F365309

General Info

Members Datasets Scaffolds Average Seq Length
254 141 201 257

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919395869|2919397646
Length 253
Sequence RSHALDETGYVVLDRYDQTTDPAEWFDLEYVPWRSSGITRFAPLASYAGDLECNGFWNHTPPRPDKDGVWIPRQATAAPTLVRRAEEAGANIGRCRVIELQPNTYADAVYNLHQDDNNRLNEEGGWVVRGFLNLTDDPESLLILRSDRFDPATEIRLPLPAGSRIVVDTQRFWHAVWHRGVAPRYALIASWTSGPELDAYISSNHGDPHPVSVHLDEALVEEGQRELHRRIEERRRIFEAQGITMEPPEPLWP

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221553 Microbacterium sp. Root553 Isolate Unclassified
4 2643221566 Microbacterium sp. Root166 Isolate Unclassified
5 2643221575 Microbacterium sp. Root61 Isolate Unclassified
6 2643221597 Microbacterium sp. Root180 Isolate Unclassified
7 2643221630 Microbacterium sp. Root322 Isolate Unclassified
8 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
9 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
10 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
11 2773857759 Microbacterium sp. 1294 Isolate Unclassified
12 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
13 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
14 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
15 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
16 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
17 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
18 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
19 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
20 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
21 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
22 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
23 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
24 2919395869 Microbacterium resistens 2980 Isolate Unclassified
25 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
26 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
27 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
28 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
29 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
30 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
31 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
32 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
33 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
34 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
84 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
94 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
95 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
96 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
116 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
133 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
139 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
140 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
141 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.56
Metatranscriptomes 1.97
Isolates 20.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0
Endosphere 12.2
Nodule 0
Rhizoplane 6.3
Rhizosphere 48.03
Stem 0
Stem Tuber 0
Unclassified 33.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10030145 3300001979 Bacteria 1771
2 JGI25154J39366_1000478 3300002738 Bacteria 20885
3 Ga0006562J51391_1212240 3300003578 Bacteria 1951
4 Ga0006562J51391_1212241 3300003578 Bacteria 1890
5 Ga0070658_10000381 3300005327 Bacteria 38709
6 Ga0070683_100823844 3300005329 Bacteria 890
7 Ga0070660_100563189 3300005339 Bacteria 951
8 Ga0070659_100063839 3300005366 Bacteria 2914
9 Ga0070679_100601236 3300005530 Bacteria 1043
10 Ga0070665_100036458 3300005548 Bacteria 4946
11 Ga0068855_100298460 3300005563 Bacteria 1785
12 Ga0081540_1042296 3300005983 Bacteria 2351
13 Ga0070717_10250015 3300006028 Bacteria 1566
14 Ga0075365_10007174 3300006038 Bacteria 6221
15 Ga0075365_10052755 3300006038 Bacteria 2691
16 Ga0075368_10027944 3300006042 Bacteria 2178
17 Ga0075364_10030862 3300006051 Bacteria 3441
18 Ga0075364_10048154 3300006051 Bacteria 2777
19 Ga0075364_10055137 3300006051 Bacteria 2600
20 Ga0075364_10057997 3300006051 Bacteria 2537
21 Ga0075364_10095167 3300006051 Bacteria 1980
22 Ga0075364_10102713 3300006051 Bacteria 1903
23 Ga0075364_10156826 3300006051 Bacteria 1535
24 Ga0075364_10305221 3300006051 Bacteria 1084
25 Ga0075367_10042004 3300006178 Bacteria 2674
26 Ga0075369_10007725 3300006186 Bacteria 4110
27 Ga0075369_10017418 3300006186 Bacteria 2911
28 Ga0075370_10054685 3300006353 Bacteria 2267
29 Ga0105240_10574494 3300009093 Bacteria 1244
30 Ga0105243_10013535 3300009148 Bacteria 6171
31 Ga0157371_10000768 3300013102 Bacteria 37059
32 Ga0157371_10057740 3300013102 Bacteria 2752
33 Ga0157370_10005408 3300013104 Bacteria 14328
34 Ga0157370_10016106 3300013104 Bacteria 7578
35 Ga0157370_10073507 3300013104 Bacteria 3226
36 Ga0157369_10224239 3300013105 Bacteria 1967
37 Ga0157369_10421006 3300013105 Bacteria 1384
38 Ga0171462_1003 3300013250 Bacteria 853796
39 Ga0157372_10086558 3300013307 Bacteria 3555
40 Ga0157372_10218099 3300013307 Bacteria 2211
41 Ga0157375_10073398 3300013308 Bacteria 3440
42 Ga0157375_10580833 3300013308 Bacteria 1281
43 Ga0163163_10181947 3300014325 Bacteria 2149
44 Ga0157380_10042016 3300014326 Bacteria 3572
45 Ga0206354_11188825 3300020081 Bacteria 964
46 Ga0209646_1000014 3300025246 Bacteria 550484
47 Ga0209646_1000071 3300025246 Bacteria 228702
48 Ga0207655_1002843 3300025728 Bacteria 13391
49 Ga0207647_10026257 3300025904 Bacteria 3813
50 Ga0207647_10115638 3300025904 Bacteria 1584
51 Ga0207705_10000001 3300025909 Bacteria 2061880
52 Ga0207705_10000006 3300025909 Bacteria 657147
53 Ga0207657_10146057 3300025919 Bacteria 1929
54 Ga0207690_10166009 3300025932 Bacteria 1650
55 Ga0207709_10003301 3300025935 Bacteria 9674
56 Ga0207709_10157876 3300025935 Bacteria 1578
57 Ga0207667_10028166 3300025949 Bacteria 6103
58 Ga0207667_10581299 3300025949 Bacteria 1131
59 Ga0207678_10008331 3300026067 Bacteria 9137
60 Ga0209813_10022494 3300027866 Bacteria 1784
61 Ga0268266_10263569 3300028379 Bacteria 1598
62 Ga0316576_10003832 3300031727 Bacteria 8907
63 Ga0316576_10010453 3300031727 Bacteria 6030
64 Ga0316576_10014967 3300031727 Bacteria 5192
65 Ga0316576_10043694 3300031727 Bacteria 3234
66 Ga0316578_10076592 3300031728 Bacteria 1986
67 Ga0307405_10071564 3300031731 Bacteria 2232
68 Ga0307406_10000222 3300031901 Bacteria 34546
69 Ga0307406_10000595 3300031901 Bacteria 20772
70 Ga0307406_10000602 3300031901 Bacteria 20583
71 Ga0307406_10002086 3300031901 Bacteria 10902
72 Ga0307406_10007027 3300031901 Bacteria 6232
73 Ga0307412_10175618 3300031911 Bacteria 1606
74 Ga0307414_10141152 3300032004 Bacteria 1886
75 Ga0307414_10300355 3300032004 Bacteria 1358
76 Ga0307415_100387909 3300032126 Bacteria 1188
77 Ga0316593_10161677 3300032168 Bacteria 818
78 Ga0316574_0004730 3300035398 Bacteria 7184
79 Ga0316574_0006284 3300035398 Bacteria 6409
80 Ga0316574_0008672 3300035398 Bacteria 5656
81 Ga0316574_0057763 3300035398 Bacteria 2430
82 Ga0316574_0060739 3300035398 Bacteria 2373
83 Ga0316584_0161717 3300036712 Bacteria 1663
84 Ga0395898_0099136 3300037466 Bacteria 2798
85 Ga0451793_1814309 3300041452 Bacteria 1407
86 Ga0451851_1074210 3300041507 Bacteria 1069
87 Ga0466965_0018888 3300044683 Bacteria 3308
88 Ga0466970_0000138 3300044765 Bacteria 33745
89 Ga0466970_0076714 3300044765 Bacteria 1801
90 Ga0466970_0306800 3300044765 Bacteria 896
91 Ga0466957_0031554 3300044842 Bacteria 3167
92 Ga0466960_0008119 3300044901 Bacteria 4289
93 Ga0466960_0294051 3300044901 Bacteria 913
94 Ga0466959_0116662 3300045049 Bacteria 1901
95 Ga0466958_0112371 3300045836 Bacteria 1701
96 Ga0495627_000642 3300046453 Bacteria 27306
97 Ga0495627_003655 3300046453 Bacteria 6675
98 Ga0495638_0300101 3300046460 Bacteria 866
99 Ga0495654_0055437 3300046530 Bacteria 1919
100 Ga0495621_0116840 3300046539 Bacteria 1028
101 Ga0495672_0176930 3300047320 Bacteria 1083
102 Ga0495686_0167451 3300047472 Bacteria 1280
103 Ga0496100_0024611 3300048903 Bacteria 3673
104 Ga0496101_0066237 3300048904 Bacteria 2634
105 Ga0496103_0055504 3300048906 Bacteria 2457
106 Ga0496104_0170417 3300048907 Bacteria 2087
107 Ga0496105_0209924 3300048908 Bacteria 1587
108 Ga0496109_0803542 3300048912 Bacteria 878
109 Ga0496110_0158470 3300048913 Bacteria 2051
110 Ga0496110_0207077 3300048913 Bacteria 1783
111 Ga0496111_0136895 3300048914 Bacteria 1814
112 Ga0496112_0035950 3300048915 Bacteria 4828
113 Ga0496113_0019289 3300048916 Bacteria 4767
114 Ga0496114_0011754 3300048917 Bacteria 7003
115 Ga0496114_0073761 3300048917 Bacteria 2872
116 Ga0496115_0031960 3300048918 Bacteria 4150
117 Ga0496115_0078605 3300048918 Bacteria 2684
118 Ga0496116_0138241 3300048919 Bacteria 1375
119 Ga0496117_0000178 3300048920 Bacteria 131062
120 Ga0496117_0001190 3300048920 Bacteria 39141
121 Ga0496117_0002845 3300048920 Bacteria 21058
122 Ga0496117_0004772 3300048920 Bacteria 14698
123 Ga0496117_0016734 3300048920 Bacteria 6165
124 Ga0496117_0070789 3300048920 Bacteria 2340
125 Ga0496117_0166542 3300048920 Bacteria 1285
126 Ga0496118_0019129 3300048921 Bacteria 6135
127 Ga0496118_0022558 3300048921 Bacteria 5497
128 Ga0496118_0033851 3300048921 Bacteria 4183
129 Ga0496118_0049728 3300048921 Bacteria 3225
130 Ga0496119_0002138 3300048922 Bacteria 22248
131 Ga0496119_0007690 3300048922 Bacteria 9647
132 Ga0496119_0040276 3300048922 Bacteria 2991
133 Ga0496119_0060576 3300048922 Bacteria 2265
134 Ga0496120_0002449 3300048923 Bacteria 18776
135 Ga0496121_0003735 3300048924 Bacteria 21334
136 Ga0496122_0000031 3300048925 Bacteria 329726
137 Ga0496122_0000200 3300048925 Bacteria 133548
138 Ga0496122_0001810 3300048925 Bacteria 32761
139 Ga0496122_0007941 3300048925 Bacteria 11608
140 Ga0496122_0017802 3300048925 Bacteria 6608
141 Ga0496122_0025598 3300048925 Bacteria 5119
142 Ga0496122_0046431 3300048925 Bacteria 3364
143 Ga0496123_0000013 3300048926 Bacteria 439694
144 Ga0496123_0000076 3300048926 Bacteria 194050
145 Ga0496123_0011988 3300048926 Bacteria 7437
146 Ga0496123_0021272 3300048926 Bacteria 5046
147 Ga0496123_0069277 3300048926 Bacteria 2216
148 Ga0496124_0010195 3300048927 Bacteria 9556
149 Ga0496124_0302873 3300048927 Bacteria 1153
150 Ga0496125_0000077 3300048928 Bacteria 232629
151 Ga0496125_0001836 3300048928 Bacteria 29342
152 Ga0496125_0003349 3300048928 Bacteria 19512
153 Ga0496125_0003595 3300048928 Bacteria 18621
154 Ga0496125_0016443 3300048928 Bacteria 7103
155 Ga0496125_0037508 3300048928 Bacteria 4213
156 Ga0496125_0038343 3300048928 Bacteria 4149
157 Ga0496125_0130161 3300048928 Bacteria 1773
158 Ga0496125_0229707 3300048928 Bacteria 1188
159 Ga0496126_0000588 3300048929 Bacteria 68756
160 Ga0496126_0009535 3300048929 Bacteria 10298
161 Ga0496126_0023037 3300048929 Bacteria 6040
162 Ga0496126_0034650 3300048929 Bacteria 4740
163 Ga0496126_0097032 3300048929 Bacteria 2583
164 Ga0496126_0136136 3300048929 Bacteria 2119
165 Ga0496126_0194236 3300048929 Bacteria 1717
166 Ga0496126_0273245 3300048929 Bacteria 1402
167 Ga0496126_0352601 3300048929 Bacteria 1203
168 Ga0501034_0000527 3300049571 Bacteria 61221
169 Ga0501034_0016989 3300049571 Bacteria 7460
170 Ga0501034_0028026 3300049571 Bacteria 5728
171 Ga0501034_0053384 3300049571 Bacteria 4069
172 Ga0501038_0001899 3300049574 Bacteria 19324
173 Ga0501038_0005896 3300049574 Bacteria 11325
174 Ga0501038_0252347 3300049574 Bacteria 1397
175 Ga0501039_0153588 3300049575 Bacteria 1808
176 Ga0501043_0353188 3300049579 Bacteria 1117
177 Ga0501069_0068411 3300049585 Bacteria 1987
178 Ga0501069_0085005 3300049585 Bacteria 1785
179 Ga0501070_0002592 3300049586 Bacteria 15801
180 Ga0501070_0011518 3300049586 Bacteria 7469
181 Ga0501070_0055295 3300049586 Bacteria 3289
182 Ga0501071_0000579 3300049587 Bacteria 18924
183 Ga0501071_0011767 3300049587 Bacteria 5905
184 Ga0501083_0117160 3300049744 Bacteria 1748
185 nmdc:mga03n38_6323_c1 3300050490 Bacteria 4106
186 nmdc:mga00v17_16634_c2 3300050491 Bacteria 2454
187 nmdc:mga00v17_29876_c1 3300050491 Bacteria 3201
188 nmdc:mga00v17_34775_c1 3300050491 Bacteria 2995
189 nmdc:mga00v17_50178_c1 3300050491 Bacteria 2534
190 nmdc:mga0yw44_2472_c1 3300050492 Bacteria 7894
191 nmdc:mga0yw44_6017_c1 3300050492 Bacteria 5811
192 nmdc:mga07m45_24120_c1 3300050496 Bacteria 3010
193 Ga0500559_0105291 3300053136 Bacteria 1303
194 Ga0500568_0084657 3300053139 Bacteria 1201
195 Ga0500616_0000090 3300053153 Bacteria 187734
196 Ga0500616_0000126 3300053153 Bacteria 134967
197 Ga0500616_0000782 3300053153 Bacteria 36564
198 Ga0500645_003968 3300053730 Bacteria 5824
199 Ga0500645_047046 3300053730 Bacteria 1265
200 Ga0501084_0144989 3300054114 Bacteria 2000
201 Ga0587084_003156 3300059477 Bacteria 1787

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0176930 Ga0495672_0176930_74_859 240
2 3300006028 Ga0070717_10250015 Ga0070717_102500152 244
3 3300028379 Ga0268266_10263569 Ga0268266_102635692 245
4 3300005983 Ga0081540_1042296 Ga0081540_10422962 246
5 3300035398 Ga0316574_0004730 Ga0316574_0004730_6123_6872 247
6 iso_pu_bacteria 2643221575 2643887268 248
7 3300041452 Ga0451793_1814309 Ga0451793_1814309_202_954 249
8 3300049571 Ga0501034_0028026 Ga0501034_0028026_2917_3669 249
9 3300049585 Ga0501069_0068411 Ga0501069_0068411_962_1714 249
10 3300049586 Ga0501070_0011518 Ga0501070_0011518_5121_5873 249
11 3300049587 Ga0501071_0000579 Ga0501071_0000579_1978_2730 249
12 3300049744 Ga0501083_0117160 Ga0501083_0117160_400_1152 249
13 iso_pu_bacteria 2919395869 2919397646 250
14 3300013308 Ga0157375_10073398 Ga0157375_100733982 251
15 iso_pu_bacteria 2643221542 2643732776 251
16 iso_pu_bacteria 2643221553 2643784918 251
17 iso_pu_bacteria 2643221630 2644171566 251
18 iso_pu_bacteria 2643221724 2644680757 251
19 iso_pu_bacteria 2747842429 2747954605 251
20 iso_pu_bacteria 2852646457 2852647744 251
21 iso_pu_bacteria 2852663356 2852663849 251
22 iso_pu_bacteria 2857723135 2857726324 251
23 iso_pu_bacteria 2945968032 2945969018 251
24 iso_pu_bacteria 2946080515 2946083837 251
25 iso_pu_bacteria 8004182704 8004184267 251
26 3300013308 Ga0157375_10073398 Ga0157375_100733983 252
27 3300031727 Ga0316576_10010453 Ga0316576_100104532 252
28 3300031727 Ga0316576_10014967 Ga0316576_100149673 252
29 3300031727 Ga0316576_10043694 Ga0316576_100436942 252
30 3300031728 Ga0316578_10076592 Ga0316578_100765922 252
31 3300032168 Ga0316593_10161677 Ga0316593_101616771 252
32 3300035398 Ga0316574_0008672 Ga0316574_0008672_2176_2940 252
33 iso_pu_bacteria 2844852863 2844854259 252
34 iso_pu_bacteria 8056037122 8056039445 252
35 3300035398 Ga0316574_0057763 Ga0316574_0057763_390_1151 253
36 3300053139 Ga0500568_0084657 Ga0500568_0084657_404_1168 253
37 iso_pu_bacteria 2585428157 2588108916 253
38 iso_pu_bacteria 2643221542 2643733555 253
39 iso_pu_bacteria 2643221553 2643785950 253
40 iso_pu_bacteria 2643221566 2643848284 253
41 iso_pu_bacteria 2643221597 2643995722 253
42 iso_pu_bacteria 2643221630 2644170130 253
43 iso_pu_bacteria 2643221724 2644680363 253
44 iso_pu_bacteria 2728369380 2730229816 253
45 iso_pu_bacteria 2728369380 2730230825 253
46 iso_pu_bacteria 2747842429 2747952035 253
47 iso_pu_bacteria 2773857759 2774384253 253
48 iso_pu_bacteria 2773857763 2774399528 253
49 iso_pu_bacteria 2808606368 2808885843 253
50 iso_pu_bacteria 2808606447 2809227448 253
51 iso_pu_bacteria 2833709550 2833710966 253
52 iso_pu_bacteria 2844852863 2844856149 253
53 iso_pu_bacteria 2852632344 2852634206 253
54 iso_pu_bacteria 2852646457 2852647387 253
55 iso_pu_bacteria 2852663356 2852665369 253
56 iso_pu_bacteria 2857720070 2857720099 253
57 iso_pu_bacteria 2857723135 2857723993 253
58 iso_pu_bacteria 2870628048 2870630363 253
59 iso_pu_bacteria 2928090899 2928092070 253
60 iso_pu_bacteria 2945968032 2945971870 253
61 iso_pu_bacteria 2946041624 2946044327 253
62 iso_pu_bacteria 2946080515 2946080826 253
63 iso_pu_bacteria 2977251589 2977254163 253
64 iso_pu_bacteria 2984580707 2984581164 253
65 iso_pu_bacteria 8004182704 8004185060 253
66 iso_pu_bacteria 8045830549 8045831600 253
67 iso_pu_bacteria 8056037122 8056040664 253
68 iso_pu_bacteria 8057345674 8057347321 253
69 iso_pu_bacteria 8057345674 8057349456 253
70 3300006051 Ga0075364_10055137 Ga0075364_100551371 255
71 3300006051 Ga0075364_10305221 Ga0075364_103052211 255
72 3300013104 Ga0157370_10073507 Ga0157370_100735072 255
73 3300025246 Ga0209646_1000014 Ga0209646_1000014299 255
74 3300025935 Ga0207709_10157876 Ga0207709_101578762 255
75 3300031731 Ga0307405_10071564 Ga0307405_100715642 255
76 3300031901 Ga0307406_10000222 Ga0307406_1000022227 255
77 3300031901 Ga0307406_10007027 Ga0307406_100070272 255
78 3300045836 Ga0466958_0112371 Ga0466958_0112371_304_1080 255
79 3300046453 Ga0495627_000642 Ga0495627_000642_25352_26149 255
80 3300048920 Ga0496117_0070789 Ga0496117_0070789_457_1242 255
81 3300048920 Ga0496117_0166542 Ga0496117_0166542_160_945 255
82 3300048921 Ga0496118_0019129 Ga0496118_0019129_4788_5573 255
83 3300048925 Ga0496122_0025598 Ga0496122_0025598_206_982 255
84 3300048925 Ga0496122_0046431 Ga0496122_0046431_1507_2283 255
85 3300048928 Ga0496125_0001836 Ga0496125_0001836_26924_27700 255
86 3300048928 Ga0496125_0130161 Ga0496125_0130161_399_1184 255
87 3300048928 Ga0496125_0229707 Ga0496125_0229707_16_792 255
88 3300048929 Ga0496126_0009535 Ga0496126_0009535_8892_9677 255
89 3300048929 Ga0496126_0136136 Ga0496126_0136136_252_1028 255
90 3300048929 Ga0496126_0194236 Ga0496126_0194236_615_1400 255
91 3300048929 Ga0496126_0273245 Ga0496126_0273245_104_880 255
92 3300049571 Ga0501034_0000527 Ga0501034_0000527_49753_50538 255
93 3300049574 Ga0501038_0005896 Ga0501038_0005896_6310_7086 255
94 3300001979 JGI24740J21852_10030145 JGI24740J21852_100301452 257
95 3300002738 JGI25154J39366_1000478 JGI25154J39366_10004787 257
96 3300003578 Ga0006562J51391_1212240 Ga0006562J51391_12122401 257
97 3300003578 Ga0006562J51391_1212241 Ga0006562J51391_12122412 257
98 3300005327 Ga0070658_10000381 Ga0070658_1000038133 257
99 3300005329 Ga0070683_100823844 Ga0070683_1008238441 257
100 3300005339 Ga0070660_100563189 Ga0070660_1005631891 257
101 3300005366 Ga0070659_100063839 Ga0070659_1000638392 257
102 3300005530 Ga0070679_100601236 Ga0070679_1006012361 257
103 3300005548 Ga0070665_100036458 Ga0070665_1000364582 257
104 3300005563 Ga0068855_100298460 Ga0068855_1002984601 257
105 3300006038 Ga0075365_10007174 Ga0075365_100071742 257
106 3300006038 Ga0075365_10052755 Ga0075365_100527551 257
107 3300006042 Ga0075368_10027944 Ga0075368_100279441 257
108 3300006051 Ga0075364_10030862 Ga0075364_100308622 257
109 3300006051 Ga0075364_10048154 Ga0075364_100481541 257
110 3300006051 Ga0075364_10057997 Ga0075364_100579972 257
111 3300006051 Ga0075364_10095167 Ga0075364_100951672 257
112 3300006051 Ga0075364_10102713 Ga0075364_101027131 257
113 3300006051 Ga0075364_10156826 Ga0075364_101568261 257
114 3300006178 Ga0075367_10042004 Ga0075367_100420043 257
115 3300006186 Ga0075369_10007725 Ga0075369_100077252 257
116 3300006186 Ga0075369_10017418 Ga0075369_100174183 257
117 3300006353 Ga0075370_10054685 Ga0075370_100546852 257
118 3300009093 Ga0105240_10574494 Ga0105240_105744941 257
119 3300009148 Ga0105243_10013535 Ga0105243_100135353 257
120 3300013102 Ga0157371_10000768 Ga0157371_1000076815 257
121 3300013102 Ga0157371_10057740 Ga0157371_100577402 257
122 3300013104 Ga0157370_10005408 Ga0157370_100054086 257
123 3300013104 Ga0157370_10016106 Ga0157370_100161065 257
124 3300013105 Ga0157369_10224239 Ga0157369_102242392 257
125 3300013105 Ga0157369_10421006 Ga0157369_104210062 257
126 3300013250 Ga0171462_1003 Ga0171462_1003391 257
127 3300013307 Ga0157372_10086558 Ga0157372_100865582 257
128 3300013307 Ga0157372_10218099 Ga0157372_102180992 257
129 3300013308 Ga0157375_10580833 Ga0157375_105808331 257
130 3300014325 Ga0163163_10181947 Ga0163163_101819473 257
131 3300014326 Ga0157380_10042016 Ga0157380_100420162 257
132 3300020081 Ga0206354_11188825 Ga0206354_111888251 257
133 3300025246 Ga0209646_1000071 Ga0209646_10000714 257
134 3300025728 Ga0207655_1002843 Ga0207655_100284310 257
135 3300025904 Ga0207647_10026257 Ga0207647_100262572 257
136 3300025904 Ga0207647_10115638 Ga0207647_101156382 257
137 3300025909 Ga0207705_10000001 Ga0207705_10000001754 257
138 3300025909 Ga0207705_10000006 Ga0207705_10000006274 257
139 3300025919 Ga0207657_10146057 Ga0207657_101460572 257
140 3300025932 Ga0207690_10166009 Ga0207690_101660092 257
141 3300025935 Ga0207709_10003301 Ga0207709_100033018 257
142 3300025949 Ga0207667_10028166 Ga0207667_100281665 257
143 3300025949 Ga0207667_10581299 Ga0207667_105812992 257
144 3300026067 Ga0207678_10008331 Ga0207678_100083312 257
145 3300027866 Ga0209813_10022494 Ga0209813_100224942 257
146 3300031727 Ga0316576_10003832 Ga0316576_100038329 257
147 3300031901 Ga0307406_10000595 Ga0307406_100005951 257
148 3300031901 Ga0307406_10000602 Ga0307406_1000060216 257
149 3300031901 Ga0307406_10002086 Ga0307406_100020867 257
150 3300031911 Ga0307412_10175618 Ga0307412_101756182 257
151 3300032004 Ga0307414_10141152 Ga0307414_101411522 257
152 3300032004 Ga0307414_10300355 Ga0307414_103003551 257
153 3300032126 Ga0307415_100387909 Ga0307415_1003879091 257
154 3300035398 Ga0316574_0006284 Ga0316574_0006284_3132_3950 257
155 3300035398 Ga0316574_0060739 Ga0316574_0060739_863_1681 257
156 3300036712 Ga0316584_0161717 Ga0316584_0161717_374_1192 257
157 3300037466 Ga0395898_0099136 Ga0395898_0099136_1387_2160 257
158 3300041507 Ga0451851_1074210 Ga0451851_1074210_205_978 257
159 3300044683 Ga0466965_0018888 Ga0466965_0018888_1091_1864 257
160 3300044765 Ga0466970_0000138 Ga0466970_0000138_32237_33010 257
161 3300044765 Ga0466970_0076714 Ga0466970_0076714_140_913 257
162 3300044765 Ga0466970_0306800 Ga0466970_0306800_22_795 257
163 3300044842 Ga0466957_0031554 Ga0466957_0031554_398_1171 257
164 3300044901 Ga0466960_0008119 Ga0466960_0008119_2052_2825 257
165 3300044901 Ga0466960_0294051 Ga0466960_0294051_109_882 257
166 3300045049 Ga0466959_0116662 Ga0466959_0116662_801_1682 257
167 3300046453 Ga0495627_003655 Ga0495627_003655_3462_4235 257
168 3300046460 Ga0495638_0300101 Ga0495638_0300101_21_794 257
169 3300046530 Ga0495654_0055437 Ga0495654_0055437_452_1225 257
170 3300046539 Ga0495621_0116840 Ga0495621_0116840_11_784 257
171 3300047472 Ga0495686_0167451 Ga0495686_0167451_468_1241 257
172 3300048903 Ga0496100_0024611 Ga0496100_0024611_641_1414 257
173 3300048904 Ga0496101_0066237 Ga0496101_0066237_456_1229 257
174 3300048906 Ga0496103_0055504 Ga0496103_0055504_313_1086 257
175 3300048907 Ga0496104_0170417 Ga0496104_0170417_1279_2052 257
176 3300048908 Ga0496105_0209924 Ga0496105_0209924_434_1207 257
177 3300048912 Ga0496109_0803542 Ga0496109_0803542_70_843 257
178 3300048913 Ga0496110_0158470 Ga0496110_0158470_1249_2022 257
179 3300048913 Ga0496110_0207077 Ga0496110_0207077_254_1027 257
180 3300048914 Ga0496111_0136895 Ga0496111_0136895_44_817 257
181 3300048915 Ga0496112_0035950 Ga0496112_0035950_1487_2260 257
182 3300048916 Ga0496113_0019289 Ga0496113_0019289_1379_2152 257
183 3300048917 Ga0496114_0011754 Ga0496114_0011754_642_1415 257
184 3300048917 Ga0496114_0073761 Ga0496114_0073761_1534_2307 257
185 3300048918 Ga0496115_0031960 Ga0496115_0031960_2106_2879 257
186 3300048918 Ga0496115_0078605 Ga0496115_0078605_153_926 257
187 3300048919 Ga0496116_0138241 Ga0496116_0138241_282_1055 257
188 3300048920 Ga0496117_0000178 Ga0496117_0000178_84595_85374 257
189 3300048920 Ga0496117_0001190 Ga0496117_0001190_3933_4706 257
190 3300048920 Ga0496117_0002845 Ga0496117_0002845_6234_7007 257
191 3300048920 Ga0496117_0004772 Ga0496117_0004772_7260_8033 257
192 3300048920 Ga0496117_0016734 Ga0496117_0016734_270_1043 257
193 3300048921 Ga0496118_0022558 Ga0496118_0022558_4631_5404 257
194 3300048921 Ga0496118_0033851 Ga0496118_0033851_1081_1866 257
195 3300048921 Ga0496118_0049728 Ga0496118_0049728_1800_2573 257
196 3300048922 Ga0496119_0002138 Ga0496119_0002138_18303_19076 257
197 3300048922 Ga0496119_0007690 Ga0496119_0007690_2598_3371 257
198 3300048922 Ga0496119_0040276 Ga0496119_0040276_2195_2968 257
199 3300048922 Ga0496119_0060576 Ga0496119_0060576_60_833 257
200 3300048923 Ga0496120_0002449 Ga0496120_0002449_11872_12645 257
201 3300048924 Ga0496121_0003735 Ga0496121_0003735_18960_19736 257
202 3300048925 Ga0496122_0000031 Ga0496122_0000031_151499_152272 257
203 3300048925 Ga0496122_0000200 Ga0496122_0000200_14068_14841 257
204 3300048925 Ga0496122_0001810 Ga0496122_0001810_29333_30106 257
205 3300048925 Ga0496122_0007941 Ga0496122_0007941_2533_3318 257
206 3300048925 Ga0496122_0017802 Ga0496122_0017802_537_1310 257
207 3300048926 Ga0496123_0000013 Ga0496123_0000013_151509_152282 257
208 3300048926 Ga0496123_0000076 Ga0496123_0000076_179196_179969 257
209 3300048926 Ga0496123_0011988 Ga0496123_0011988_6244_7017 257
210 3300048926 Ga0496123_0021272 Ga0496123_0021272_2786_3571 257
211 3300048926 Ga0496123_0069277 Ga0496123_0069277_23_796 257
212 3300048927 Ga0496124_0010195 Ga0496124_0010195_5786_6559 257
213 3300048927 Ga0496124_0302873 Ga0496124_0302873_370_1143 257
214 3300048928 Ga0496125_0000077 Ga0496125_0000077_78702_79475 257
215 3300048928 Ga0496125_0003349 Ga0496125_0003349_15965_16738 257
216 3300048928 Ga0496125_0003595 Ga0496125_0003595_5022_5795 257
217 3300048928 Ga0496125_0016443 Ga0496125_0016443_3800_4573 257
218 3300048928 Ga0496125_0037508 Ga0496125_0037508_1599_2372 257
219 3300048928 Ga0496125_0038343 Ga0496125_0038343_409_1182 257
220 3300048929 Ga0496126_0000588 Ga0496126_0000588_28546_29334 257
221 3300048929 Ga0496126_0023037 Ga0496126_0023037_1068_1841 257
222 3300048929 Ga0496126_0034650 Ga0496126_0034650_888_1661 257
223 3300048929 Ga0496126_0097032 Ga0496126_0097032_1160_1933 257
224 3300048929 Ga0496126_0352601 Ga0496126_0352601_174_947 257
225 3300049571 Ga0501034_0016989 Ga0501034_0016989_4439_5212 257
226 3300049571 Ga0501034_0053384 Ga0501034_0053384_2694_3467 257
227 3300049574 Ga0501038_0001899 Ga0501038_0001899_304_1089 257
228 3300049574 Ga0501038_0252347 Ga0501038_0252347_101_874 257
229 3300049575 Ga0501039_0153588 Ga0501039_0153588_708_1481 257
230 3300049579 Ga0501043_0353188 Ga0501043_0353188_196_969 257
231 3300049585 Ga0501069_0085005 Ga0501069_0085005_366_1139 257
232 3300049586 Ga0501070_0002592 Ga0501070_0002592_7174_7947 257
233 3300049586 Ga0501070_0055295 Ga0501070_0055295_2477_3250 257
234 3300049587 Ga0501071_0011767 Ga0501071_0011767_2381_3154 257
235 3300050490 nmdc:mga03n38_6323_c1 nmdc:mga03n38_6323_c1_546_1319 257
236 3300050491 nmdc:mga00v17_16634_c2 nmdc:mga00v17_16634_c2_1245_2018 257
237 3300050491 nmdc:mga00v17_29876_c1 nmdc:mga00v17_29876_c1_1689_2462 257
238 3300050491 nmdc:mga00v17_34775_c1 nmdc:mga00v17_34775_c1_495_1268 257
239 3300050491 nmdc:mga00v17_50178_c1 nmdc:mga00v17_50178_c1_1232_2005 257
240 3300050492 nmdc:mga0yw44_2472_c1 nmdc:mga0yw44_2472_c1_1216_1989 257
241 3300050492 nmdc:mga0yw44_6017_c1 nmdc:mga0yw44_6017_c1_4301_5074 257
242 3300050496 nmdc:mga07m45_24120_c1 nmdc:mga07m45_24120_c1_2145_2918 257
243 3300053136 Ga0500559_0105291 Ga0500559_0105291_472_1245 257
244 3300053153 Ga0500616_0000090 Ga0500616_0000090_151499_152272 257
245 3300053153 Ga0500616_0000126 Ga0500616_0000126_121913_122698 257
246 3300053153 Ga0500616_0000782 Ga0500616_0000782_32199_32975 257
247 3300053730 Ga0500645_003968 Ga0500645_003968_3780_4556 257
248 3300053730 Ga0500645_047046 Ga0500645_047046_173_958 257
249 3300054114 Ga0501084_0144989 Ga0501084_0144989_959_1732 257
250 3300059477 Ga0587084_003156 Ga0587084_003156_58_843 257
251 iso_pu_bacteria 2643221575 2643885425 257
252 iso_pu_bacteria 2821268502 2821270018 257
253 iso_pu_bacteria 2919395869 2919396565 257
254 iso_pu_bacteria 2946033335 2946033693 257

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d0o-assembly1.cif.gz_C rdpa dioxygenase holoenzyme 0.8006 153 196
6xwv-assembly1.cif.gz_C crystal structure of drosophila melanogaster cenp-c bound to cal1 0.7819 99 195
6d1o-assembly1.cif.gz_D ft_5 dioxygenase apoenzyme 0.7713 153 196
6d1o-assembly1.cif.gz_A ft_5 dioxygenase apoenzyme 0.7582 153 198
6d1o-assembly1.cif.gz_B ft_5 dioxygenase apoenzyme 0.758 153 198
ID Description Score Start End Superfamily
af_Q9VHP9_1291_1411_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8006 99 195 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7677 98 197 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7587 98 197 2.60.120.10
af_Q9FLT3_18_198_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7536 99 200 2.60.120.10
af_Q8MSC8_116_326_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.743 99 194 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A6J7DUG5-F1-model_v4 Unannotated protein 0.9828 104 248
AF-A0A2S8ZKI0-F1-model_v4 Aspartyl/asparaginy/proline hydroxylase domain-containing protein 0.9773 1 248
AF-A0A150H6V2-F1-model_v4 Uncharacterized protein 0.9741 1 257
AF-A0A6J7JEH8-F1-model_v4 Unannotated protein 0.9726 7 252
AF-A0A2N1JI42-F1-model_v4 Aspartyl/asparaginy/proline hydroxylase domain-containing protein 0.97 1 251

Feature Viewer

pLDDT pTM Quality
90.85 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map