F365309
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 254 | 141 | 201 | 257 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2919395869|2919397646 |
| Length | 253 |
| Sequence | RSHALDETGYVVLDRYDQTTDPAEWFDLEYVPWRSSGITRFAPLASYAGDLECNGFWNHTPPRPDKDGVWIPRQATAAPTLVRRAEEAGANIGRCRVIELQPNTYADAVYNLHQDDNNRLNEEGGWVVRGFLNLTDDPESLLILRSDRFDPATEIRLPLPAGSRIVVDTQRFWHAVWHRGVAPRYALIASWTSGPELDAYISSNHGDPHPVSVHLDEALVEEGQRELHRRIEERRRIFEAQGITMEPPEPLWP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 2 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 3 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 4 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 5 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 6 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 7 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 8 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 9 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 10 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 11 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 12 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 13 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 14 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 15 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 16 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 17 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 18 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 19 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 20 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 21 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 22 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 23 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 24 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 25 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 26 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 27 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 28 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 29 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 30 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 31 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 32 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 33 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 34 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 62 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 73 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 74 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 75 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 76 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 77 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 78 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 79 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 81 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 82 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 83 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 84 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 85 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 86 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 87 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 88 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 89 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 90 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 91 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 98 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 99 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 100 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 101 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 102 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 103 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 104 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 105 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 106 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 107 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 108 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 109 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 110 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 111 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 112 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 113 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 114 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 115 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 116 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 117 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 118 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 119 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 120 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 129 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 130 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 131 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 132 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 133 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 134 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 135 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 136 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 139 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 140 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 141 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.56 |
| Metatranscriptomes | 1.97 |
| Isolates | 20.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.39 |
| Bulb | 0 |
| Endosphere | 12.2 |
| Nodule | 0 |
| Rhizoplane | 6.3 |
| Rhizosphere | 48.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 33.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10030145 | 3300001979 | Bacteria | 1771 |
| 2 | JGI25154J39366_1000478 | 3300002738 | Bacteria | 20885 |
| 3 | Ga0006562J51391_1212240 | 3300003578 | Bacteria | 1951 |
| 4 | Ga0006562J51391_1212241 | 3300003578 | Bacteria | 1890 |
| 5 | Ga0070658_10000381 | 3300005327 | Bacteria | 38709 |
| 6 | Ga0070683_100823844 | 3300005329 | Bacteria | 890 |
| 7 | Ga0070660_100563189 | 3300005339 | Bacteria | 951 |
| 8 | Ga0070659_100063839 | 3300005366 | Bacteria | 2914 |
| 9 | Ga0070679_100601236 | 3300005530 | Bacteria | 1043 |
| 10 | Ga0070665_100036458 | 3300005548 | Bacteria | 4946 |
| 11 | Ga0068855_100298460 | 3300005563 | Bacteria | 1785 |
| 12 | Ga0081540_1042296 | 3300005983 | Bacteria | 2351 |
| 13 | Ga0070717_10250015 | 3300006028 | Bacteria | 1566 |
| 14 | Ga0075365_10007174 | 3300006038 | Bacteria | 6221 |
| 15 | Ga0075365_10052755 | 3300006038 | Bacteria | 2691 |
| 16 | Ga0075368_10027944 | 3300006042 | Bacteria | 2178 |
| 17 | Ga0075364_10030862 | 3300006051 | Bacteria | 3441 |
| 18 | Ga0075364_10048154 | 3300006051 | Bacteria | 2777 |
| 19 | Ga0075364_10055137 | 3300006051 | Bacteria | 2600 |
| 20 | Ga0075364_10057997 | 3300006051 | Bacteria | 2537 |
| 21 | Ga0075364_10095167 | 3300006051 | Bacteria | 1980 |
| 22 | Ga0075364_10102713 | 3300006051 | Bacteria | 1903 |
| 23 | Ga0075364_10156826 | 3300006051 | Bacteria | 1535 |
| 24 | Ga0075364_10305221 | 3300006051 | Bacteria | 1084 |
| 25 | Ga0075367_10042004 | 3300006178 | Bacteria | 2674 |
| 26 | Ga0075369_10007725 | 3300006186 | Bacteria | 4110 |
| 27 | Ga0075369_10017418 | 3300006186 | Bacteria | 2911 |
| 28 | Ga0075370_10054685 | 3300006353 | Bacteria | 2267 |
| 29 | Ga0105240_10574494 | 3300009093 | Bacteria | 1244 |
| 30 | Ga0105243_10013535 | 3300009148 | Bacteria | 6171 |
| 31 | Ga0157371_10000768 | 3300013102 | Bacteria | 37059 |
| 32 | Ga0157371_10057740 | 3300013102 | Bacteria | 2752 |
| 33 | Ga0157370_10005408 | 3300013104 | Bacteria | 14328 |
| 34 | Ga0157370_10016106 | 3300013104 | Bacteria | 7578 |
| 35 | Ga0157370_10073507 | 3300013104 | Bacteria | 3226 |
| 36 | Ga0157369_10224239 | 3300013105 | Bacteria | 1967 |
| 37 | Ga0157369_10421006 | 3300013105 | Bacteria | 1384 |
| 38 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 39 | Ga0157372_10086558 | 3300013307 | Bacteria | 3555 |
| 40 | Ga0157372_10218099 | 3300013307 | Bacteria | 2211 |
| 41 | Ga0157375_10073398 | 3300013308 | Bacteria | 3440 |
| 42 | Ga0157375_10580833 | 3300013308 | Bacteria | 1281 |
| 43 | Ga0163163_10181947 | 3300014325 | Bacteria | 2149 |
| 44 | Ga0157380_10042016 | 3300014326 | Bacteria | 3572 |
| 45 | Ga0206354_11188825 | 3300020081 | Bacteria | 964 |
| 46 | Ga0209646_1000014 | 3300025246 | Bacteria | 550484 |
| 47 | Ga0209646_1000071 | 3300025246 | Bacteria | 228702 |
| 48 | Ga0207655_1002843 | 3300025728 | Bacteria | 13391 |
| 49 | Ga0207647_10026257 | 3300025904 | Bacteria | 3813 |
| 50 | Ga0207647_10115638 | 3300025904 | Bacteria | 1584 |
| 51 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 52 | Ga0207705_10000006 | 3300025909 | Bacteria | 657147 |
| 53 | Ga0207657_10146057 | 3300025919 | Bacteria | 1929 |
| 54 | Ga0207690_10166009 | 3300025932 | Bacteria | 1650 |
| 55 | Ga0207709_10003301 | 3300025935 | Bacteria | 9674 |
| 56 | Ga0207709_10157876 | 3300025935 | Bacteria | 1578 |
| 57 | Ga0207667_10028166 | 3300025949 | Bacteria | 6103 |
| 58 | Ga0207667_10581299 | 3300025949 | Bacteria | 1131 |
| 59 | Ga0207678_10008331 | 3300026067 | Bacteria | 9137 |
| 60 | Ga0209813_10022494 | 3300027866 | Bacteria | 1784 |
| 61 | Ga0268266_10263569 | 3300028379 | Bacteria | 1598 |
| 62 | Ga0316576_10003832 | 3300031727 | Bacteria | 8907 |
| 63 | Ga0316576_10010453 | 3300031727 | Bacteria | 6030 |
| 64 | Ga0316576_10014967 | 3300031727 | Bacteria | 5192 |
| 65 | Ga0316576_10043694 | 3300031727 | Bacteria | 3234 |
| 66 | Ga0316578_10076592 | 3300031728 | Bacteria | 1986 |
| 67 | Ga0307405_10071564 | 3300031731 | Bacteria | 2232 |
| 68 | Ga0307406_10000222 | 3300031901 | Bacteria | 34546 |
| 69 | Ga0307406_10000595 | 3300031901 | Bacteria | 20772 |
| 70 | Ga0307406_10000602 | 3300031901 | Bacteria | 20583 |
| 71 | Ga0307406_10002086 | 3300031901 | Bacteria | 10902 |
| 72 | Ga0307406_10007027 | 3300031901 | Bacteria | 6232 |
| 73 | Ga0307412_10175618 | 3300031911 | Bacteria | 1606 |
| 74 | Ga0307414_10141152 | 3300032004 | Bacteria | 1886 |
| 75 | Ga0307414_10300355 | 3300032004 | Bacteria | 1358 |
| 76 | Ga0307415_100387909 | 3300032126 | Bacteria | 1188 |
| 77 | Ga0316593_10161677 | 3300032168 | Bacteria | 818 |
| 78 | Ga0316574_0004730 | 3300035398 | Bacteria | 7184 |
| 79 | Ga0316574_0006284 | 3300035398 | Bacteria | 6409 |
| 80 | Ga0316574_0008672 | 3300035398 | Bacteria | 5656 |
| 81 | Ga0316574_0057763 | 3300035398 | Bacteria | 2430 |
| 82 | Ga0316574_0060739 | 3300035398 | Bacteria | 2373 |
| 83 | Ga0316584_0161717 | 3300036712 | Bacteria | 1663 |
| 84 | Ga0395898_0099136 | 3300037466 | Bacteria | 2798 |
| 85 | Ga0451793_1814309 | 3300041452 | Bacteria | 1407 |
| 86 | Ga0451851_1074210 | 3300041507 | Bacteria | 1069 |
| 87 | Ga0466965_0018888 | 3300044683 | Bacteria | 3308 |
| 88 | Ga0466970_0000138 | 3300044765 | Bacteria | 33745 |
| 89 | Ga0466970_0076714 | 3300044765 | Bacteria | 1801 |
| 90 | Ga0466970_0306800 | 3300044765 | Bacteria | 896 |
| 91 | Ga0466957_0031554 | 3300044842 | Bacteria | 3167 |
| 92 | Ga0466960_0008119 | 3300044901 | Bacteria | 4289 |
| 93 | Ga0466960_0294051 | 3300044901 | Bacteria | 913 |
| 94 | Ga0466959_0116662 | 3300045049 | Bacteria | 1901 |
| 95 | Ga0466958_0112371 | 3300045836 | Bacteria | 1701 |
| 96 | Ga0495627_000642 | 3300046453 | Bacteria | 27306 |
| 97 | Ga0495627_003655 | 3300046453 | Bacteria | 6675 |
| 98 | Ga0495638_0300101 | 3300046460 | Bacteria | 866 |
| 99 | Ga0495654_0055437 | 3300046530 | Bacteria | 1919 |
| 100 | Ga0495621_0116840 | 3300046539 | Bacteria | 1028 |
| 101 | Ga0495672_0176930 | 3300047320 | Bacteria | 1083 |
| 102 | Ga0495686_0167451 | 3300047472 | Bacteria | 1280 |
| 103 | Ga0496100_0024611 | 3300048903 | Bacteria | 3673 |
| 104 | Ga0496101_0066237 | 3300048904 | Bacteria | 2634 |
| 105 | Ga0496103_0055504 | 3300048906 | Bacteria | 2457 |
| 106 | Ga0496104_0170417 | 3300048907 | Bacteria | 2087 |
| 107 | Ga0496105_0209924 | 3300048908 | Bacteria | 1587 |
| 108 | Ga0496109_0803542 | 3300048912 | Bacteria | 878 |
| 109 | Ga0496110_0158470 | 3300048913 | Bacteria | 2051 |
| 110 | Ga0496110_0207077 | 3300048913 | Bacteria | 1783 |
| 111 | Ga0496111_0136895 | 3300048914 | Bacteria | 1814 |
| 112 | Ga0496112_0035950 | 3300048915 | Bacteria | 4828 |
| 113 | Ga0496113_0019289 | 3300048916 | Bacteria | 4767 |
| 114 | Ga0496114_0011754 | 3300048917 | Bacteria | 7003 |
| 115 | Ga0496114_0073761 | 3300048917 | Bacteria | 2872 |
| 116 | Ga0496115_0031960 | 3300048918 | Bacteria | 4150 |
| 117 | Ga0496115_0078605 | 3300048918 | Bacteria | 2684 |
| 118 | Ga0496116_0138241 | 3300048919 | Bacteria | 1375 |
| 119 | Ga0496117_0000178 | 3300048920 | Bacteria | 131062 |
| 120 | Ga0496117_0001190 | 3300048920 | Bacteria | 39141 |
| 121 | Ga0496117_0002845 | 3300048920 | Bacteria | 21058 |
| 122 | Ga0496117_0004772 | 3300048920 | Bacteria | 14698 |
| 123 | Ga0496117_0016734 | 3300048920 | Bacteria | 6165 |
| 124 | Ga0496117_0070789 | 3300048920 | Bacteria | 2340 |
| 125 | Ga0496117_0166542 | 3300048920 | Bacteria | 1285 |
| 126 | Ga0496118_0019129 | 3300048921 | Bacteria | 6135 |
| 127 | Ga0496118_0022558 | 3300048921 | Bacteria | 5497 |
| 128 | Ga0496118_0033851 | 3300048921 | Bacteria | 4183 |
| 129 | Ga0496118_0049728 | 3300048921 | Bacteria | 3225 |
| 130 | Ga0496119_0002138 | 3300048922 | Bacteria | 22248 |
| 131 | Ga0496119_0007690 | 3300048922 | Bacteria | 9647 |
| 132 | Ga0496119_0040276 | 3300048922 | Bacteria | 2991 |
| 133 | Ga0496119_0060576 | 3300048922 | Bacteria | 2265 |
| 134 | Ga0496120_0002449 | 3300048923 | Bacteria | 18776 |
| 135 | Ga0496121_0003735 | 3300048924 | Bacteria | 21334 |
| 136 | Ga0496122_0000031 | 3300048925 | Bacteria | 329726 |
| 137 | Ga0496122_0000200 | 3300048925 | Bacteria | 133548 |
| 138 | Ga0496122_0001810 | 3300048925 | Bacteria | 32761 |
| 139 | Ga0496122_0007941 | 3300048925 | Bacteria | 11608 |
| 140 | Ga0496122_0017802 | 3300048925 | Bacteria | 6608 |
| 141 | Ga0496122_0025598 | 3300048925 | Bacteria | 5119 |
| 142 | Ga0496122_0046431 | 3300048925 | Bacteria | 3364 |
| 143 | Ga0496123_0000013 | 3300048926 | Bacteria | 439694 |
| 144 | Ga0496123_0000076 | 3300048926 | Bacteria | 194050 |
| 145 | Ga0496123_0011988 | 3300048926 | Bacteria | 7437 |
| 146 | Ga0496123_0021272 | 3300048926 | Bacteria | 5046 |
| 147 | Ga0496123_0069277 | 3300048926 | Bacteria | 2216 |
| 148 | Ga0496124_0010195 | 3300048927 | Bacteria | 9556 |
| 149 | Ga0496124_0302873 | 3300048927 | Bacteria | 1153 |
| 150 | Ga0496125_0000077 | 3300048928 | Bacteria | 232629 |
| 151 | Ga0496125_0001836 | 3300048928 | Bacteria | 29342 |
| 152 | Ga0496125_0003349 | 3300048928 | Bacteria | 19512 |
| 153 | Ga0496125_0003595 | 3300048928 | Bacteria | 18621 |
| 154 | Ga0496125_0016443 | 3300048928 | Bacteria | 7103 |
| 155 | Ga0496125_0037508 | 3300048928 | Bacteria | 4213 |
| 156 | Ga0496125_0038343 | 3300048928 | Bacteria | 4149 |
| 157 | Ga0496125_0130161 | 3300048928 | Bacteria | 1773 |
| 158 | Ga0496125_0229707 | 3300048928 | Bacteria | 1188 |
| 159 | Ga0496126_0000588 | 3300048929 | Bacteria | 68756 |
| 160 | Ga0496126_0009535 | 3300048929 | Bacteria | 10298 |
| 161 | Ga0496126_0023037 | 3300048929 | Bacteria | 6040 |
| 162 | Ga0496126_0034650 | 3300048929 | Bacteria | 4740 |
| 163 | Ga0496126_0097032 | 3300048929 | Bacteria | 2583 |
| 164 | Ga0496126_0136136 | 3300048929 | Bacteria | 2119 |
| 165 | Ga0496126_0194236 | 3300048929 | Bacteria | 1717 |
| 166 | Ga0496126_0273245 | 3300048929 | Bacteria | 1402 |
| 167 | Ga0496126_0352601 | 3300048929 | Bacteria | 1203 |
| 168 | Ga0501034_0000527 | 3300049571 | Bacteria | 61221 |
| 169 | Ga0501034_0016989 | 3300049571 | Bacteria | 7460 |
| 170 | Ga0501034_0028026 | 3300049571 | Bacteria | 5728 |
| 171 | Ga0501034_0053384 | 3300049571 | Bacteria | 4069 |
| 172 | Ga0501038_0001899 | 3300049574 | Bacteria | 19324 |
| 173 | Ga0501038_0005896 | 3300049574 | Bacteria | 11325 |
| 174 | Ga0501038_0252347 | 3300049574 | Bacteria | 1397 |
| 175 | Ga0501039_0153588 | 3300049575 | Bacteria | 1808 |
| 176 | Ga0501043_0353188 | 3300049579 | Bacteria | 1117 |
| 177 | Ga0501069_0068411 | 3300049585 | Bacteria | 1987 |
| 178 | Ga0501069_0085005 | 3300049585 | Bacteria | 1785 |
| 179 | Ga0501070_0002592 | 3300049586 | Bacteria | 15801 |
| 180 | Ga0501070_0011518 | 3300049586 | Bacteria | 7469 |
| 181 | Ga0501070_0055295 | 3300049586 | Bacteria | 3289 |
| 182 | Ga0501071_0000579 | 3300049587 | Bacteria | 18924 |
| 183 | Ga0501071_0011767 | 3300049587 | Bacteria | 5905 |
| 184 | Ga0501083_0117160 | 3300049744 | Bacteria | 1748 |
| 185 | nmdc:mga03n38_6323_c1 | 3300050490 | Bacteria | 4106 |
| 186 | nmdc:mga00v17_16634_c2 | 3300050491 | Bacteria | 2454 |
| 187 | nmdc:mga00v17_29876_c1 | 3300050491 | Bacteria | 3201 |
| 188 | nmdc:mga00v17_34775_c1 | 3300050491 | Bacteria | 2995 |
| 189 | nmdc:mga00v17_50178_c1 | 3300050491 | Bacteria | 2534 |
| 190 | nmdc:mga0yw44_2472_c1 | 3300050492 | Bacteria | 7894 |
| 191 | nmdc:mga0yw44_6017_c1 | 3300050492 | Bacteria | 5811 |
| 192 | nmdc:mga07m45_24120_c1 | 3300050496 | Bacteria | 3010 |
| 193 | Ga0500559_0105291 | 3300053136 | Bacteria | 1303 |
| 194 | Ga0500568_0084657 | 3300053139 | Bacteria | 1201 |
| 195 | Ga0500616_0000090 | 3300053153 | Bacteria | 187734 |
| 196 | Ga0500616_0000126 | 3300053153 | Bacteria | 134967 |
| 197 | Ga0500616_0000782 | 3300053153 | Bacteria | 36564 |
| 198 | Ga0500645_003968 | 3300053730 | Bacteria | 5824 |
| 199 | Ga0500645_047046 | 3300053730 | Bacteria | 1265 |
| 200 | Ga0501084_0144989 | 3300054114 | Bacteria | 2000 |
| 201 | Ga0587084_003156 | 3300059477 | Bacteria | 1787 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047320 | Ga0495672_0176930 | Ga0495672_0176930_74_859 | 240 |
| 2 | 3300006028 | Ga0070717_10250015 | Ga0070717_102500152 | 244 |
| 3 | 3300028379 | Ga0268266_10263569 | Ga0268266_102635692 | 245 |
| 4 | 3300005983 | Ga0081540_1042296 | Ga0081540_10422962 | 246 |
| 5 | 3300035398 | Ga0316574_0004730 | Ga0316574_0004730_6123_6872 | 247 |
| 6 | iso_pu_bacteria | 2643221575 | 2643887268 | 248 |
| 7 | 3300041452 | Ga0451793_1814309 | Ga0451793_1814309_202_954 | 249 |
| 8 | 3300049571 | Ga0501034_0028026 | Ga0501034_0028026_2917_3669 | 249 |
| 9 | 3300049585 | Ga0501069_0068411 | Ga0501069_0068411_962_1714 | 249 |
| 10 | 3300049586 | Ga0501070_0011518 | Ga0501070_0011518_5121_5873 | 249 |
| 11 | 3300049587 | Ga0501071_0000579 | Ga0501071_0000579_1978_2730 | 249 |
| 12 | 3300049744 | Ga0501083_0117160 | Ga0501083_0117160_400_1152 | 249 |
| 13 | iso_pu_bacteria | 2919395869 | 2919397646 | 250 |
| 14 | 3300013308 | Ga0157375_10073398 | Ga0157375_100733982 | 251 |
| 15 | iso_pu_bacteria | 2643221542 | 2643732776 | 251 |
| 16 | iso_pu_bacteria | 2643221553 | 2643784918 | 251 |
| 17 | iso_pu_bacteria | 2643221630 | 2644171566 | 251 |
| 18 | iso_pu_bacteria | 2643221724 | 2644680757 | 251 |
| 19 | iso_pu_bacteria | 2747842429 | 2747954605 | 251 |
| 20 | iso_pu_bacteria | 2852646457 | 2852647744 | 251 |
| 21 | iso_pu_bacteria | 2852663356 | 2852663849 | 251 |
| 22 | iso_pu_bacteria | 2857723135 | 2857726324 | 251 |
| 23 | iso_pu_bacteria | 2945968032 | 2945969018 | 251 |
| 24 | iso_pu_bacteria | 2946080515 | 2946083837 | 251 |
| 25 | iso_pu_bacteria | 8004182704 | 8004184267 | 251 |
| 26 | 3300013308 | Ga0157375_10073398 | Ga0157375_100733983 | 252 |
| 27 | 3300031727 | Ga0316576_10010453 | Ga0316576_100104532 | 252 |
| 28 | 3300031727 | Ga0316576_10014967 | Ga0316576_100149673 | 252 |
| 29 | 3300031727 | Ga0316576_10043694 | Ga0316576_100436942 | 252 |
| 30 | 3300031728 | Ga0316578_10076592 | Ga0316578_100765922 | 252 |
| 31 | 3300032168 | Ga0316593_10161677 | Ga0316593_101616771 | 252 |
| 32 | 3300035398 | Ga0316574_0008672 | Ga0316574_0008672_2176_2940 | 252 |
| 33 | iso_pu_bacteria | 2844852863 | 2844854259 | 252 |
| 34 | iso_pu_bacteria | 8056037122 | 8056039445 | 252 |
| 35 | 3300035398 | Ga0316574_0057763 | Ga0316574_0057763_390_1151 | 253 |
| 36 | 3300053139 | Ga0500568_0084657 | Ga0500568_0084657_404_1168 | 253 |
| 37 | iso_pu_bacteria | 2585428157 | 2588108916 | 253 |
| 38 | iso_pu_bacteria | 2643221542 | 2643733555 | 253 |
| 39 | iso_pu_bacteria | 2643221553 | 2643785950 | 253 |
| 40 | iso_pu_bacteria | 2643221566 | 2643848284 | 253 |
| 41 | iso_pu_bacteria | 2643221597 | 2643995722 | 253 |
| 42 | iso_pu_bacteria | 2643221630 | 2644170130 | 253 |
| 43 | iso_pu_bacteria | 2643221724 | 2644680363 | 253 |
| 44 | iso_pu_bacteria | 2728369380 | 2730229816 | 253 |
| 45 | iso_pu_bacteria | 2728369380 | 2730230825 | 253 |
| 46 | iso_pu_bacteria | 2747842429 | 2747952035 | 253 |
| 47 | iso_pu_bacteria | 2773857759 | 2774384253 | 253 |
| 48 | iso_pu_bacteria | 2773857763 | 2774399528 | 253 |
| 49 | iso_pu_bacteria | 2808606368 | 2808885843 | 253 |
| 50 | iso_pu_bacteria | 2808606447 | 2809227448 | 253 |
| 51 | iso_pu_bacteria | 2833709550 | 2833710966 | 253 |
| 52 | iso_pu_bacteria | 2844852863 | 2844856149 | 253 |
| 53 | iso_pu_bacteria | 2852632344 | 2852634206 | 253 |
| 54 | iso_pu_bacteria | 2852646457 | 2852647387 | 253 |
| 55 | iso_pu_bacteria | 2852663356 | 2852665369 | 253 |
| 56 | iso_pu_bacteria | 2857720070 | 2857720099 | 253 |
| 57 | iso_pu_bacteria | 2857723135 | 2857723993 | 253 |
| 58 | iso_pu_bacteria | 2870628048 | 2870630363 | 253 |
| 59 | iso_pu_bacteria | 2928090899 | 2928092070 | 253 |
| 60 | iso_pu_bacteria | 2945968032 | 2945971870 | 253 |
| 61 | iso_pu_bacteria | 2946041624 | 2946044327 | 253 |
| 62 | iso_pu_bacteria | 2946080515 | 2946080826 | 253 |
| 63 | iso_pu_bacteria | 2977251589 | 2977254163 | 253 |
| 64 | iso_pu_bacteria | 2984580707 | 2984581164 | 253 |
| 65 | iso_pu_bacteria | 8004182704 | 8004185060 | 253 |
| 66 | iso_pu_bacteria | 8045830549 | 8045831600 | 253 |
| 67 | iso_pu_bacteria | 8056037122 | 8056040664 | 253 |
| 68 | iso_pu_bacteria | 8057345674 | 8057347321 | 253 |
| 69 | iso_pu_bacteria | 8057345674 | 8057349456 | 253 |
| 70 | 3300006051 | Ga0075364_10055137 | Ga0075364_100551371 | 255 |
| 71 | 3300006051 | Ga0075364_10305221 | Ga0075364_103052211 | 255 |
| 72 | 3300013104 | Ga0157370_10073507 | Ga0157370_100735072 | 255 |
| 73 | 3300025246 | Ga0209646_1000014 | Ga0209646_1000014299 | 255 |
| 74 | 3300025935 | Ga0207709_10157876 | Ga0207709_101578762 | 255 |
| 75 | 3300031731 | Ga0307405_10071564 | Ga0307405_100715642 | 255 |
| 76 | 3300031901 | Ga0307406_10000222 | Ga0307406_1000022227 | 255 |
| 77 | 3300031901 | Ga0307406_10007027 | Ga0307406_100070272 | 255 |
| 78 | 3300045836 | Ga0466958_0112371 | Ga0466958_0112371_304_1080 | 255 |
| 79 | 3300046453 | Ga0495627_000642 | Ga0495627_000642_25352_26149 | 255 |
| 80 | 3300048920 | Ga0496117_0070789 | Ga0496117_0070789_457_1242 | 255 |
| 81 | 3300048920 | Ga0496117_0166542 | Ga0496117_0166542_160_945 | 255 |
| 82 | 3300048921 | Ga0496118_0019129 | Ga0496118_0019129_4788_5573 | 255 |
| 83 | 3300048925 | Ga0496122_0025598 | Ga0496122_0025598_206_982 | 255 |
| 84 | 3300048925 | Ga0496122_0046431 | Ga0496122_0046431_1507_2283 | 255 |
| 85 | 3300048928 | Ga0496125_0001836 | Ga0496125_0001836_26924_27700 | 255 |
| 86 | 3300048928 | Ga0496125_0130161 | Ga0496125_0130161_399_1184 | 255 |
| 87 | 3300048928 | Ga0496125_0229707 | Ga0496125_0229707_16_792 | 255 |
| 88 | 3300048929 | Ga0496126_0009535 | Ga0496126_0009535_8892_9677 | 255 |
| 89 | 3300048929 | Ga0496126_0136136 | Ga0496126_0136136_252_1028 | 255 |
| 90 | 3300048929 | Ga0496126_0194236 | Ga0496126_0194236_615_1400 | 255 |
| 91 | 3300048929 | Ga0496126_0273245 | Ga0496126_0273245_104_880 | 255 |
| 92 | 3300049571 | Ga0501034_0000527 | Ga0501034_0000527_49753_50538 | 255 |
| 93 | 3300049574 | Ga0501038_0005896 | Ga0501038_0005896_6310_7086 | 255 |
| 94 | 3300001979 | JGI24740J21852_10030145 | JGI24740J21852_100301452 | 257 |
| 95 | 3300002738 | JGI25154J39366_1000478 | JGI25154J39366_10004787 | 257 |
| 96 | 3300003578 | Ga0006562J51391_1212240 | Ga0006562J51391_12122401 | 257 |
| 97 | 3300003578 | Ga0006562J51391_1212241 | Ga0006562J51391_12122412 | 257 |
| 98 | 3300005327 | Ga0070658_10000381 | Ga0070658_1000038133 | 257 |
| 99 | 3300005329 | Ga0070683_100823844 | Ga0070683_1008238441 | 257 |
| 100 | 3300005339 | Ga0070660_100563189 | Ga0070660_1005631891 | 257 |
| 101 | 3300005366 | Ga0070659_100063839 | Ga0070659_1000638392 | 257 |
| 102 | 3300005530 | Ga0070679_100601236 | Ga0070679_1006012361 | 257 |
| 103 | 3300005548 | Ga0070665_100036458 | Ga0070665_1000364582 | 257 |
| 104 | 3300005563 | Ga0068855_100298460 | Ga0068855_1002984601 | 257 |
| 105 | 3300006038 | Ga0075365_10007174 | Ga0075365_100071742 | 257 |
| 106 | 3300006038 | Ga0075365_10052755 | Ga0075365_100527551 | 257 |
| 107 | 3300006042 | Ga0075368_10027944 | Ga0075368_100279441 | 257 |
| 108 | 3300006051 | Ga0075364_10030862 | Ga0075364_100308622 | 257 |
| 109 | 3300006051 | Ga0075364_10048154 | Ga0075364_100481541 | 257 |
| 110 | 3300006051 | Ga0075364_10057997 | Ga0075364_100579972 | 257 |
| 111 | 3300006051 | Ga0075364_10095167 | Ga0075364_100951672 | 257 |
| 112 | 3300006051 | Ga0075364_10102713 | Ga0075364_101027131 | 257 |
| 113 | 3300006051 | Ga0075364_10156826 | Ga0075364_101568261 | 257 |
| 114 | 3300006178 | Ga0075367_10042004 | Ga0075367_100420043 | 257 |
| 115 | 3300006186 | Ga0075369_10007725 | Ga0075369_100077252 | 257 |
| 116 | 3300006186 | Ga0075369_10017418 | Ga0075369_100174183 | 257 |
| 117 | 3300006353 | Ga0075370_10054685 | Ga0075370_100546852 | 257 |
| 118 | 3300009093 | Ga0105240_10574494 | Ga0105240_105744941 | 257 |
| 119 | 3300009148 | Ga0105243_10013535 | Ga0105243_100135353 | 257 |
| 120 | 3300013102 | Ga0157371_10000768 | Ga0157371_1000076815 | 257 |
| 121 | 3300013102 | Ga0157371_10057740 | Ga0157371_100577402 | 257 |
| 122 | 3300013104 | Ga0157370_10005408 | Ga0157370_100054086 | 257 |
| 123 | 3300013104 | Ga0157370_10016106 | Ga0157370_100161065 | 257 |
| 124 | 3300013105 | Ga0157369_10224239 | Ga0157369_102242392 | 257 |
| 125 | 3300013105 | Ga0157369_10421006 | Ga0157369_104210062 | 257 |
| 126 | 3300013250 | Ga0171462_1003 | Ga0171462_1003391 | 257 |
| 127 | 3300013307 | Ga0157372_10086558 | Ga0157372_100865582 | 257 |
| 128 | 3300013307 | Ga0157372_10218099 | Ga0157372_102180992 | 257 |
| 129 | 3300013308 | Ga0157375_10580833 | Ga0157375_105808331 | 257 |
| 130 | 3300014325 | Ga0163163_10181947 | Ga0163163_101819473 | 257 |
| 131 | 3300014326 | Ga0157380_10042016 | Ga0157380_100420162 | 257 |
| 132 | 3300020081 | Ga0206354_11188825 | Ga0206354_111888251 | 257 |
| 133 | 3300025246 | Ga0209646_1000071 | Ga0209646_10000714 | 257 |
| 134 | 3300025728 | Ga0207655_1002843 | Ga0207655_100284310 | 257 |
| 135 | 3300025904 | Ga0207647_10026257 | Ga0207647_100262572 | 257 |
| 136 | 3300025904 | Ga0207647_10115638 | Ga0207647_101156382 | 257 |
| 137 | 3300025909 | Ga0207705_10000001 | Ga0207705_10000001754 | 257 |
| 138 | 3300025909 | Ga0207705_10000006 | Ga0207705_10000006274 | 257 |
| 139 | 3300025919 | Ga0207657_10146057 | Ga0207657_101460572 | 257 |
| 140 | 3300025932 | Ga0207690_10166009 | Ga0207690_101660092 | 257 |
| 141 | 3300025935 | Ga0207709_10003301 | Ga0207709_100033018 | 257 |
| 142 | 3300025949 | Ga0207667_10028166 | Ga0207667_100281665 | 257 |
| 143 | 3300025949 | Ga0207667_10581299 | Ga0207667_105812992 | 257 |
| 144 | 3300026067 | Ga0207678_10008331 | Ga0207678_100083312 | 257 |
| 145 | 3300027866 | Ga0209813_10022494 | Ga0209813_100224942 | 257 |
| 146 | 3300031727 | Ga0316576_10003832 | Ga0316576_100038329 | 257 |
| 147 | 3300031901 | Ga0307406_10000595 | Ga0307406_100005951 | 257 |
| 148 | 3300031901 | Ga0307406_10000602 | Ga0307406_1000060216 | 257 |
| 149 | 3300031901 | Ga0307406_10002086 | Ga0307406_100020867 | 257 |
| 150 | 3300031911 | Ga0307412_10175618 | Ga0307412_101756182 | 257 |
| 151 | 3300032004 | Ga0307414_10141152 | Ga0307414_101411522 | 257 |
| 152 | 3300032004 | Ga0307414_10300355 | Ga0307414_103003551 | 257 |
| 153 | 3300032126 | Ga0307415_100387909 | Ga0307415_1003879091 | 257 |
| 154 | 3300035398 | Ga0316574_0006284 | Ga0316574_0006284_3132_3950 | 257 |
| 155 | 3300035398 | Ga0316574_0060739 | Ga0316574_0060739_863_1681 | 257 |
| 156 | 3300036712 | Ga0316584_0161717 | Ga0316584_0161717_374_1192 | 257 |
| 157 | 3300037466 | Ga0395898_0099136 | Ga0395898_0099136_1387_2160 | 257 |
| 158 | 3300041507 | Ga0451851_1074210 | Ga0451851_1074210_205_978 | 257 |
| 159 | 3300044683 | Ga0466965_0018888 | Ga0466965_0018888_1091_1864 | 257 |
| 160 | 3300044765 | Ga0466970_0000138 | Ga0466970_0000138_32237_33010 | 257 |
| 161 | 3300044765 | Ga0466970_0076714 | Ga0466970_0076714_140_913 | 257 |
| 162 | 3300044765 | Ga0466970_0306800 | Ga0466970_0306800_22_795 | 257 |
| 163 | 3300044842 | Ga0466957_0031554 | Ga0466957_0031554_398_1171 | 257 |
| 164 | 3300044901 | Ga0466960_0008119 | Ga0466960_0008119_2052_2825 | 257 |
| 165 | 3300044901 | Ga0466960_0294051 | Ga0466960_0294051_109_882 | 257 |
| 166 | 3300045049 | Ga0466959_0116662 | Ga0466959_0116662_801_1682 | 257 |
| 167 | 3300046453 | Ga0495627_003655 | Ga0495627_003655_3462_4235 | 257 |
| 168 | 3300046460 | Ga0495638_0300101 | Ga0495638_0300101_21_794 | 257 |
| 169 | 3300046530 | Ga0495654_0055437 | Ga0495654_0055437_452_1225 | 257 |
| 170 | 3300046539 | Ga0495621_0116840 | Ga0495621_0116840_11_784 | 257 |
| 171 | 3300047472 | Ga0495686_0167451 | Ga0495686_0167451_468_1241 | 257 |
| 172 | 3300048903 | Ga0496100_0024611 | Ga0496100_0024611_641_1414 | 257 |
| 173 | 3300048904 | Ga0496101_0066237 | Ga0496101_0066237_456_1229 | 257 |
| 174 | 3300048906 | Ga0496103_0055504 | Ga0496103_0055504_313_1086 | 257 |
| 175 | 3300048907 | Ga0496104_0170417 | Ga0496104_0170417_1279_2052 | 257 |
| 176 | 3300048908 | Ga0496105_0209924 | Ga0496105_0209924_434_1207 | 257 |
| 177 | 3300048912 | Ga0496109_0803542 | Ga0496109_0803542_70_843 | 257 |
| 178 | 3300048913 | Ga0496110_0158470 | Ga0496110_0158470_1249_2022 | 257 |
| 179 | 3300048913 | Ga0496110_0207077 | Ga0496110_0207077_254_1027 | 257 |
| 180 | 3300048914 | Ga0496111_0136895 | Ga0496111_0136895_44_817 | 257 |
| 181 | 3300048915 | Ga0496112_0035950 | Ga0496112_0035950_1487_2260 | 257 |
| 182 | 3300048916 | Ga0496113_0019289 | Ga0496113_0019289_1379_2152 | 257 |
| 183 | 3300048917 | Ga0496114_0011754 | Ga0496114_0011754_642_1415 | 257 |
| 184 | 3300048917 | Ga0496114_0073761 | Ga0496114_0073761_1534_2307 | 257 |
| 185 | 3300048918 | Ga0496115_0031960 | Ga0496115_0031960_2106_2879 | 257 |
| 186 | 3300048918 | Ga0496115_0078605 | Ga0496115_0078605_153_926 | 257 |
| 187 | 3300048919 | Ga0496116_0138241 | Ga0496116_0138241_282_1055 | 257 |
| 188 | 3300048920 | Ga0496117_0000178 | Ga0496117_0000178_84595_85374 | 257 |
| 189 | 3300048920 | Ga0496117_0001190 | Ga0496117_0001190_3933_4706 | 257 |
| 190 | 3300048920 | Ga0496117_0002845 | Ga0496117_0002845_6234_7007 | 257 |
| 191 | 3300048920 | Ga0496117_0004772 | Ga0496117_0004772_7260_8033 | 257 |
| 192 | 3300048920 | Ga0496117_0016734 | Ga0496117_0016734_270_1043 | 257 |
| 193 | 3300048921 | Ga0496118_0022558 | Ga0496118_0022558_4631_5404 | 257 |
| 194 | 3300048921 | Ga0496118_0033851 | Ga0496118_0033851_1081_1866 | 257 |
| 195 | 3300048921 | Ga0496118_0049728 | Ga0496118_0049728_1800_2573 | 257 |
| 196 | 3300048922 | Ga0496119_0002138 | Ga0496119_0002138_18303_19076 | 257 |
| 197 | 3300048922 | Ga0496119_0007690 | Ga0496119_0007690_2598_3371 | 257 |
| 198 | 3300048922 | Ga0496119_0040276 | Ga0496119_0040276_2195_2968 | 257 |
| 199 | 3300048922 | Ga0496119_0060576 | Ga0496119_0060576_60_833 | 257 |
| 200 | 3300048923 | Ga0496120_0002449 | Ga0496120_0002449_11872_12645 | 257 |
| 201 | 3300048924 | Ga0496121_0003735 | Ga0496121_0003735_18960_19736 | 257 |
| 202 | 3300048925 | Ga0496122_0000031 | Ga0496122_0000031_151499_152272 | 257 |
| 203 | 3300048925 | Ga0496122_0000200 | Ga0496122_0000200_14068_14841 | 257 |
| 204 | 3300048925 | Ga0496122_0001810 | Ga0496122_0001810_29333_30106 | 257 |
| 205 | 3300048925 | Ga0496122_0007941 | Ga0496122_0007941_2533_3318 | 257 |
| 206 | 3300048925 | Ga0496122_0017802 | Ga0496122_0017802_537_1310 | 257 |
| 207 | 3300048926 | Ga0496123_0000013 | Ga0496123_0000013_151509_152282 | 257 |
| 208 | 3300048926 | Ga0496123_0000076 | Ga0496123_0000076_179196_179969 | 257 |
| 209 | 3300048926 | Ga0496123_0011988 | Ga0496123_0011988_6244_7017 | 257 |
| 210 | 3300048926 | Ga0496123_0021272 | Ga0496123_0021272_2786_3571 | 257 |
| 211 | 3300048926 | Ga0496123_0069277 | Ga0496123_0069277_23_796 | 257 |
| 212 | 3300048927 | Ga0496124_0010195 | Ga0496124_0010195_5786_6559 | 257 |
| 213 | 3300048927 | Ga0496124_0302873 | Ga0496124_0302873_370_1143 | 257 |
| 214 | 3300048928 | Ga0496125_0000077 | Ga0496125_0000077_78702_79475 | 257 |
| 215 | 3300048928 | Ga0496125_0003349 | Ga0496125_0003349_15965_16738 | 257 |
| 216 | 3300048928 | Ga0496125_0003595 | Ga0496125_0003595_5022_5795 | 257 |
| 217 | 3300048928 | Ga0496125_0016443 | Ga0496125_0016443_3800_4573 | 257 |
| 218 | 3300048928 | Ga0496125_0037508 | Ga0496125_0037508_1599_2372 | 257 |
| 219 | 3300048928 | Ga0496125_0038343 | Ga0496125_0038343_409_1182 | 257 |
| 220 | 3300048929 | Ga0496126_0000588 | Ga0496126_0000588_28546_29334 | 257 |
| 221 | 3300048929 | Ga0496126_0023037 | Ga0496126_0023037_1068_1841 | 257 |
| 222 | 3300048929 | Ga0496126_0034650 | Ga0496126_0034650_888_1661 | 257 |
| 223 | 3300048929 | Ga0496126_0097032 | Ga0496126_0097032_1160_1933 | 257 |
| 224 | 3300048929 | Ga0496126_0352601 | Ga0496126_0352601_174_947 | 257 |
| 225 | 3300049571 | Ga0501034_0016989 | Ga0501034_0016989_4439_5212 | 257 |
| 226 | 3300049571 | Ga0501034_0053384 | Ga0501034_0053384_2694_3467 | 257 |
| 227 | 3300049574 | Ga0501038_0001899 | Ga0501038_0001899_304_1089 | 257 |
| 228 | 3300049574 | Ga0501038_0252347 | Ga0501038_0252347_101_874 | 257 |
| 229 | 3300049575 | Ga0501039_0153588 | Ga0501039_0153588_708_1481 | 257 |
| 230 | 3300049579 | Ga0501043_0353188 | Ga0501043_0353188_196_969 | 257 |
| 231 | 3300049585 | Ga0501069_0085005 | Ga0501069_0085005_366_1139 | 257 |
| 232 | 3300049586 | Ga0501070_0002592 | Ga0501070_0002592_7174_7947 | 257 |
| 233 | 3300049586 | Ga0501070_0055295 | Ga0501070_0055295_2477_3250 | 257 |
| 234 | 3300049587 | Ga0501071_0011767 | Ga0501071_0011767_2381_3154 | 257 |
| 235 | 3300050490 | nmdc:mga03n38_6323_c1 | nmdc:mga03n38_6323_c1_546_1319 | 257 |
| 236 | 3300050491 | nmdc:mga00v17_16634_c2 | nmdc:mga00v17_16634_c2_1245_2018 | 257 |
| 237 | 3300050491 | nmdc:mga00v17_29876_c1 | nmdc:mga00v17_29876_c1_1689_2462 | 257 |
| 238 | 3300050491 | nmdc:mga00v17_34775_c1 | nmdc:mga00v17_34775_c1_495_1268 | 257 |
| 239 | 3300050491 | nmdc:mga00v17_50178_c1 | nmdc:mga00v17_50178_c1_1232_2005 | 257 |
| 240 | 3300050492 | nmdc:mga0yw44_2472_c1 | nmdc:mga0yw44_2472_c1_1216_1989 | 257 |
| 241 | 3300050492 | nmdc:mga0yw44_6017_c1 | nmdc:mga0yw44_6017_c1_4301_5074 | 257 |
| 242 | 3300050496 | nmdc:mga07m45_24120_c1 | nmdc:mga07m45_24120_c1_2145_2918 | 257 |
| 243 | 3300053136 | Ga0500559_0105291 | Ga0500559_0105291_472_1245 | 257 |
| 244 | 3300053153 | Ga0500616_0000090 | Ga0500616_0000090_151499_152272 | 257 |
| 245 | 3300053153 | Ga0500616_0000126 | Ga0500616_0000126_121913_122698 | 257 |
| 246 | 3300053153 | Ga0500616_0000782 | Ga0500616_0000782_32199_32975 | 257 |
| 247 | 3300053730 | Ga0500645_003968 | Ga0500645_003968_3780_4556 | 257 |
| 248 | 3300053730 | Ga0500645_047046 | Ga0500645_047046_173_958 | 257 |
| 249 | 3300054114 | Ga0501084_0144989 | Ga0501084_0144989_959_1732 | 257 |
| 250 | 3300059477 | Ga0587084_003156 | Ga0587084_003156_58_843 | 257 |
| 251 | iso_pu_bacteria | 2643221575 | 2643885425 | 257 |
| 252 | iso_pu_bacteria | 2821268502 | 2821270018 | 257 |
| 253 | iso_pu_bacteria | 2919395869 | 2919396565 | 257 |
| 254 | iso_pu_bacteria | 2946033335 | 2946033693 | 257 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6d0o-assembly1.cif.gz_C | rdpa dioxygenase holoenzyme | 0.8006 | 153 | 196 |
| 6xwv-assembly1.cif.gz_C | crystal structure of drosophila melanogaster cenp-c bound to cal1 | 0.7819 | 99 | 195 |
| 6d1o-assembly1.cif.gz_D | ft_5 dioxygenase apoenzyme | 0.7713 | 153 | 196 |
| 6d1o-assembly1.cif.gz_A | ft_5 dioxygenase apoenzyme | 0.7582 | 153 | 198 |
| 6d1o-assembly1.cif.gz_B | ft_5 dioxygenase apoenzyme | 0.758 | 153 | 198 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VHP9_1291_1411_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8006 | 99 | 195 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7677 | 98 | 197 | 2.60.120.10 |
| af_E7FAC3_1039_1126_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7587 | 98 | 197 | 2.60.120.10 |
| af_Q9FLT3_18_198_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7536 | 99 | 200 | 2.60.120.10 |
| af_Q8MSC8_116_326_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.743 | 99 | 194 | 2.60.120.650 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J7DUG5-F1-model_v4 | Unannotated protein | 0.9828 | 104 | 248 |
|
| AF-A0A2S8ZKI0-F1-model_v4 | Aspartyl/asparaginy/proline hydroxylase domain-containing protein | 0.9773 | 1 | 248 |
|
| AF-A0A150H6V2-F1-model_v4 | Uncharacterized protein | 0.9741 | 1 | 257 |
|
| AF-A0A6J7JEH8-F1-model_v4 | Unannotated protein | 0.9726 | 7 | 252 |
|
| AF-A0A2N1JI42-F1-model_v4 | Aspartyl/asparaginy/proline hydroxylase domain-containing protein | 0.97 | 1 | 251 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar