F365008

General Info

Members Datasets Scaffolds Average Seq Length
254 199 508 313

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10026708|Ga0307414_100267082
Length 350
Sequence MMRRFLSPSRAPLPHASSTIAPRKHASMSRLGSLLTPLALIAALVPLPAAPQDWPSKPMRMIVPYPPGGPTDLLGRVVGEGLQAALGQPVVIENRAGAAGNIGVGQAARAEPDGYTFVVVPTGNIAVNPTLFKDLPYKASDLAPVTMMAMVENVLVVSPKVEAKSLKELLALAGQKPGILTFGSPGAGSQAHLAGELLELEAGVDLIHVPYKGIAPAVNDLLGGQITMMFAQMSSALPHVQAGKLRAIAVASLKRSPAAPDLPTVAEQGFPGFEAVSWYALMTPTGTPRDVIAKVASETSRIVNQPDNRKKFAGLGMAPVGNRPDELAATIDAETKRWVDVIRKQDIKVD

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
126 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
127 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
128 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
129 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
133 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
137 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
187 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
188 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
189 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
190 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
191 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 2643221736 Bosea sp. Root483D1 Isolate Unclassified
197 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
198 2904456579 Variovorax sp. 2002 Isolate Unclassified
199 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 0
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.81
Nodule 0
Rhizoplane 3.54
Rhizosphere 80.31
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10026708 3300032004 Bacteria 3720
2 Ga0065165_1000072 3300005262 Bacteria 165049
3 Ga0065707_10108034 3300005295 Bacteria 2527
4 Ga0070658_10043490 3300005327 Bacteria 3628
5 Ga0070658_10071994 3300005327 Bacteria 2832
6 Ga0070658_10217506 3300005327 Bacteria 1615
7 Ga0070658_10219823 3300005327 Bacteria 1606
8 Ga0070676_10165344 3300005328 Bacteria 1427
9 Ga0070690_100000357 3300005330 Bacteria 23358
10 Ga0070670_100058744 3300005331 Bacteria 3302
11 Ga0070670_100259169 3300005331 Bacteria 1516
12 Ga0068869_100072556 3300005334 Bacteria 2551
13 Ga0070682_100002476 3300005337 Bacteria 10198
14 Ga0068868_100000484 3300005338 Bacteria 26446
15 Ga0068868_100402770 3300005338 Bacteria 1181
16 Ga0070689_100000576 3300005340 Bacteria 22068
17 Ga0070687_100000687 3300005343 Bacteria 11289
18 Ga0070692_10003250 3300005345 Bacteria 6549
19 Ga0070675_100056068 3300005354 Bacteria 3246
20 Ga0070675_100089336 3300005354 Bacteria 2580
21 Ga0070671_100286100 3300005355 Bacteria 1402
22 Ga0070674_100011829 3300005356 Bacteria 5330
23 Ga0070674_100176902 3300005356 Bacteria 1631
24 Ga0070673_100039951 3300005364 Bacteria 3595
25 Ga0070673_100121693 3300005364 Bacteria 2178
26 Ga0070688_100021650 3300005365 Bacteria 3758
27 Ga0070709_10082209 3300005434 Bacteria 2104
28 Ga0070714_100498724 3300005435 Bacteria 1161
29 Ga0070713_100552228 3300005436 Bacteria 1091
30 Ga0070701_10006484 3300005438 Bacteria 4929
31 Ga0070700_100000930 3300005441 Bacteria 14451
32 Ga0070694_100005653 3300005444 Bacteria 7579
33 Ga0070681_10005984 3300005458 Bacteria 11786
34 Ga0070681_10028968 3300005458 Bacteria 5562
35 Ga0068867_100003498 3300005459 Bacteria 11044
36 Ga0070707_100069900 3300005468 Bacteria 3381
37 Ga0070684_100255153 3300005535 Bacteria 1603
38 Ga0070697_100020602 3300005536 Bacteria 5218
39 Ga0068853_100059540 3300005539 Bacteria 3300
40 Ga0068853_100108586 3300005539 Bacteria 2462
41 Ga0070686_100002110 3300005544 Bacteria 10969
42 Ga0070695_100002659 3300005545 Bacteria 10337
43 Ga0070696_100000052 3300005546 Bacteria 53820
44 Ga0070696_100002476 3300005546 Bacteria 12242
45 Ga0070693_100000236 3300005547 Bacteria 25789
46 Ga0070704_100004441 3300005549 Bacteria 8098
47 Ga0068855_100029595 3300005563 Bacteria 6546
48 Ga0068855_100042763 3300005563 Bacteria 5368
49 Ga0068855_100166565 3300005563 Bacteria 2498
50 Ga0068857_100426003 3300005577 Bacteria 1238
51 Ga0068854_100001760 3300005578 Bacteria 13188
52 Ga0068856_100047785 3300005614 Bacteria 4217
53 Ga0068856_100089222 3300005614 Bacteria 3066
54 Ga0070702_100001096 3300005615 Bacteria 10836
55 Ga0068852_100101664 3300005616 Bacteria 2596
56 Ga0068859_100006853 3300005617 Bacteria 11573
57 Ga0068859_100112850 3300005617 Bacteria 2781
58 Ga0068859_100198500 3300005617 Bacteria 2090
59 Ga0068864_100034410 3300005618 Bacteria 4309
60 Ga0068866_10001390 3300005718 Bacteria 10430
61 Ga0068861_100000164 3300005719 Bacteria 34852
62 Ga0068870_10129399 3300005840 Bacteria 1465
63 Ga0068860_100447141 3300005843 Bacteria 1285
64 Ga0068862_100005316 3300005844 Bacteria 10787
65 Ga0081538_10012460 3300005981 Bacteria 6814
66 Ga0075365_10003771 3300006038 Bacteria 7890
67 Ga0075365_10060065 3300006038 Bacteria 2535
68 Ga0075368_10005259 3300006042 Bacteria 4443
69 Ga0075363_100015137 3300006048 Bacteria 3785
70 Ga0075364_10113728 3300006051 Bacteria 1808
71 Ga0075364_10273410 3300006051 Unclassified 1149
72 Ga0075366_10017401 3300006195 Bacteria 4136
73 Ga0097621_100001366 3300006237 Bacteria 16793
74 Ga0075370_10054492 3300006353 Bacteria 2271
75 Ga0068871_100017248 3300006358 Bacteria 5459
76 Ga0075428_100002813 3300006844 Bacteria 18944
77 Ga0075428_100130439 3300006844 Bacteria 2735
78 Ga0075431_100411866 3300006847 Bacteria 1352
79 Ga0075431_100465998 3300006847 Bacteria 1258
80 Ga0075433_10304129 3300006852 Bacteria 1412
81 Ga0075429_100003591 3300006880 Bacteria 13219
82 Ga0068865_100000130 3300006881 Bacteria 38946
83 Ga0075436_100114108 3300006914 Bacteria 1886
84 Ga0097620_100006853 3300006931 Bacteria 11573
85 Ga0097620_100112849 3300006931 Bacteria 2781
86 Ga0097620_100198511 3300006931 Bacteria 2090
87 Ga0075435_100096263 3300007076 Bacteria 2448
88 Ga0105240_10102471 3300009093 Bacteria 3478
89 Ga0105240_10312404 3300009093 Bacteria 1794
90 Ga0105245_10009465 3300009098 Bacteria 8498
91 Ga0105247_10033666 3300009101 Bacteria 3118
92 Ga0114129_10095145 3300009147 Bacteria 4125
93 Ga0114129_10438615 3300009147 Bacteria 1715
94 Ga0105243_10011003 3300009148 Bacteria 6841
95 Ga0105241_10063339 3300009174 Bacteria 2853
96 Ga0105242_10000432 3300009176 Bacteria 33401
97 Ga0105249_10015834 3300009553 Bacteria 6682
98 Ga0105239_10048614 3300010375 Bacteria 4651
99 Ga0157370_10288016 3300013104 Bacteria 1517
100 Ga0157369_10004796 3300013105 Bacteria 15899
101 Ga0157378_10000467 3300013297 Bacteria 38541
102 Ga0157372_10007345 3300013307 Bacteria 11724
103 Ga0157380_10226277 3300014326 Bacteria 1677
104 Ga0157380_10238642 3300014326 Bacteria 1638
105 Ga0182008_10091467 3300014497 Bacteria 1500
106 Ga0157377_10144199 3300014745 Bacteria 1466
107 Ga0157379_10237540 3300014968 Bacteria 1653
108 Ga0157376_10025257 3300014969 Bacteria 4678
109 Ga0157376_10181016 3300014969 Bacteria 1927
110 Ga0157376_10241647 3300014969 Bacteria 1682
111 Ga0182006_1010212 3300015261 Bacteria 4184
112 Ga0163161_10042540 3300017792 Bacteria 3268
113 Ga0209130_1000125 3300025284 Bacteria 124425
114 Ga0209025_1001183 3300025294 Bacteria 36933
115 Ga0207653_10008565 3300025885 Bacteria 3186
116 Ga0207710_10009391 3300025900 Bacteria 4117
117 Ga0207647_10125542 3300025904 Bacteria 1510
118 Ga0207705_10016767 3300025909 Bacteria 5246
119 Ga0207705_10047023 3300025909 Bacteria 3102
120 Ga0207705_10173928 3300025909 Bacteria 1622
121 Ga0207705_10368222 3300025909 Bacteria 1109
122 Ga0207707_10087867 3300025912 Bacteria 2715
123 Ga0207695_10073864 3300025913 Bacteria 3473
124 Ga0207660_10005881 3300025917 Bacteria 7966
125 Ga0207662_10015548 3300025918 Bacteria 4283
126 Ga0207652_10230025 3300025921 Bacteria 1671
127 Ga0207681_10225402 3300025923 Bacteria 1452
128 Ga0207659_10045137 3300025926 Bacteria 3105
129 Ga0207659_10364445 3300025926 Bacteria 1202
130 Ga0207687_10069248 3300025927 Bacteria 2516
131 Ga0207700_10452825 3300025928 Bacteria 1131
132 Ga0207644_10099918 3300025931 Bacteria 2178
133 Ga0207709_10006514 3300025935 Bacteria 6559
134 Ga0207709_10051078 3300025935 Bacteria 2532
135 Ga0207711_10064101 3300025941 Bacteria 3173
136 Ga0207689_10000453 3300025942 Bacteria 38540
137 Ga0207689_10055219 3300025942 Bacteria 3269
138 Ga0207661_10350112 3300025944 Bacteria 1333
139 Ga0207667_10081012 3300025949 Bacteria 3363
140 Ga0207667_10157543 3300025949 Bacteria 2336
141 Ga0207651_10025998 3300025960 Bacteria 3649
142 Ga0207712_10044215 3300025961 Bacteria 3077
143 Ga0207677_10003666 3300026023 Bacteria 8155
144 Ga0207703_10003378 3300026035 Bacteria 13408
145 Ga0207639_10112325 3300026041 Bacteria 2223
146 Ga0207639_10114971 3300026041 Bacteria 2200
147 Ga0207708_10000727 3300026075 Bacteria 24747
148 Ga0207702_10007151 3300026078 Bacteria 9551
149 Ga0207702_10113521 3300026078 Bacteria 2413
150 Ga0207648_10036848 3300026089 Bacteria 4308
151 Ga0207648_10521161 3300026089 Bacteria 1089
152 Ga0207676_10191112 3300026095 Bacteria 1801
153 Ga0207675_100000474 3300026118 Bacteria 39052
154 Ga0207675_100058268 3300026118 Bacteria 3605
155 Ga0207675_100321404 3300026118 Bacteria 1511
156 Ga0209813_10009477 3300027866 Bacteria 2492
157 Ga0207428_10001885 3300027907 Bacteria 21329
158 Ga0268265_10128849 3300028380 Bacteria 2099
159 Ga0268264_10007305 3300028381 Bacteria 9240
160 Ga0307511_10000065 3300030521 Bacteria 88859
161 Ga0307408_100006771 3300031548 Bacteria 7597
162 Ga0307408_100057967 3300031548 Bacteria 2814
163 Ga0307408_100373409 3300031548 Bacteria 1217
164 Ga0307514_10004320 3300031649 Bacteria 13107
165 Ga0307406_10000768 3300031901 Bacteria 18002
166 Ga0307507_10204772 3300033179 Bacteria 1358
167 Ga0373958_0003570 3300034819 Bacteria 2252
168 Ga0373938_0005845 3300034957 Bacteria 2105
169 Ga0373928_0003206 3300035084 Bacteria 3133
170 Ga0373940_0005939 3300035088 Bacteria 2678
171 Ga0373949_0009525 3300035090 Bacteria 2127
172 Ga0373951_0005115 3300035091 Bacteria 3065
173 Ga0373952_0007180 3300035092 Bacteria 2081
174 Ga0373932_0007279 3300035112 Bacteria 2633
175 Ga0373939_0001437 3300035114 Bacteria 5762
176 Ga0373941_0002727 3300035115 Bacteria 3918
177 Ga0373942_0007941 3300035207 Bacteria 2466
178 Ga0373961_0028997 3300035241 Bacteria 1530
179 Ga0373962_0015105 3300035242 Bacteria 1975
180 Ga0373931_0002175 3300035691 Bacteria 8642
181 Ga0373931_0033624 3300035691 Bacteria 2658
182 Ga0395900_0011643 3300037418 Bacteria 8998
183 Ga0395900_0081711 3300037418 Bacteria 3320
184 Ga0395900_0283208 3300037418 Bacteria 1649
185 Ga0395898_0002097 3300037466 Bacteria 24778
186 Ga0395898_0012292 3300037466 Bacteria 8854
187 Ga0395898_0103558 3300037466 Bacteria 2731
188 Ga0395905_0080561 3300037471 Bacteria 3051
189 Ga0395905_0104817 3300037471 Bacteria 2655
190 Ga0395905_0237478 3300037471 Bacteria 1703
191 Ga0436364_0967224 3300037853 Bacteria 1607
192 Ga0436364_1027859 3300037853 Bacteria 2910
193 Ga0436365_1182449 3300039437 Bacteria 1734
194 Ga0439453_0000034 3300041408 Bacteria 9062
195 Ga0451577_0238951 3300042876 Bacteria 1644
196 Ga0439440_0014034 3300042993 Bacteria 1725
197 Ga0466965_0119793 3300044683 Bacteria 1358
198 Ga0466957_0253644 3300044842 Bacteria 1170
199 Ga0466958_0141980 3300045836 Bacteria 1512
200 Ga0466967_0114618 3300045976 Bacteria 2481
201 Ga0495580_0010905 3300046472 Bacteria 7050
202 Ga0495594_0008192 3300046499 Bacteria 5379
203 Ga0495643_0033462 3300046522 Bacteria 2844
204 Ga0495666_0001115 3300046526 Bacteria 12849
205 Ga0495665_0034729 3300046531 Bacteria 2697
206 Ga0495615_0006992 3300048090 Bacteria 2121
207 Ga0496100_0464370 3300048903 Unclassified 972
208 Ga0496101_0335474 3300048904 Bacteria 1187
209 Ga0496102_0173120 3300048905 Bacteria 2032
210 Ga0496102_0327511 3300048905 Bacteria 1443
211 Ga0496106_0120593 3300048909 Bacteria 2049
212 Ga0496108_0310002 3300048911 Bacteria 1375
213 Ga0496112_0080260 3300048915 Bacteria 3226
214 Ga0496112_0546707 3300048915 Bacteria 1092
215 Ga0496114_0096903 3300048917 Bacteria 2512
216 Ga0496117_0037891 3300048920 Bacteria 3585
217 Ga0496122_0031454 3300048925 Bacteria 4416
218 Ga0496126_0120507 3300048929 Bacteria 2276
219 Ga0501075_0269628 3300049591 Bacteria 1297
220 nmdc:mga03683_11834_c1 3300050489 Bacteria 3171
221 nmdc:mga03n38_12932_c1 3300050490 Bacteria 3157
222 nmdc:mga00v17_50717_c1 3300050491 Bacteria 2523
223 nmdc:mga0yw44_12020_c1 3300050492 Bacteria 4496
224 nmdc:mga0yw44_250794_c1 3300050492 Unclassified 1178
225 nmdc:mga0k408_6686_c1 3300050493 Bacteria 6147
226 nmdc:mga06z11_55249_c1 3300050494 Bacteria 2050
227 nmdc:mga04h51_25835_c1 3300050495 Bacteria 1812
228 nmdc:mga07m45_22820_c2 3300050496 Bacteria 2857
229 nmdc:mga05p37_80711_c1 3300050507 Bacteria 4007
230 nmdc:mga09592_1711_c1 3300050508 Bacteria 17663
231 nmdc:mga06r32_101109_c1 3300050510 Bacteria 2829
232 nmdc:mga06r32_345544_c1 3300050510 Bacteria 1472
233 nmdc:mga08y16_238340_c1 3300050511 Bacteria 1881
234 nmdc:mga08y16_36917_c1 3300050511 Bacteria 5132
235 nmdc:mga08x19_75423_c1 3300050514 Bacteria 2205
236 nmdc:mga0a205_332734_c1 3300050515 Bacteria 1388
237 Ga0495601_0039970 3300053077 Bacteria 2938
238 Ga0495595_0020798 3300053084 Bacteria 2859
239 Ga0495619_0124925 3300053085 Bacteria 1765
240 Ga0500646_0015287 3300053090 Bacteria 1997
241 Ga0500595_005455 3300053119 Bacteria 5547
242 Ga0500608_087858 3300053122 Bacteria 1458
243 Ga0500652_000017 3300053131 Bacteria 121760
244 Ga0500561_0009289 3300053137 Bacteria 1990
245 Ga0500604_0002673 3300053151 Bacteria 4848
246 Ga0500622_0009319 3300053156 Bacteria 5441
247 Ga0500636_0001607 3300053177 Bacteria 12313
248 Ga0500636_0012636 3300053177 Bacteria 4950
249 Ga0501084_0076599 3300054114 Bacteria 2804
250 Ga0501082_0448763 3300060353 Unclassified 1127
251 2644747208 2643221736 Bacteria 6608466
252 2904451513 2904449895 Bacteria 6927402
253 2904458370 2904456579 Bacteria 6819253
254 2945974793 2945972063 Bacteria 6086495
255 Ga0307414_10026708
256 Ga0065165_1000072
257 Ga0065707_10108034
258 Ga0070658_10043490
259 Ga0070658_10071994
260 Ga0070658_10217506
261 Ga0070658_10219823
262 Ga0070676_10165344
263 Ga0070690_100000357
264 Ga0070670_100058744
265 Ga0070670_100259169
266 Ga0068869_100072556
267 Ga0070682_100002476
268 Ga0068868_100000484
269 Ga0068868_100402770
270 Ga0070689_100000576
271 Ga0070687_100000687
272 Ga0070692_10003250
273 Ga0070675_100056068
274 Ga0070675_100089336
275 Ga0070671_100286100
276 Ga0070674_100011829
277 Ga0070674_100176902
278 Ga0070673_100039951
279 Ga0070673_100121693
280 Ga0070688_100021650
281 Ga0070709_10082209
282 Ga0070714_100498724
283 Ga0070713_100552228
284 Ga0070701_10006484
285 Ga0070700_100000930
286 Ga0070694_100005653
287 Ga0070681_10005984
288 Ga0070681_10028968
289 Ga0068867_100003498
290 Ga0070707_100069900
291 Ga0070684_100255153
292 Ga0070697_100020602
293 Ga0068853_100059540
294 Ga0068853_100108586
295 Ga0070686_100002110
296 Ga0070695_100002659
297 Ga0070696_100000052
298 Ga0070696_100002476
299 Ga0070693_100000236
300 Ga0070704_100004441
301 Ga0068855_100029595
302 Ga0068855_100042763
303 Ga0068855_100166565
304 Ga0068857_100426003
305 Ga0068854_100001760
306 Ga0068856_100047785
307 Ga0068856_100089222
308 Ga0070702_100001096
309 Ga0068852_100101664
310 Ga0068859_100006853
311 Ga0068859_100112850
312 Ga0068859_100198500
313 Ga0068864_100034410
314 Ga0068866_10001390
315 Ga0068861_100000164
316 Ga0068870_10129399
317 Ga0068860_100447141
318 Ga0068862_100005316
319 Ga0081538_10012460
320 Ga0075365_10003771
321 Ga0075365_10060065
322 Ga0075368_10005259
323 Ga0075363_100015137
324 Ga0075364_10113728
325 Ga0075364_10273410
326 Ga0075366_10017401
327 Ga0097621_100001366
328 Ga0075370_10054492
329 Ga0068871_100017248
330 Ga0075428_100002813
331 Ga0075428_100130439
332 Ga0075431_100411866
333 Ga0075431_100465998
334 Ga0075433_10304129
335 Ga0075429_100003591
336 Ga0068865_100000130
337 Ga0075436_100114108
338 Ga0097620_100006853
339 Ga0097620_100112849
340 Ga0097620_100198511
341 Ga0075435_100096263
342 Ga0105240_10102471
343 Ga0105240_10312404
344 Ga0105245_10009465
345 Ga0105247_10033666
346 Ga0114129_10095145
347 Ga0114129_10438615
348 Ga0105243_10011003
349 Ga0105241_10063339
350 Ga0105242_10000432
351 Ga0105249_10015834
352 Ga0105239_10048614
353 Ga0157370_10288016
354 Ga0157369_10004796
355 Ga0157378_10000467
356 Ga0157372_10007345
357 Ga0157380_10226277
358 Ga0157380_10238642
359 Ga0182008_10091467
360 Ga0157377_10144199
361 Ga0157379_10237540
362 Ga0157376_10025257
363 Ga0157376_10181016
364 Ga0157376_10241647
365 Ga0182006_1010212
366 Ga0163161_10042540
367 Ga0209130_1000125
368 Ga0209025_1001183
369 Ga0207653_10008565
370 Ga0207710_10009391
371 Ga0207647_10125542
372 Ga0207705_10016767
373 Ga0207705_10047023
374 Ga0207705_10173928
375 Ga0207705_10368222
376 Ga0207707_10087867
377 Ga0207695_10073864
378 Ga0207660_10005881
379 Ga0207662_10015548
380 Ga0207652_10230025
381 Ga0207681_10225402
382 Ga0207659_10045137
383 Ga0207659_10364445
384 Ga0207687_10069248
385 Ga0207700_10452825
386 Ga0207644_10099918
387 Ga0207709_10006514
388 Ga0207709_10051078
389 Ga0207711_10064101
390 Ga0207689_10000453
391 Ga0207689_10055219
392 Ga0207661_10350112
393 Ga0207667_10081012
394 Ga0207667_10157543
395 Ga0207651_10025998
396 Ga0207712_10044215
397 Ga0207677_10003666
398 Ga0207703_10003378
399 Ga0207639_10112325
400 Ga0207639_10114971
401 Ga0207708_10000727
402 Ga0207702_10007151
403 Ga0207702_10113521
404 Ga0207648_10036848
405 Ga0207648_10521161
406 Ga0207676_10191112
407 Ga0207675_100000474
408 Ga0207675_100058268
409 Ga0207675_100321404
410 Ga0209813_10009477
411 Ga0207428_10001885
412 Ga0268265_10128849
413 Ga0268264_10007305
414 Ga0307511_10000065
415 Ga0307408_100006771
416 Ga0307408_100057967
417 Ga0307408_100373409
418 Ga0307514_10004320
419 Ga0307406_10000768
420 Ga0307507_10204772
421 Ga0373958_0003570
422 Ga0373938_0005845
423 Ga0373928_0003206
424 Ga0373940_0005939
425 Ga0373949_0009525
426 Ga0373951_0005115
427 Ga0373952_0007180
428 Ga0373932_0007279
429 Ga0373939_0001437
430 Ga0373941_0002727
431 Ga0373942_0007941
432 Ga0373961_0028997
433 Ga0373962_0015105
434 Ga0373931_0002175
435 Ga0373931_0033624
436 Ga0395900_0011643
437 Ga0395900_0081711
438 Ga0395900_0283208
439 Ga0395898_0002097
440 Ga0395898_0012292
441 Ga0395898_0103558
442 Ga0395905_0080561
443 Ga0395905_0104817
444 Ga0395905_0237478
445 Ga0436364_0967224
446 Ga0436364_1027859
447 Ga0436365_1182449
448 Ga0439453_0000034
449 Ga0451577_0238951
450 Ga0439440_0014034
451 Ga0466965_0119793
452 Ga0466957_0253644
453 Ga0466958_0141980
454 Ga0466967_0114618
455 Ga0495580_0010905
456 Ga0495594_0008192
457 Ga0495643_0033462
458 Ga0495666_0001115
459 Ga0495665_0034729
460 Ga0495615_0006992
461 Ga0496100_0464370
462 Ga0496101_0335474
463 Ga0496102_0173120
464 Ga0496102_0327511
465 Ga0496106_0120593
466 Ga0496108_0310002
467 Ga0496112_0080260
468 Ga0496112_0546707
469 Ga0496114_0096903
470 Ga0496117_0037891
471 Ga0496122_0031454
472 Ga0496126_0120507
473 Ga0501075_0269628
474 nmdc:mga03683_11834_c1
475 nmdc:mga03n38_12932_c1
476 nmdc:mga00v17_50717_c1
477 nmdc:mga0yw44_12020_c1
478 nmdc:mga0yw44_250794_c1
479 nmdc:mga0k408_6686_c1
480 nmdc:mga06z11_55249_c1
481 nmdc:mga04h51_25835_c1
482 nmdc:mga07m45_22820_c2
483 nmdc:mga05p37_80711_c1
484 nmdc:mga09592_1711_c1
485 nmdc:mga06r32_101109_c1
486 nmdc:mga06r32_345544_c1
487 nmdc:mga08y16_238340_c1
488 nmdc:mga08y16_36917_c1
489 nmdc:mga08x19_75423_c1
490 nmdc:mga0a205_332734_c1
491 Ga0495601_0039970
492 Ga0495595_0020798
493 Ga0495619_0124925
494 Ga0500646_0015287
495 Ga0500595_005455
496 Ga0500608_087858
497 Ga0500652_000017
498 Ga0500561_0009289
499 Ga0500604_0002673
500 Ga0500622_0009319
501 Ga0500636_0001607
502 Ga0500636_0012636
503 Ga0501084_0076599
504 Ga0501082_0448763
505 2644747208
506 2904451513
507 2904458370
508 2945974793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

74

347

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9665 29 326
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9633 29 326
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9584 28 326
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9552 28 326
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9518 31 322
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9474 128 242 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9451 28 326 3.40.190.150
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9413 128 250 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9344 28 326 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9228 28 326 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A1G3HID8-F1-model_v4 ABC transporter substrate-binding protein 0.9773 26 326
AF-A0A6N0JW53-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9771 28 326
AF-A0A4V2HUY2-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9766 91 326
AF-A0A536SFT4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9747 56 326
AF-A0A4V2UYF0-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9744 48 324

Map