F364949

General Info

Members Datasets Scaffolds Average Seq Length
254 176 509 148

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10476630|Ga0207639_104766301
Length 181
Sequence VKRVWLLTLQYYWSLLIDKQLYFSSAECIPIFAPMHDVIIKVINTSKNNLPEYATNGSAGMDIRASLQKPVVLRPLERAMIPTGLYFEIPQGYEAQMRPRSGLAIKHGISCLNSPGTIDSDYRGELKVILINLSNKEHIISDGERIAQVVISKVEKAFLQPVEQLEESLRADGGFGHTGTN

Samples

Sample ID Description Type Environment
1 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
139 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
140 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
141 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
168 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
171 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
172 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
173 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.87
Nodule 0
Rhizoplane 1.97
Rhizosphere 86.22
Stem 0
Stem Tuber 0
Unclassified 11.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207639_10476630 3300026041 Bacteria 1137
2 JGI25154J39366_1000120 3300002738 Bacteria 63261
3 JGI25153J46596_10000422 3300003215 Bacteria 27612
4 rootH2_10099657 3300003320 Bacteria 1509
5 rootH2_10099658 3300003320 Bacteria 1555
6 rootH1_10063898 3300003316 Bacteria 1932
7 rootH1_10063898 3300003323 Bacteria 5530
8 JGI25160J50197_1031071 3300003354 Bacteria 1382
9 Ga0055530_10028445 3300003791 Bacteria 1508
10 Ga0065165_1010129 3300005262 Bacteria 4124
11 Ga0065165_1096231 3300005262 Bacteria 747
12 Ga0070658_10004224 3300005327 Bacteria 11752
13 Ga0070658_10657309 3300005327 Bacteria 909
14 Ga0070683_100655337 3300005329 Unclassified 1005
15 Ga0070670_100968058 3300005331 Bacteria 773
16 Ga0070666_10999089 3300005335 Bacteria 620
17 Ga0070680_100149253 3300005336 Bacteria 1962
18 Ga0070682_100009063 3300005337 Bacteria 5625
19 Ga0070682_100101586 3300005337 Unclassified 1899
20 Ga0070682_101013585 3300005337 Bacteria 690
21 Ga0068868_100098391 3300005338 Bacteria 2365
22 Ga0070660_100079326 3300005339 Bacteria 2575
23 Ga0070661_100019645 3300005344 Bacteria 4814
24 Ga0070668_100109498 3300005347 Bacteria 2198
25 Ga0070669_100338026 3300005353 Unclassified 1219
26 Ga0070671_100008744 3300005355 Bacteria 8124
27 Ga0070673_100006246 3300005364 Bacteria 7725
28 Ga0070673_100714769 3300005364 Bacteria 921
29 Ga0070659_100019291 3300005366 Bacteria 5164
30 Ga0070667_100002451 3300005367 Bacteria 16201
31 Ga0070667_100275106 3300005367 Bacteria 1511
32 Ga0070667_100331185 3300005367 Bacteria 1375
33 Ga0070709_10007869 3300005434 Bacteria 5853
34 Ga0070714_100056734 3300005435 Bacteria 3350
35 Ga0070714_100222417 3300005435 Bacteria 1735
36 Ga0070713_100018790 3300005436 Bacteria 5260
37 Ga0070710_10111212 3300005437 Bacteria 1646
38 Ga0070711_101203321 3300005439 Bacteria 655
39 Ga0070700_100465422 3300005441 Bacteria 965
40 Ga0070678_100159013 3300005456 Bacteria 1828
41 Ga0070681_10264410 3300005458 Bacteria 1632
42 Ga0070681_10402026 3300005458 Bacteria 1281
43 Ga0070681_11367203 3300005458 Bacteria 631
44 Ga0070679_100005255 3300005530 Bacteria 11986
45 Ga0070679_100046872 3300005530 Bacteria 4309
46 Ga0070684_100458704 3300005535 Bacteria 1178
47 Ga0070684_100669333 3300005535 Bacteria 967
48 Ga0068853_100000181 3300005539 Bacteria 44176
49 Ga0068853_100057647 3300005539 Bacteria 3352
50 Ga0068853_100515382 3300005539 Bacteria 1130
51 Ga0070686_100277219 3300005544 Bacteria 1235
52 Ga0068855_100094495 3300005563 Bacteria 3447
53 Ga0068855_100204314 3300005563 Bacteria 2223
54 Ga0068855_101497763 3300005563 Unclassified 693
55 Ga0068856_100021815 3300005614 Bacteria 6223
56 Ga0068856_100479356 3300005614 Bacteria 1265
57 Ga0068852_100009862 3300005616 Bacteria 7106
58 Ga0068852_100011600 3300005616 Bacteria 6646
59 Ga0068852_100099389 3300005616 Bacteria 2623
60 Ga0068852_100135265 3300005616 Unclassified 2275
61 Ga0068859_102206774 3300005617 Bacteria 608
62 Ga0068864_100932932 3300005618 Bacteria 858
63 Ga0068851_10071643 3300005834 Bacteria 1794
64 Ga0068863_100058577 3300005841 Unclassified 3645
65 Ga0068860_100004369 3300005843 Bacteria 14436
66 Ga0068862_100012344 3300005844 Bacteria 7062
67 Ga0070716_100665378 3300006173 Bacteria 791
68 Ga0070712_100127865 3300006175 Bacteria 1922
69 Ga0097621_100000118 3300006237 Bacteria 45384
70 Ga0097621_100000691 3300006237 Bacteria 23650
71 Ga0075370_10390512 3300006353 Bacteria 834
72 Ga0068871_100002078 3300006358 Bacteria 13539
73 Ga0068871_100005427 3300006358 Bacteria 8940
74 Ga0068865_100523550 3300006881 Unclassified 992
75 Ga0097620_102206871 3300006931 Bacteria 608
76 Ga0105240_10017744 3300009093 Bacteria 9580
77 Ga0105245_10147615 3300009098 Bacteria 2220
78 Ga0105241_10007003 3300009174 Bacteria 8295
79 Ga0105241_10202751 3300009174 Unclassified 1658
80 Ga0105248_10013248 3300009177 Bacteria 9079
81 Ga0105237_10054406 3300009545 Bacteria 4010
82 Ga0105249_10002912 3300009553 Bacteria 14766
83 Ga0105249_10371101 3300009553 Bacteria 1455
84 Ga0105249_10402935 3300009553 Bacteria 1399
85 Ga0105239_10036469 3300010375 Bacteria 5399
86 Ga0105239_10106329 3300010375 Bacteria 3108
87 Ga0105239_11143610 3300010375 Bacteria 897
88 Ga0105246_10014849 3300011119 Bacteria 4906
89 Ga0157373_10039543 3300013100 Bacteria 3377
90 Ga0157371_10037690 3300013102 Bacteria 3460
91 Ga0157371_10079646 3300013102 Bacteria 2320
92 Ga0157371_10233181 3300013102 Bacteria 1323
93 Ga0157370_10145464 3300013104 Bacteria 2207
94 Ga0157370_10341608 3300013104 Bacteria 1380
95 Ga0157369_10028123 3300013105 Bacteria 6224
96 Ga0157374_10439423 3300013296 Bacteria 1305
97 Ga0157378_10078354 3300013297 Unclassified 2980
98 Ga0163162_10000086 3300013306 Bacteria 85949
99 Ga0163162_10001629 3300013306 Bacteria 21029
100 Ga0157372_10042437 3300013307 Bacteria 5031
101 Ga0157375_10000115 3300013308 Bacteria 77964
102 Ga0157375_10043805 3300013308 Bacteria 4343
103 Ga0157380_10077232 3300014326 Bacteria 2713
104 Ga0157380_10361680 3300014326 Bacteria 1362
105 Ga0157380_10693517 3300014326 Bacteria 1022
106 Ga0157379_10069310 3300014968 Unclassified 3153
107 Ga0157379_10136111 3300014968 Bacteria 2213
108 Ga0157379_10141359 3300014968 Bacteria 2170
109 Ga0157376_10000429 3300014969 Bacteria 27200
110 Ga0157376_10060312 3300014969 Bacteria 3185
111 Ga0157376_10098959 3300014969 Unclassified 2543
112 Ga0157376_11841449 3300014969 Unclassified 642
113 Ga0163161_10036607 3300017792 Bacteria 3515
114 Ga0213874_10149120 3300021377 Bacteria 815
115 Ga0209646_1000050 3300025246 Bacteria 296599
116 Ga0209026_1000452 3300025250 Bacteria 32703
117 Ga0209129_1027461 3300025258 Bacteria 974
118 Ga0209758_1027512 3300025297 Bacteria 2427
119 Ga0209050_1009972 3300025298 Bacteria 4757
120 Ga0207426_1000711 3300025302 Bacteria 38972
121 Ga0207682_10448515 3300025893 Bacteria 611
122 Ga0207680_10011509 3300025903 Bacteria 4474
123 Ga0207647_10000088 3300025904 Bacteria 70267
124 Ga0207705_10365873 3300025909 Bacteria 1112
125 Ga0207654_10019538 3300025911 Bacteria 3577
126 Ga0207707_10079218 3300025912 Bacteria 2869
127 Ga0207707_10095336 3300025912 Bacteria 2600
128 Ga0207707_10970847 3300025912 Bacteria 699
129 Ga0207695_10013243 3300025913 Bacteria 9841
130 Ga0207671_11191280 3300025914 Bacteria 596
131 Ga0207693_10019817 3300025915 Bacteria 5349
132 Ga0207663_10862573 3300025916 Bacteria 723
133 Ga0207660_10424607 3300025917 Bacteria 1073
134 Ga0207660_10450503 3300025917 Bacteria 1041
135 Ga0207657_10028007 3300025919 Bacteria 5149
136 Ga0207652_10010171 3300025921 Bacteria 7573
137 Ga0207652_10031285 3300025921 Bacteria 4469
138 Ga0207681_10244556 3300025923 Bacteria 1398
139 Ga0207659_10089371 3300025926 Bacteria 2297
140 Ga0207659_10912231 3300025926 Bacteria 755
141 Ga0207700_11284608 3300025928 Bacteria 652
142 Ga0207664_10043206 3300025929 Bacteria 3523
143 Ga0207644_10012142 3300025931 Bacteria 5715
144 Ga0207690_10072577 3300025932 Unclassified 2377
145 Ga0207665_10174648 3300025939 Bacteria 1553
146 Ga0207691_10002936 3300025940 Bacteria 16636
147 Ga0207691_10396765 3300025940 Bacteria 1177
148 Ga0207711_10252671 3300025941 Unclassified 1619
149 Ga0207689_10015795 3300025942 Bacteria 6393
150 Ga0207661_10375140 3300025944 Unclassified 1287
151 Ga0207667_10008192 3300025949 Bacteria 12438
152 Ga0207667_10146897 3300025949 Bacteria 2427
153 Ga0207667_10529951 3300025949 Bacteria 1193
154 Ga0207712_10043351 3300025961 Bacteria 3103
155 Ga0207640_10463994 3300025981 Unclassified 1047
156 Ga0207677_10201862 3300026023 Unclassified 1581
157 Ga0207703_10533961 3300026035 Bacteria 1105
158 Ga0207639_10009376 3300026041 Bacteria 6750
159 Ga0207639_10118799 3300026041 Bacteria 2168
160 Ga0207639_11392861 3300026041 Bacteria 658
161 Ga0207702_10028195 3300026078 Bacteria 4665
162 Ga0207702_10425441 3300026078 Bacteria 1285
163 Ga0207641_10038478 3300026088 Unclassified 3999
164 Ga0207641_11058064 3300026088 Unclassified 809
165 Ga0207674_10005394 3300026116 Bacteria 15211
166 Ga0207683_10065200 3300026121 Unclassified 3211
167 Ga0207698_10010894 3300026142 Bacteria 5871
168 Ga0207698_10057769 3300026142 Unclassified 3003
169 Ga0207698_10439899 3300026142 Bacteria 1256
170 Ga0207698_10576336 3300026142 Bacteria 1106
171 Ga0268265_10018897 3300028380 Bacteria 4783
172 Ga0268264_10047212 3300028381 Unclassified 3580
173 Ga0265316_10021960 3300031344 Bacteria 5393
174 Ga0307408_101461290 3300031548 Bacteria 645
175 Ga0265342_10217432 3300031712 Bacteria 1031
176 Ga0316576_10143971 3300031727 Bacteria 1795
177 Ga0307405_10233879 3300031731 Bacteria 1356
178 Ga0307405_11163851 3300031731 Bacteria 665
179 Ga0307413_10207343 3300031824 Bacteria 1420
180 Ga0307410_10067752 3300031852 Bacteria 2463
181 Ga0307410_11516940 3300031852 Bacteria 591
182 Ga0307406_10064219 3300031901 Bacteria 2381
183 Ga0307406_10078781 3300031901 Bacteria 2184
184 Ga0307412_10064239 3300031911 Bacteria 2479
185 Ga0307412_10611406 3300031911 Bacteria 924
186 Ga0307409_100014392 3300031995 Bacteria 5145
187 Ga0307409_100032307 3300031995 Bacteria 3793
188 Ga0307416_100086356 3300032002 Bacteria 2674
189 Ga0307416_100379820 3300032002 Bacteria 1442
190 Ga0307414_10272846 3300032004 Bacteria 1417
191 Ga0307414_11028630 3300032004 Bacteria 759
192 Ga0307411_10158151 3300032005 Bacteria 1693
193 Ga0307411_10399149 3300032005 Bacteria 1136
194 Ga0307411_10492231 3300032005 Bacteria 1035
195 Ga0307415_100644748 3300032126 Bacteria 949
196 Ga0373943_0134495 3300035170 Bacteria 1326
197 Ga0373946_0072722 3300035171 Bacteria 1489
198 Ga0373935_0564294 3300035692 Bacteria 830
199 Ga0373935_1085247 3300035692 Bacteria 596
200 Ga0373947_0175228 3300035725 Bacteria 1394
201 Ga0373937_0115086 3300036401 Unclassified 2504
202 Ga0395900_0024370 3300037418 Bacteria 6197
203 Ga0395900_0584468 3300037418 Bacteria 1059
204 Ga0395905_0404692 3300037471 Bacteria 1260
205 Ga0395901_1359863 3300038443 Bacteria 670
206 Ga0237819_00705 3300038705 Bacteria 10860
207 Ga0400483_082752 3300039062 Bacteria 2094
208 Ga0451789_0451547 3300041443 Unclassified 639
209 Ga0439449_0053517 3300042007 Bacteria 1492
210 Ga0466966_0218278 3300044684 Bacteria 1151
211 Ga0466966_0401490 3300044684 Bacteria 824
212 Ga0466961_0031775 3300044693 Bacteria 3394
213 Ga0466963_0038966 3300044694 Bacteria 3110
214 Ga0466970_0219842 3300044765 Bacteria 1060
215 Ga0466959_0037152 3300045049 Bacteria 3598
216 Ga0466959_0070284 3300045049 Unclassified 2536
217 Ga0466958_0093580 3300045836 Bacteria 1861
218 Ga0495633_0307997 3300046558 Bacteria 719
219 Ga0495674_0227247 3300047319 Bacteria 1541
220 Ga0496101_0051865 3300048904 Unclassified 2957
221 Ga0496105_0408563 3300048908 Bacteria 1077
222 Ga0496106_0519174 3300048909 Unclassified 956
223 Ga0496114_0217772 3300048917 Bacteria 1676
224 Ga0496126_0038081 3300048929 Bacteria 4477
225 Ga0501033_0584587 3300049570 Bacteria 767
226 Ga0501034_0011155 3300049571 Bacteria 9326
227 Ga0501034_0163775 3300049571 Bacteria 2193
228 Ga0501034_0165134 3300049571 Unclassified 2183
229 Ga0501043_0325753 3300049579 Bacteria 1171
230 Ga0501047_0091505 3300049581 Bacteria 2920
231 Ga0501047_0376655 3300049581 Bacteria 1254
232 Ga0501070_0118017 3300049586 Bacteria 2192
233 Ga0501071_0168235 3300049587 Bacteria 1641
234 Ga0501080_0028604 3300049742 Bacteria 5187
235 Ga0501083_0089580 3300049744 Bacteria 2033
236 Ga0501035_0092202 3300049822 Bacteria 2666
237 Ga0501044_0001543 3300049823 Bacteria 27026
238 Ga0501044_0257497 3300049823 Unclassified 1684
239 Ga0501044_0268366 3300049823 Unclassified 1643
240 Ga0501044_1051196 3300049823 Bacteria 685
241 nmdc:mga0rr50_725110_c1 3300050513 Bacteria 848
242 Ga0500643_007404 3300053087 Bacteria 4434
243 Ga0500592_000031 3300053116 Bacteria 47686
244 Ga0500652_013176 3300053131 Bacteria 2921
245 Ga0500568_0014636 3300053139 Bacteria 3536
246 Ga0500568_0016742 3300053139 Bacteria 3249
247 Ga0500573_0141617 3300053140 Bacteria 1324
248 Ga0500624_000060 3300053157 Bacteria 68534
249 Ga0500627_0002097 3300053158 Bacteria 5784
250 Ga0500636_0005194 3300053177 Bacteria 7408
251 Ga0500636_0233614 3300053177 Bacteria 949
252 Ga0501084_0313484 3300054114 Bacteria 1325
253 Ga0501082_0284623 3300060353 Bacteria 1439
254 Ga0466962_0029827 3300061719 Bacteria 2611
255 Ga0466962_0168407 3300061719 Bacteria 1066
256 Ga0207639_10476630
257 JGI25154J39366_1000120
258 JGI25153J46596_10000422
259 rootH2_10099657
260 rootH2_10099658
261 rootH1_10063898
262 JGI25160J50197_1031071
263 Ga0055530_10028445
264 Ga0065165_1010129
265 Ga0065165_1096231
266 Ga0070658_10004224
267 Ga0070658_10657309
268 Ga0070683_100655337
269 Ga0070670_100968058
270 Ga0070666_10999089
271 Ga0070680_100149253
272 Ga0070682_100009063
273 Ga0070682_100101586
274 Ga0070682_101013585
275 Ga0068868_100098391
276 Ga0070660_100079326
277 Ga0070661_100019645
278 Ga0070668_100109498
279 Ga0070669_100338026
280 Ga0070671_100008744
281 Ga0070673_100006246
282 Ga0070673_100714769
283 Ga0070659_100019291
284 Ga0070667_100002451
285 Ga0070667_100275106
286 Ga0070667_100331185
287 Ga0070709_10007869
288 Ga0070714_100056734
289 Ga0070714_100222417
290 Ga0070713_100018790
291 Ga0070710_10111212
292 Ga0070711_101203321
293 Ga0070700_100465422
294 Ga0070678_100159013
295 Ga0070681_10264410
296 Ga0070681_10402026
297 Ga0070681_11367203
298 Ga0070679_100005255
299 Ga0070679_100046872
300 Ga0070684_100458704
301 Ga0070684_100669333
302 Ga0068853_100000181
303 Ga0068853_100057647
304 Ga0068853_100515382
305 Ga0070686_100277219
306 Ga0068855_100094495
307 Ga0068855_100204314
308 Ga0068855_101497763
309 Ga0068856_100021815
310 Ga0068856_100479356
311 Ga0068852_100009862
312 Ga0068852_100011600
313 Ga0068852_100099389
314 Ga0068852_100135265
315 Ga0068859_102206774
316 Ga0068864_100932932
317 Ga0068851_10071643
318 Ga0068863_100058577
319 Ga0068860_100004369
320 Ga0068862_100012344
321 Ga0070716_100665378
322 Ga0070712_100127865
323 Ga0097621_100000118
324 Ga0097621_100000691
325 Ga0075370_10390512
326 Ga0068871_100002078
327 Ga0068871_100005427
328 Ga0068865_100523550
329 Ga0097620_102206871
330 Ga0105240_10017744
331 Ga0105245_10147615
332 Ga0105241_10007003
333 Ga0105241_10202751
334 Ga0105248_10013248
335 Ga0105237_10054406
336 Ga0105249_10002912
337 Ga0105249_10371101
338 Ga0105249_10402935
339 Ga0105239_10036469
340 Ga0105239_10106329
341 Ga0105239_11143610
342 Ga0105246_10014849
343 Ga0157373_10039543
344 Ga0157371_10037690
345 Ga0157371_10079646
346 Ga0157371_10233181
347 Ga0157370_10145464
348 Ga0157370_10341608
349 Ga0157369_10028123
350 Ga0157374_10439423
351 Ga0157378_10078354
352 Ga0163162_10000086
353 Ga0163162_10001629
354 Ga0157372_10042437
355 Ga0157375_10000115
356 Ga0157375_10043805
357 Ga0157380_10077232
358 Ga0157380_10361680
359 Ga0157380_10693517
360 Ga0157379_10069310
361 Ga0157379_10136111
362 Ga0157379_10141359
363 Ga0157376_10000429
364 Ga0157376_10060312
365 Ga0157376_10098959
366 Ga0157376_11841449
367 Ga0163161_10036607
368 Ga0213874_10149120
369 Ga0209646_1000050
370 Ga0209026_1000452
371 Ga0209129_1027461
372 Ga0209758_1027512
373 Ga0209050_1009972
374 Ga0207426_1000711
375 Ga0207682_10448515
376 Ga0207680_10011509
377 Ga0207647_10000088
378 Ga0207705_10365873
379 Ga0207654_10019538
380 Ga0207707_10079218
381 Ga0207707_10095336
382 Ga0207707_10970847
383 Ga0207695_10013243
384 Ga0207671_11191280
385 Ga0207693_10019817
386 Ga0207663_10862573
387 Ga0207660_10424607
388 Ga0207660_10450503
389 Ga0207657_10028007
390 Ga0207652_10010171
391 Ga0207652_10031285
392 Ga0207681_10244556
393 Ga0207659_10089371
394 Ga0207659_10912231
395 Ga0207700_11284608
396 Ga0207664_10043206
397 Ga0207644_10012142
398 Ga0207690_10072577
399 Ga0207665_10174648
400 Ga0207691_10002936
401 Ga0207691_10396765
402 Ga0207711_10252671
403 Ga0207689_10015795
404 Ga0207661_10375140
405 Ga0207667_10008192
406 Ga0207667_10146897
407 Ga0207667_10529951
408 Ga0207712_10043351
409 Ga0207640_10463994
410 Ga0207677_10201862
411 Ga0207703_10533961
412 Ga0207639_10009376
413 Ga0207639_10118799
414 Ga0207639_11392861
415 Ga0207702_10028195
416 Ga0207702_10425441
417 Ga0207641_10038478
418 Ga0207641_11058064
419 Ga0207674_10005394
420 Ga0207683_10065200
421 Ga0207698_10010894
422 Ga0207698_10057769
423 Ga0207698_10439899
424 Ga0207698_10576336
425 Ga0268265_10018897
426 Ga0268264_10047212
427 Ga0265316_10021960
428 Ga0307408_101461290
429 Ga0265342_10217432
430 Ga0316576_10143971
431 Ga0307405_10233879
432 Ga0307405_11163851
433 Ga0307413_10207343
434 Ga0307410_10067752
435 Ga0307410_11516940
436 Ga0307406_10064219
437 Ga0307406_10078781
438 Ga0307412_10064239
439 Ga0307412_10611406
440 Ga0307409_100014392
441 Ga0307409_100032307
442 Ga0307416_100086356
443 Ga0307416_100379820
444 Ga0307414_10272846
445 Ga0307414_11028630
446 Ga0307411_10158151
447 Ga0307411_10399149
448 Ga0307411_10492231
449 Ga0307415_100644748
450 Ga0373943_0134495
451 Ga0373946_0072722
452 Ga0373935_0564294
453 Ga0373935_1085247
454 Ga0373947_0175228
455 Ga0373937_0115086
456 Ga0395900_0024370
457 Ga0395900_0584468
458 Ga0395905_0404692
459 Ga0395901_1359863
460 Ga0237819_00705
461 Ga0400483_082752
462 Ga0451789_0451547
463 Ga0439449_0053517
464 Ga0466966_0218278
465 Ga0466966_0401490
466 Ga0466961_0031775
467 Ga0466963_0038966
468 Ga0466970_0219842
469 Ga0466959_0037152
470 Ga0466959_0070284
471 Ga0466958_0093580
472 Ga0495633_0307997
473 Ga0495674_0227247
474 Ga0496101_0051865
475 Ga0496105_0408563
476 Ga0496106_0519174
477 Ga0496114_0217772
478 Ga0496126_0038081
479 Ga0501033_0584587
480 Ga0501034_0011155
481 Ga0501034_0163775
482 Ga0501034_0165134
483 Ga0501043_0325753
484 Ga0501047_0091505
485 Ga0501047_0376655
486 Ga0501070_0118017
487 Ga0501071_0168235
488 Ga0501080_0028604
489 Ga0501083_0089580
490 Ga0501035_0092202
491 Ga0501044_0001543
492 Ga0501044_0257497
493 Ga0501044_0268366
494 Ga0501044_1051196
495 nmdc:mga0rr50_725110_c1
496 Ga0500643_007404
497 Ga0500592_000031
498 Ga0500652_013176
499 Ga0500568_0014636
500 Ga0500568_0016742
501 Ga0500573_0141617
502 Ga0500624_000060
503 Ga0500627_0002097
504 Ga0500636_0005194
505 Ga0500636_0233614
506 Ga0501084_0313484
507 Ga0501082_0284623
508 Ga0466962_0029827
509 Ga0466962_0168407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

46

179

0.94

PF22769

DCD

dCTP deaminase-like

41

154

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mbq-assembly1.cif.gz_B crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form 0.9637 3 128
7n56-assembly3.cif.gz_K crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from rickettsia prowazekii str. madrid e 0.9594 1 132
4lhr-assembly1.cif.gz_A crystal structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase from burkholderia thailandensis 0.9454 3 131
3i93-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dutpase stop138t mutant 0.9387 5 130
6mai-assembly1.cif.gz_A crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from legionella pneumophila philadelphia 1 0.9378 3 133
ID Description Score Start End Superfamily
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9609 3 132 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9414 3 131 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9344 3 131 2.70.40.10
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9196 3 132 2.70.40.10
1sjnC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9134 3 140 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A7X9CIF6-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9958 4 116 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-F8DS81-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9906 4 126 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A359GZM5-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.99 4 128 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A7V7WIC2-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9873 1 120 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A359GZM5-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9822 4 128 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Map