159 3300005545 Bacteria 2807
52 Ga0070696_100004775 3300005546 Bacteria 9057
53 Ga0070696_100249669 3300005546 Bacteria 1341
54 Ga0070704_100007503 3300005549 Bacteria 6493
55 Ga0070704_100037508 3300005549 Bacteria 3312
56 Ga0070664_100010031 3300005564 Bacteria 7676
57 Ga0070664_100092007 3300005564 Bacteria 2626
58 Ga0070664_100158255 3300005564 Bacteria 2003
59 Ga0068857_100073102 3300005577 Bacteria 3054
60 Ga0068854_100158195 3300005578 Bacteria 1752
61 Ga0068859_100000008 3300005617 Bacteria 383750
62 Ga0068859_100022329 3300005617 Bacteria 6345
63 Ga0068859_100066428 3300005617 Bacteria 3641
64 Ga0068859_100271963 3300005617 Bacteria 1786
65 Ga0068866_10010289 3300005718 Bacteria 4005
66 Ga0068861_100001293 3300005719 Bacteria 15634
67 Ga0068861_100089025 3300005719 Bacteria 2432
68 Ga0068870_10012409 3300005840 Bacteria 3981
69 Ga0068870_10014636 3300005840 Bacteria 3709
70 Ga0068863_100223707 3300005841 Unclassified 1814
71 Ga0068863_100248718 3300005841 Bacteria 1717
72 Ga0068858_100042183 3300005842 Bacteria 4230
73 Ga0068858_100085656 3300005842 Bacteria 2932
74 Ga0068860_100045133 3300005843 Bacteria 4201
75 Ga0068862_100001293 3300005844 Bacteria 23404
76 Ga0068862_100043447 3300005844 Bacteria 3832
77 Ga0081538_10016052 3300005981 Bacteria 5761
78 Ga0081539_10009115 3300005985 Bacteria 8392
79 Ga0075428_100040404 3300006844 Bacteria 5132
80 Ga0075428_100209457 3300006844 Bacteria 2107
81 Ga0075431_100436008 3300006847 Bacteria 1308
82 Ga0075433_10138975 3300006852 Unclassified 2159
83 Ga0075434_100031758 3300006871 Bacteria 5207
84 Ga0075434_100043557 3300006871 Bacteria 4452
85 Ga0075434_100260325 3300006871 Unclassified 1754
86 Ga0068865_100045671 3300006881 Bacteria 3003
87 Ga0097620_100000008 3300006931 Bacteria 383750
88 Ga0097620_100022326 3300006931 Bacteria 6345
89 Ga0097620_100066435 3300006931 Bacteria 3641
90 Ga0097620_100271960 3300006931 Bacteria 1786
91 Ga0075435_100013704 3300007076 Bacteria 6040
92 Ga0105240_10073147 3300009093 Bacteria 4233
93 Ga0111539_10001774 3300009094 Bacteria 28680
94 Ga0111539_10099585 3300009094 Bacteria 3413
95 Ga0111539_10129113 3300009094 Bacteria 2960
96 Ga0114129_10003276 3300009147 Bacteria 22724
97 Ga0114129_10029480 3300009147 Bacteria 7773
98 Ga0114129_10036817 3300009147 Bacteria 6909
99 Ga0114129_10086877 3300009147 Bacteria 4337
100 Ga0105243_10021283 3300009148 Bacteria 4923
101 Ga0105243_10040397 3300009148 Bacteria 3643
102 Ga0105242_10004358 3300009176 Bacteria 11013
103 Ga0105238_10029740 3300009551 Bacteria 5564
104 Ga0105249_10058932 3300009553 Bacteria 3521
105 Ga0105249_10136576 3300009553 Bacteria 2347
106 Ga0157375_10017681 3300013308 Bacteria 6443
107 Ga0157375_10186557 3300013308 Bacteria 2227
108 Ga0157375_10366930 3300013308 Bacteria 1606
109 Ga0157375_10456442 3300013308 Bacteria 1443
110 Ga0157380_10026631 3300014326 Bacteria 4392
111 Ga0157380_10221979 3300014326 Bacteria 1691
112 Ga0157380_10225998 3300014326 Unclassified 1678
113 Ga0157377_10023133 3300014745 Bacteria 3290
114 Ga0157376_10366440 3300014969 Unclassified 1383
115 Ga0207642_10006028 3300025899 Bacteria 4004
116 Ga0207680_10050432 3300025903 Bacteria 2483
117 Ga0207645_10010441 3300025907 Bacteria 6373
118 Ga0207645_10016675 3300025907 Bacteria 4858
119 Ga0207643_10011688 3300025908 Bacteria 4742
120 Ga0207643_10019733 3300025908 Bacteria 3695
121 Ga0207662_10009076 3300025918 Bacteria 5462
122 Ga0207662_10048110 3300025918 Bacteria 2526
123 Ga0207681_10000566 3300025923 Bacteria 25276
124 Ga0207681_10031982 3300025923 Bacteria 3441
125 Ga0207650_10003068 3300025925 Bacteria 11504
126 Ga0207650_10133714 3300025925 Unclassified 1943
127 Ga0207659_10001222 3300025926 Bacteria 15363
128 Ga0207659_10002762 3300025926 Bacteria 10460
129 Ga0207659_10038664 3300025926 Bacteria 3321
130 Ga0207659_10243140 3300025926 Bacteria 1457
131 Ga0207686_10003148 3300025934 Bacteria 8874
132 Ga0207709_10011383 3300025935 Bacteria 4907
133 Ga0207709_10019737 3300025935 Bacteria 3794
134 Ga0207670_10058249 3300025936 Bacteria 2624
135 Ga0207670_10096842 3300025936 Bacteria 2099
136 Ga0207670_10178515 3300025936 Bacteria 1598
137 Ga0207704_10058596 3300025938 Bacteria 2372
138 Ga0207691_10028999 3300025940 Bacteria 5178
139 Ga0207691_10047514 3300025940 Bacteria 3938
140 Ga0207691_10083466 3300025940 Bacteria 2868
141 Ga0207689_10005795 3300025942 Bacteria 10963
142 Ga0207679_10069523 3300025945 Bacteria 2650
143 Ga0207651_10012826 3300025960 Bacteria 4763
144 Ga0207712_10009450 3300025961 Bacteria 6170
145 Ga0207668_10335699 3300025972 Bacteria 1259
146 Ga0207640_10344200 3300025981 Unclassified 1195
147 Ga0207703_10027999 3300026035 Bacteria 4438
148 Ga0207703_10033753 3300026035 Bacteria 4059
149 Ga0207708_10001732 3300026075 Bacteria 16102
150 Ga0207708_10034870 3300026075 Bacteria 3828
151 Ga0207648_10000093 3300026089 Bacteria 84666
152 Ga0207648_10000446 3300026089 Bacteria 45706
153 Ga0207676_10016223 3300026095 Bacteria 5393
154 Ga0207674_10021515 3300026116 Bacteria 6944
155 Ga0207674_10050425 3300026116 Bacteria 4252
156 Ga0207675_100001058 3300026118 Bacteria 27297
157 Ga0207675_100099553 3300026118 Bacteria 2738
158 Ga0207675_100345576 3300026118 Bacteria 1457
159 Ga0207683_10088885 3300026121 Bacteria 2749
160 Ga0207683_10103829 3300026121 Bacteria 2539
161 Ga0207683_10247964 3300026121 Bacteria 1625
162 Ga0207428_10000224 3300027907 Bacteria 78533
163 Ga0207428_10000353 3300027907 Bacteria 59325
164 Ga0207428_10114038 3300027907 Bacteria 2077
165 Ga0268265_10000540 3300028380 Bacteria 38471
166 Ga0268265_10005201 3300028380 Bacteria 8915
167 Ga0268265_10029716 3300028380 Bacteria 3928
168 Ga0268264_10026797 3300028381 Bacteria 4709
169 Ga0268264_10040314 3300028381 Bacteria 3859
170 Ga0307408_100124105 3300031548 Bacteria 2005
171 Ga0307405_10229977 3300031731 Bacteria 1366
172 Ga0307410_10092908 3300031852 Unclassified 2146
173 Ga0307409_100126794 3300031995 Bacteria 2173
174 Ga0307409_100364769 3300031995 Bacteria 1368
175 Ga0307414_10102308 3300032004 Unclassified 2159
176 Ga0307415_100032794 3300032126 Bacteria 3364
177 Ga0373960_0031645 3300035121 Unclassified 1481
178 Ga0373937_0000297 3300036401 Bacteria 47202
179 Ga0436364_0215309 3300037853 Bacteria 4629
180 Ga0436364_1470702 3300037853 Bacteria 2268
181 Ga0451576_0021675 3300045051 Bacteria 6980
182 Ga0451576_0031953 3300045051 Bacteria 5610
183 Ga0451576_0330533 3300045051 Unclassified 1595
184 Ga0495621_0000539 3300046539 Bacteria 9397
185 Ga0495621_0006098 3300046539 Unclassified 3502
186 Ga0495659_0044972 3300046664 Bacteria 1589
187 Ga0495636_0021923 3300047318 Bacteria 2581
188 Ga0495677_0056851 3300047445 Bacteria 1446
189 Ga0501031_0001259 3300049568 Bacteria 15509
190 Ga0501032_0004264 3300049569 Bacteria 10799
191 Ga0501033_0007073 3300049570 Bacteria 8763
192 Ga0501034_0013597 3300049571 Bacteria 8377
193 Ga0501036_0033594 3300049572 Bacteria 4338
194 Ga0501036_0034701 3300049572 Bacteria 4267
195 Ga0501037_0003760 3300049573 Bacteria 11006
196 Ga0501038_0001579 3300049574 Bacteria 21102
197 Ga0501038_0034241 3300049574 Bacteria 4467
198 Ga0501038_0216023 3300049574 Bacteria 1532
199 Ga0501039_0007773 3300049575 Bacteria 8178
200 Ga0501042_0065870 3300049578 Bacteria 2589
201 Ga0501042_0204550 3300049578 Unclassified 1424
202 Ga0501043_0002485 3300049579 Bacteria 15597
203 Ga0501043_0019504 3300049579 Bacteria 5322
204 Ga0501046_0004021 3300049580 Bacteria 13430
205 Ga0501046_0006836 3300049580 Bacteria 10064
206 Ga0501048_0006495 3300049582 Bacteria 8887
207 Ga0501048_0120288 3300049582 Bacteria 1855
208 Ga0501067_0006773 3300049583 Bacteria 6355
209 Ga0501067_0012768 3300049583 Bacteria 4654
210 Ga0501068_0006038 3300049584 Bacteria 6656
211 Ga0501069_0005284 3300049585 Bacteria 6708
212 Ga0501069_0012823 3300049585 Bacteria 4462
213 Ga0501071_0128258 3300049587 Bacteria 1883
214 Ga0501071_0215208 3300049587 Bacteria 1445
215 Ga0501072_0012415 3300049588 Bacteria 6509
216 Ga0501073_0005905 3300049589 Bacteria 9137
217 Ga0501073_0006275 3300049589 Bacteria 8857
218 Ga0501074_0002883 3300049590 Bacteria 12056
219 Ga0501075_0093770 3300049591 Bacteria 2279
220 Ga0501075_0288417 3300049591 Bacteria 1250
221 Ga0501076_0013031 3300049592 Bacteria 6225
222 Ga0501076_0015000 3300049592 Bacteria 5851
223 Ga0501077_0001306 3300049593 Bacteria 15060
224 Ga0501249_013756 3300049679 Unclassified 1721
225 Ga0501079_0010623 3300049741 Bacteria 7007
226 Ga0501080_0000494 3300049742 Bacteria 30812
227 Ga0501081_0041043 3300049743 Bacteria 3168
228 Ga0501083_0003677 3300049744 Bacteria 10767
229 Ga0501083_0125458 3300049744 Bacteria 1683
230 Ga0501044_0441157 3300049823 Bacteria 1209
231 Ga0501045_0040804 3300049824 Bacteria 3375
232 nmdc:mga05p37_138748_c1 3300050507 Bacteria 2980
233 nmdc:mga05p37_263258_c1 3300050507 Bacteria 2063
234 nmdc:mga05p37_9387_c1 3300050507 Bacteria 11579
235 nmdc:mga09592_114920_c1 3300050508 Bacteria 2310
236 nmdc:mga0qj67_94606_c1 3300050509 Bacteria 2404
237 nmdc:mga06r32_152696_c1 3300050510 Bacteria 2289
238 nmdc:mga08y16_20288_c1 3300050511 Bacteria 7016
239 nmdc:mga08y16_3489_c1 3300050511 Bacteria 16324
240 nmdc:mga08y16_37541_c1 3300050511 Bacteria 5087
241 nmdc:mga0n895_144524_c1 3300050512 Bacteria 2408
242 nmdc:mga0n895_173589_c1 3300050512 Bacteria 2187
243 nmdc:mga0n895_414126_c1 3300050512 Bacteria 1363
244 nmdc:mga0n895_4856_c1 3300050512 Bacteria 11143
245 nmdc:mga0rr50_155556_c1 3300050513 Bacteria 1852
246 nmdc:mga0rr50_203525_c1 3300050513 Bacteria 1628
247 Ga0500616_0000100 3300053153 Bacteria 173477
248 Ga0500645_001538 3300053730 Bacteria 11520
249 Ga0500609_004289 3300053731 Bacteria 1977
250 Ga0501084_0031976 3300054114 Bacteria 4401
251 Ga0590071_019837 3300059421 Bacteria 1583
252 Ga0590077_004263 3300059426 Bacteria 2946
253 Ga0501082_0026862 3300060353 Bacteria 4959
254 Ga0501082_0028619 3300060353 Bacteria 4799
255 Ga0530510_0240440 3300061734 Bacteria 1348
256 Ga0070672_100128879
257 Ga0065707_10098904
258 Ga0070676_10025385
259 Ga0070683_100010292
260 Ga0070670_100095147
261 Ga0068869_100001798
262 Ga0070666_10127170
263 Ga0070680_100144836
264 Ga0070689_100093940
265 Ga0070687_100013566
266 Ga0070687_100036529
267 Ga0070661_100121358
268 Ga0070668_100389074
269 Ga0070669_100002727
270 Ga0070669_100011077
271 Ga0070669_100051692
272 Ga0070675_100000537
273 Ga0070675_100006081
274 Ga0070675_100013258
275 Ga0070675_100105098
276 Ga0070671_100014309
277 Ga0070674_100016590
278 Ga0070674_100215445
279 Ga0070673_100014639
280 Ga0070673_100097504
281 Ga0070673_100145646
282 Ga0070688_100143039
283 Ga0070701_10004199
284 Ga0070705_100001006
285 Ga0070700_100018136
286 Ga0070700_100019280
287 Ga0070694_100001224
288 Ga0070694_100045175
289 Ga0070694_100110847
290 Ga0070694_100149924
291 Ga0070678_100067402
292 Ga0070678_100150415
293 Ga0070681_10045119
294 Ga0068867_100000147
295 Ga0068867_100037628
296 Ga0070707_100301551
297 Ga0070699_100000339
298 Ga0070699_100012945
299 Ga0070699_100033837
300 Ga0070679_100254488
301 Ga0070684_100015033
302 Ga0070672_100017006
303 Ga0070672_100046142
304 Ga0070672_100088757
305 Ga0070695_100000425
306 Ga0070695_100045159
307 Ga0070696_100004775
308 Ga0070696_100249669
309 Ga0070704_100007503
310 Ga0070704_100037508
311 Ga0070664_100010031
312 Ga0070664_100092007
313 Ga0070664_100158255
314 Ga0068857_100073102
315 Ga0068854_100158195
316 Ga0068859_100000008
317 Ga0068859_100022329
318 Ga0068859_100066428
319 Ga0068859_100271963
320 Ga0068866_10010289
321 Ga0068861_100001293
322 Ga0068861_100089025
323 Ga0068870_10012409
324 Ga0068870_10014636
325 Ga0068863_100223707
326 Ga0068863_100248718
327 Ga0068858_100042183
328 Ga0068858_100085656
329 Ga0068860_100045133
330 Ga0068862_100001293
331 Ga0068862_100043447
332 Ga0081538_10016052
333 Ga0081539_10009115
334 Ga0075428_100040404
335 Ga0075428_100209457
336 Ga0075431_100436008
337 Ga0075433_10138975
338 Ga0075434_100031758
339 Ga0075434_100043557
340 Ga0075434_100260325
341 Ga0068865_100045671
342 Ga0097620_100000008
343 Ga0097620_100022326
344 Ga0097620_100066435
345 Ga0097620_100271960
346 Ga0075435_100013704
347 Ga0105240_10073147
348 Ga0111539_10001774
349 Ga0111539_10099585
350 Ga0111539_10129113
351 Ga0114129_10003276
352 Ga0114129_10029480
353 Ga0114129_10036817
354 Ga0114129_10086877
355 Ga0105243_10021283
356 Ga0105243_10040397
357 Ga0105242_10004358
358 Ga0105238_10029740
359 Ga0105249_10058932
360 Ga0105249_10136576
361 Ga0157375_10017681
362 Ga0157375_10186557
363 Ga0157375_10366930
364 Ga0157375_10456442
365 Ga0157380_10026631
366 Ga0157380_10221979
367 Ga0157380_10225998
368 Ga0157377_10023133
369 Ga0157376_10366440
370 Ga0207642_10006028
371 Ga0207680_10050432
372 Ga0207645_10010441
373 Ga0207645_10016675
374 Ga0207643_10011688
375 Ga0207643_10019733
376 Ga0207662_10009076
377 Ga0207662_10048110
378 Ga0207681_10000566
379 Ga0207681_10031982
380 Ga0207650_10003068
381 Ga0207650_10133714
382 Ga0207659_10001222
383 Ga0207659_10002762
384 Ga0207659_10038664
385 Ga0207659_10243140
386 Ga0207686_10003148
387 Ga0207709_10011383
388 Ga0207709_10019737
389 Ga0207670_10058249
390 Ga0207670_10096842
391 Ga0207670_10178515
392 Ga0207704_10058596
393 Ga0207691_10028999
394 Ga0207691_10047514
395 Ga0207691_10083466
396 Ga0207689_10005795
397 Ga0207679_10069523
398 Ga0207651_10012826
399 Ga0207712_10009450
400 Ga0207668_10335699
401 Ga0207640_10344200
402 Ga0207703_10027999
403 Ga0207703_10033753
404 Ga0207708_10001732
405 Ga0207708_10034870
406 Ga0207648_10000093
407 Ga0207648_10000446
408 Ga0207676_10016223
409 Ga0207674_10021515
410 Ga0207674_10050425
411 Ga0207675_100001058
412 Ga0207675_100099553
413 Ga0207675_100345576
414 Ga0207683_10088885
415 Ga0207683_10103829
416 Ga0207683_10247964
417 Ga0207428_10000224
418 Ga0207428_10000353
419 Ga0207428_10114038
420 Ga0268265_10000540
421 Ga0268265_10005201
422 Ga0268265_10029716
423 Ga0268264_10026797
424 Ga0268264_10040314
425 Ga0307408_100124105
426 Ga0307405_10229977
427 Ga0307410_10092908
428 Ga0307409_100126794
429 Ga0307409_100364769
430 Ga0307414_10102308
431 Ga0307415_100032794
432 Ga0373960_0031645
433 Ga0373937_0000297
434 Ga0436364_0215309
435 Ga0436364_1470702
436 Ga0451576_0021675
437 Ga0451576_0031953
438 Ga0451576_0330533
439 Ga0495621_0000539
440 Ga0495621_0006098
441 Ga0495659_0044972
442 Ga0495636_0021923
443 Ga0495677_0056851
444 Ga0501031_0001259
445 Ga0501032_0004264
446 Ga0501033_0007073
447 Ga0501034_0013597
448 Ga0501036_0033594
449 Ga0501036_0034701
450 Ga0501037_0003760
451 Ga0501038_0001579
452 Ga0501038_0034241
453 Ga0501038_0216023
454 Ga0501039_0007773
455 Ga0501042_0065870
456 Ga0501042_0204550
457 Ga0501043_0002485
458 Ga0501043_0019504
459 Ga0501046_0004021
460 Ga0501046_0006836
461 Ga0501048_0006495
462 Ga0501048_0120288
463 Ga0501067_0006773
464 Ga0501067_0012768
465 Ga0501068_0006038
466 Ga0501069_0005284
467 Ga0501069_0012823
468 Ga0501071_0128258
469 Ga0501071_0215208
470 Ga0501072_0012415
471 Ga0501073_0005905
472 Ga0501073_0006275
473 Ga0501074_0002883
474 Ga0501075_0093770
475 Ga0501075_0288417
476 Ga0501076_0013031
477 Ga0501076_0015000
478 Ga0501077_0001306
479 Ga0501249_013756
480 Ga0501079_0010623
481 Ga0501080_0000494
482 Ga0501081_0041043
483 Ga0501083_0003677
484 Ga0501083_0125458
485 Ga0501044_0441157
486 Ga0501045_0040804
487 nmdc:mga05p37_138748_c1
488 nmdc:mga05p37_263258_c1
489 nmdc:mga05p37_9387_c1
490 nmdc:mga09592_114920_c1
491 nmdc:mga0qj67_94606_c1
492 nmdc:mga06r32_152696_c1
493 nmdc:mga08y16_20288_c1
494 nmdc:mga08y16_3489_c1
495 nmdc:mga08y16_37541_c1
496 nmdc:mga0n895_144524_c1
497 nmdc:mga0n895_173589_c1
498 nmdc:mga0n895_414126_c1
499 nmdc:mga0n895_4856_c1
500 nmdc:mga0rr50_155556_c1
501 nmdc:mga0rr50_203525_c1
502 Ga0500616_0000100
503 Ga0500645_001538
504 Ga0500609_004289
505 Ga0501084_0031976
506 Ga0590071_019837
507 Ga0590077_004263
508 Ga0501082_0026862
509 Ga0501082_0028619
510 Ga0530510_0240440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02618

YceG

YceG-like family

55

344

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r1f-assembly1.cif.gz_A crystal structure of predicted aminodeoxychorismate lyase from escherichia coli 0.8137 75 341
2r1f-assembly1.cif.gz_A crystal structure of predicted aminodeoxychorismate lyase from escherichia coli 0.8055 75 341
4iiw-assembly1.cif.gz_A-5 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes 0.6933 31 320
4iiw-assembly1.cif.gz_B 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes 0.6795 32 320
4iiw-assembly1.cif.gz_A-5 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes 0.6611 31 320
ID Description Score Start End Superfamily
4iiwB01 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Endolytic murein transglycosylase 0.9175 32 101 3.30.1490.480
4iiwB01 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Endolytic murein transglycosylase 0.8242 32 101 3.30.1490.480
af_Q8JGR4_1_63_2.30.170.20 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L24 0.4849 294 335 2.30.170.20
af_Q9M2L3_272_361_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.4625 294 339 3.30.40.10
af_A0A286YBK5_623_778_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.3996 294 358 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A3B0VLB7-F1-model_v4 FIG004453: protein YceG like 0.9759 204 327 GO:0005886
GO:0016829
GO:0071555
AF-A0A455U6T2-F1-model_v4 Endolytic murein transglycosylase 0.975 199 328 GO:0005886
GO:0016829
GO:0071555
AF-A0A3D2NZ87-F1-model_v4 deleted 0.9728 153 326
AF-V4KU55-F1-model_v4 Endolytic transglycosylase MltG 0.9689 212 328 GO:0005886
GO:0016829
GO:0071555
AF-A0A3D2NZ87-F1-model_v4 deleted 0.9673 153 326

Map