F364904

General Info

Members Datasets Scaffolds Average Seq Length
254 164 508 208

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10105790|Ga0213876_101057902
Length 249
Sequence MDRRKFIKDSAIAATAAAALAGQATKLNILAAPAASRPTLSAGPGFTFARLRYASGNWDADPRMPSNILNSLVEYTSIRVDPTERVVEVGSPALANYPFVYLTGNKMLRFTEAERANLRRYLRNGGFMFVDDCNHDIDGTFAKTFESEIKLILDHPSEVMHKLPKNHALYRSFFEFKEGPPATSHELNGWGDDIVHDYLQAIEIDGRIAVLYSNKDYGCEWNYDWTNKRFAAKDNTRFGVNIIVYALTH

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
154 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
155 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
158 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
159 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
160 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
161 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
163 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
164 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 0
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.54
Nodule 0
Rhizoplane 0.39
Rhizosphere 90.16
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10105790 3300021384 Bacteria 1493
2 JGI24737J22298_10038515 3300001990 Bacteria 1472
3 JGI24744J21845_10037287 3300002077 Bacteria 916
4 JGI25160J50197_1000842 3300003354 Bacteria 16288
5 Ga0070670_100133824 3300005331 Bacteria 2142
6 Ga0070670_100178363 3300005331 Bacteria 1844
7 Ga0068869_100052343 3300005334 Bacteria 2964
8 Ga0068869_100063559 3300005334 Bacteria 2712
9 Ga0070666_10118249 3300005335 Bacteria 1837
10 Ga0068868_100051076 3300005338 Bacteria 3250
11 Ga0068868_100055416 3300005338 Bacteria 3127
12 Ga0070668_100045332 3300005347 Bacteria 3374
13 Ga0070668_100218587 3300005347 Bacteria 1570
14 Ga0070669_100063533 3300005353 Bacteria 2718
15 Ga0070675_100116614 3300005354 Bacteria 2265
16 Ga0070675_100280591 3300005354 Bacteria 1464
17 Ga0070674_100053435 3300005356 Bacteria 2789
18 Ga0070674_100091500 3300005356 Bacteria 2197
19 Ga0070673_100002639 3300005364 Bacteria 10967
20 Ga0070673_100068618 3300005364 Bacteria 2839
21 Ga0070673_100116598 3300005364 Bacteria 2222
22 Ga0070673_100743348 3300005364 Bacteria 903
23 Ga0070688_100327006 3300005365 Bacteria 1116
24 Ga0070701_10212742 3300005438 Bacteria 1149
25 Ga0070705_100606830 3300005440 Bacteria 847
26 Ga0070663_100296263 3300005455 Bacteria 1293
27 Ga0070678_100095421 3300005456 Bacteria 2292
28 Ga0070678_100118159 3300005456 Bacteria 2086
29 Ga0070662_100000013 3300005457 Bacteria 125019
30 Ga0070662_100092205 3300005457 Bacteria 2277
31 Ga0068867_100013674 3300005459 Bacteria 5747
32 Ga0068867_100061825 3300005459 Bacteria 2781
33 Ga0068867_100284438 3300005459 Bacteria 1357
34 Ga0070699_100361386 3300005518 Bacteria 1309
35 Ga0070684_100007033 3300005535 Bacteria 8747
36 Ga0068853_100741480 3300005539 Bacteria 938
37 Ga0070672_100010677 3300005543 Bacteria 6378
38 Ga0070672_100160519 3300005543 Bacteria 1865
39 Ga0070665_100027777 3300005548 Bacteria 5697
40 Ga0070665_100518872 3300005548 Bacteria 1203
41 Ga0068854_100228658 3300005578 Bacteria 1475
42 Ga0068859_100028106 3300005617 Bacteria 5639
43 Ga0068859_100035563 3300005617 Bacteria 4998
44 Ga0068859_100098258 3300005617 Bacteria 2981
45 Ga0068864_100597472 3300005618 Bacteria 1071
46 Ga0068866_10021869 3300005718 Bacteria 2951
47 Ga0068866_10110213 3300005718 Bacteria 1534
48 Ga0068866_10239600 3300005718 Bacteria 1104
49 Ga0068861_100969451 3300005719 Bacteria 810
50 Ga0068851_10022623 3300005834 Bacteria 3065
51 Ga0068870_10047634 3300005840 Bacteria 2254
52 Ga0068860_100228649 3300005843 Bacteria 1807
53 Ga0068860_100233160 3300005843 Bacteria 1789
54 Ga0068862_100570726 3300005844 Bacteria 1083
55 Ga0081539_10240401 3300005985 Bacteria 811
56 Ga0097621_100017677 3300006237 Bacteria 5422
57 Ga0097621_100046603 3300006237 Bacteria 3508
58 Ga0097621_100180273 3300006237 Bacteria 1825
59 Ga0097621_100532890 3300006237 Bacteria 1067
60 Ga0068871_100033097 3300006358 Bacteria 4090
61 Ga0068871_100044505 3300006358 Bacteria 3570
62 Ga0068871_100717085 3300006358 Bacteria 917
63 Ga0068871_100854137 3300006358 Bacteria 841
64 Ga0075430_100149281 3300006846 Bacteria 1946
65 Ga0075431_100002917 3300006847 Bacteria 16555
66 Ga0075431_101153045 3300006847 Bacteria 739
67 Ga0075429_100011748 3300006880 Bacteria 7595
68 Ga0075429_100024636 3300006880 Bacteria 5222
69 Ga0068865_100016686 3300006881 Bacteria 4704
70 Ga0097620_100028106 3300006931 Bacteria 5639
71 Ga0097620_100035563 3300006931 Bacteria 4998
72 Ga0097620_100098261 3300006931 Bacteria 2981
73 Ga0111539_10063370 3300009094 Bacteria 4375
74 Ga0111539_10144469 3300009094 Bacteria 2785
75 Ga0111539_10200647 3300009094 Bacteria 2326
76 Ga0105245_10265784 3300009098 Bacteria 1671
77 Ga0114129_10282107 3300009147 Bacteria 2219
78 Ga0114129_10590223 3300009147 Bacteria 1440
79 Ga0105241_10132412 3300009174 Bacteria 2020
80 Ga0105241_10260139 3300009174 Bacteria 1474
81 Ga0105242_10009424 3300009176 Bacteria 7484
82 Ga0105242_10015071 3300009176 Bacteria 5997
83 Ga0105242_10022154 3300009176 Bacteria 4992
84 Ga0105248_10770788 3300009177 Bacteria 1086
85 Ga0105238_10001237 3300009551 Bacteria 25698
86 Ga0105238_10036953 3300009551 Bacteria 4966
87 Ga0105249_10601457 3300009553 Bacteria 1154
88 Ga0105249_10670382 3300009553 Bacteria 1096
89 Ga0105239_10695120 3300010375 Bacteria 1163
90 Ga0105246_10014427 3300011119 Bacteria 4970
91 Ga0157371_10000578 3300013102 Bacteria 43421
92 Ga0157371_10147260 3300013102 Bacteria 1678
93 Ga0157370_10119898 3300013104 Bacteria 2456
94 Ga0157369_10048767 3300013105 Bacteria 4594
95 Ga0157369_11379697 3300013105 Bacteria 718
96 Ga0157374_10094924 3300013296 Bacteria 2851
97 Ga0157378_10163852 3300013297 Bacteria 2081
98 Ga0157378_10286334 3300013297 Bacteria 1590
99 Ga0163162_10284159 3300013306 Bacteria 1786
100 Ga0163162_10697230 3300013306 Unclassified 1137
101 Ga0157375_10179283 3300013308 Bacteria 2269
102 Ga0157375_10236696 3300013308 Bacteria 1985
103 Ga0157375_10299874 3300013308 Bacteria 1771
104 Ga0163163_10000553 3300014325 Bacteria 32772
105 Ga0163163_10862928 3300014325 Bacteria 968
106 Ga0182008_10040610 3300014497 Bacteria 2323
107 Ga0157377_10039553 3300014745 Bacteria 2609
108 Ga0163161_10190233 3300017792 Bacteria 1577
109 Ga0163161_10767977 3300017792 Bacteria 808
110 Ga0213872_10003022 3300021361 Bacteria 9501
111 Ga0213876_10002268 3300021384 Bacteria 11346
112 Ga0209026_1000559 3300025250 Bacteria 25465
113 Ga0209026_1001858 3300025250 Bacteria 8621
114 Ga0207426_1000032 3300025302 Bacteria 457997
115 Ga0207682_10037328 3300025893 Bacteria 1968
116 Ga0207642_10285957 3300025899 Bacteria 950
117 Ga0207688_10051665 3300025901 Bacteria 2302
118 Ga0207680_10134331 3300025903 Bacteria 1634
119 Ga0207647_10000044 3300025904 Bacteria 90491
120 Ga0207645_10000763 3300025907 Bacteria 26753
121 Ga0207654_10001733 3300025911 Bacteria 11338
122 Ga0207695_10045548 3300025913 Bacteria 4655
123 Ga0207695_10126509 3300025913 Bacteria 2517
124 Ga0207671_10002380 3300025914 Bacteria 20199
125 Ga0207671_10002807 3300025914 Bacteria 18122
126 Ga0207671_10005188 3300025914 Bacteria 12109
127 Ga0207694_10002932 3300025924 Bacteria 13705
128 Ga0207694_10301385 3300025924 Bacteria 1320
129 Ga0207650_10020713 3300025925 Bacteria 4641
130 Ga0207650_10042839 3300025925 Bacteria 3321
131 Ga0207650_10547445 3300025925 Bacteria 970
132 Ga0207659_10033944 3300025926 Bacteria 3515
133 Ga0207659_10348507 3300025926 Bacteria 1228
134 Ga0207644_10006227 3300025931 Bacteria 7779
135 Ga0207644_10482580 3300025931 Bacteria 1021
136 Ga0207690_10177733 3300025932 Bacteria 1600
137 Ga0207706_10000173 3300025933 Bacteria 71958
138 Ga0207706_10498732 3300025933 Bacteria 1051
139 Ga0207686_10040161 3300025934 Bacteria 2844
140 Ga0207686_10187403 3300025934 Bacteria 1472
141 Ga0207704_10071151 3300025938 Bacteria 2206
142 Ga0207704_10212332 3300025938 Bacteria 1425
143 Ga0207691_10012667 3300025940 Bacteria 8077
144 Ga0207691_10034664 3300025940 Bacteria 4692
145 Ga0207689_10001199 3300025942 Bacteria 24909
146 Ga0207689_10008493 3300025942 Bacteria 8950
147 Ga0207689_10089040 3300025942 Bacteria 2535
148 Ga0207661_10005139 3300025944 Bacteria 9193
149 Ga0207651_10006992 3300025960 Bacteria 5975
150 Ga0207651_10123780 3300025960 Bacteria 1966
151 Ga0207712_10020005 3300025961 Bacteria 4379
152 Ga0207712_10142561 3300025961 Bacteria 1841
153 Ga0207668_10015310 3300025972 Bacteria 4762
154 Ga0207668_10133237 3300025972 Bacteria 1900
155 Ga0207668_10198237 3300025972 Bacteria 1597
156 Ga0207668_10405568 3300025972 Bacteria 1153
157 Ga0207640_10213986 3300025981 Bacteria 1470
158 Ga0207658_10006188 3300025986 Bacteria 8173
159 Ga0207677_10078475 3300026023 Bacteria 2358
160 Ga0207703_10044239 3300026035 Bacteria 3578
161 Ga0207678_10102707 3300026067 Bacteria 2440
162 Ga0207648_10005783 3300026089 Bacteria 12387
163 Ga0207648_10016765 3300026089 Bacteria 6683
164 Ga0207648_10117255 3300026089 Bacteria 2340
165 Ga0207648_10578335 3300026089 Bacteria 1034
166 Ga0207675_100420859 3300026118 Bacteria 1319
167 Ga0207683_10093215 3300026121 Bacteria 2684
168 Ga0207683_10101464 3300026121 Bacteria 2569
169 Ga0207683_10125751 3300026121 Bacteria 2304
170 Ga0207428_10098129 3300027907 Bacteria 2267
171 Ga0268266_10018579 3300028379 Bacteria 5924
172 Ga0268265_10023526 3300028380 Bacteria 4344
173 Ga0268265_10199499 3300028380 Bacteria 1735
174 Ga0268264_10010264 3300028381 Bacteria 7753
175 Ga0268264_10197183 3300028381 Bacteria 1839
176 Ga0307515_10001310 3300028794 Bacteria 56561
177 Ga0265332_10013540 3300031238 Bacteria 3613
178 Ga0265327_10007703 3300031251 Bacteria 8241
179 Ga0265327_10104444 3300031251 Bacteria 1362
180 Ga0307509_10028379 3300031507 Bacteria 6223
181 Ga0307408_100401910 3300031548 Bacteria 1176
182 Ga0307408_100543995 3300031548 Bacteria 1024
183 Ga0265314_10220142 3300031711 Bacteria 1108
184 Ga0316576_10230067 3300031727 Bacteria 1394
185 Ga0307413_10058719 3300031824 Bacteria 2359
186 Ga0307410_10269522 3300031852 Bacteria 1331
187 Ga0307409_100580031 3300031995 Bacteria 1105
188 Ga0307409_101417285 3300031995 Bacteria 721
189 Ga0307416_100043613 3300032002 Bacteria 3514
190 Ga0307510_10004416 3300033180 Bacteria 16557
191 Ga0316584_0009019 3300036712 Bacteria 6901
192 Ga0395899_0000563 3300037312 Bacteria 39619
193 Ga0395900_0000173 3300037418 Bacteria 103767
194 Ga0395898_0070566 3300037466 Bacteria 3377
195 Ga0395905_0009847 3300037471 Bacteria 9316
196 Ga0395905_0041076 3300037471 Bacteria 4340
197 Ga0395901_0000294 3300038443 Bacteria 61869
198 Ga0436365_0004784 3300039437 Bacteria 42373
199 Ga0436365_0281988 3300039437 Bacteria 1603
200 Ga0436365_0425322 3300039437 Bacteria 1352
201 Ga0436365_1101370 3300039437 Bacteria 811
202 Ga0436365_1238752 3300039437 Bacteria 2255
203 Ga0436361_0123021 3300039447 Bacteria 13910
204 Ga0451807_0317645 3300041486 Bacteria 806
205 Ga0439448_0011847 3300042005 Bacteria 2601
206 Ga0439446_0043897 3300042156 Bacteria 1322
207 Ga0466968_0057734 3300044735 Bacteria 1669
208 Ga0466970_0057941 3300044765 Bacteria 2072
209 Ga0495585_0000838 3300046492 Bacteria 26532
210 Ga0495648_0005100 3300046524 Bacteria 11018
211 Ga0495668_0000044 3300046616 Bacteria 227585
212 Ga0495625_0001984 3300046660 Bacteria 23086
213 Ga0495625_0003910 3300046660 Bacteria 14358
214 Ga0495625_0315218 3300046660 Bacteria 997
215 Ga0495625_0332865 3300046660 Bacteria 964
216 Ga0495600_0070806 3300046809 Bacteria 2279
217 Ga0495672_0040098 3300047320 Bacteria 2842
218 Ga0495683_0040523 3300047323 Bacteria 2353
219 Ga0495687_123108 3300047443 Bacteria 932
220 Ga0495686_0001308 3300047472 Bacteria 27997
221 Ga0495614_0004553 3300048089 Bacteria 6252
222 Ga0496124_0020192 3300048927 Bacteria 6166
223 Ga0495682_0064359 3300049460 Bacteria 1322
224 Ga0501033_0463510 3300049570 Bacteria 879
225 Ga0501034_0309565 3300049571 Bacteria 1514
226 Ga0501040_0136712 3300049576 Bacteria 1726
227 Ga0501072_0346357 3300049588 Bacteria 1180
228 Ga0501238_006001 3300049671 Bacteria 1556
229 Ga0501044_0003228 3300049823 Bacteria 18353
230 nmdc:mga0k408_116_c3 3300050493 Bacteria 24401
231 nmdc:mga0k408_237_c1 3300050493 Bacteria 29636
232 nmdc:mga05p37_184457_c1 3300050507 Bacteria 2537
233 nmdc:mga05p37_652136_c1 3300050507 Bacteria 1178
234 nmdc:mga09592_138368_c1 3300050508 Unclassified 2098
235 nmdc:mga09592_77367_c1 3300050508 Bacteria 2830
236 nmdc:mga0qj67_459059_c1 3300050509 Bacteria 1025
237 nmdc:mga06r32_19127_c1 3300050510 Bacteria 6284
238 nmdc:mga08y16_180780_c1 3300050511 Bacteria 2190
239 nmdc:mga08y16_240386_c1 3300050511 Bacteria 1872
240 nmdc:mga0rr50_97038_c1 3300050513 Bacteria 2307
241 nmdc:mga0a205_19831_c1 3300050515 Bacteria 6344
242 Ga0500608_001862 3300053122 Bacteria 7525
243 Ga0500618_000061 3300053125 Bacteria 96180
244 Ga0500561_0178286 3300053137 Bacteria 668
245 Ga0500616_0002344 3300053153 Bacteria 15940
246 Ga0500622_0000786 3300053156 Bacteria 27529
247 Ga0590071_000742 3300059421 Bacteria 9139
248 Ga0590074_017854 3300059423 Bacteria 1213
249 Ga0590075_000215 3300059424 Bacteria 16149
250 Ga0590075_066979 3300059424 Bacteria 927
251 Ga0590077_017520 3300059426 Bacteria 1507
252 2842907793 2842903701 Bacteria 6986368
253 2923516799 2923516293 Bacteria 3716336
254 2929921692 2929921140 Bacteria 8649150
255 Ga0213876_10105790
256 JGI24737J22298_10038515
257 JGI24744J21845_10037287
258 JGI25160J50197_1000842
259 Ga0070670_100133824
260 Ga0070670_100178363
261 Ga0068869_100052343
262 Ga0068869_100063559
263 Ga0070666_10118249
264 Ga0068868_100051076
265 Ga0068868_100055416
266 Ga0070668_100045332
267 Ga0070668_100218587
268 Ga0070669_100063533
269 Ga0070675_100116614
270 Ga0070675_100280591
271 Ga0070674_100053435
272 Ga0070674_100091500
273 Ga0070673_100002639
274 Ga0070673_100068618
275 Ga0070673_100116598
276 Ga0070673_100743348
277 Ga0070688_100327006
278 Ga0070701_10212742
279 Ga0070705_100606830
280 Ga0070663_100296263
281 Ga0070678_100095421
282 Ga0070678_100118159
283 Ga0070662_100000013
284 Ga0070662_100092205
285 Ga0068867_100013674
286 Ga0068867_100061825
287 Ga0068867_100284438
288 Ga0070699_100361386
289 Ga0070684_100007033
290 Ga0068853_100741480
291 Ga0070672_100010677
292 Ga0070672_100160519
293 Ga0070665_100027777
294 Ga0070665_100518872
295 Ga0068854_100228658
296 Ga0068859_100028106
297 Ga0068859_100035563
298 Ga0068859_100098258
299 Ga0068864_100597472
300 Ga0068866_10021869
301 Ga0068866_10110213
302 Ga0068866_10239600
303 Ga0068861_100969451
304 Ga0068851_10022623
305 Ga0068870_10047634
306 Ga0068860_100228649
307 Ga0068860_100233160
308 Ga0068862_100570726
309 Ga0081539_10240401
310 Ga0097621_100017677
311 Ga0097621_100046603
312 Ga0097621_100180273
313 Ga0097621_100532890
314 Ga0068871_100033097
315 Ga0068871_100044505
316 Ga0068871_100717085
317 Ga0068871_100854137
318 Ga0075430_100149281
319 Ga0075431_100002917
320 Ga0075431_101153045
321 Ga0075429_100011748
322 Ga0075429_100024636
323 Ga0068865_100016686
324 Ga0097620_100028106
325 Ga0097620_100035563
326 Ga0097620_100098261
327 Ga0111539_10063370
328 Ga0111539_10144469
329 Ga0111539_10200647
330 Ga0105245_10265784
331 Ga0114129_10282107
332 Ga0114129_10590223
333 Ga0105241_10132412
334 Ga0105241_10260139
335 Ga0105242_10009424
336 Ga0105242_10015071
337 Ga0105242_10022154
338 Ga0105248_10770788
339 Ga0105238_10001237
340 Ga0105238_10036953
341 Ga0105249_10601457
342 Ga0105249_10670382
343 Ga0105239_10695120
344 Ga0105246_10014427
345 Ga0157371_10000578
346 Ga0157371_10147260
347 Ga0157370_10119898
348 Ga0157369_10048767
349 Ga0157369_11379697
350 Ga0157374_10094924
351 Ga0157378_10163852
352 Ga0157378_10286334
353 Ga0163162_10284159
354 Ga0163162_10697230
355 Ga0157375_10179283
356 Ga0157375_10236696
357 Ga0157375_10299874
358 Ga0163163_10000553
359 Ga0163163_10862928
360 Ga0182008_10040610
361 Ga0157377_10039553
362 Ga0163161_10190233
363 Ga0163161_10767977
364 Ga0213872_10003022
365 Ga0213876_10002268
366 Ga0209026_1000559
367 Ga0209026_1001858
368 Ga0207426_1000032
369 Ga0207682_10037328
370 Ga0207642_10285957
371 Ga0207688_10051665
372 Ga0207680_10134331
373 Ga0207647_10000044
374 Ga0207645_10000763
375 Ga0207654_10001733
376 Ga0207695_10045548
377 Ga0207695_10126509
378 Ga0207671_10002380
379 Ga0207671_10002807
380 Ga0207671_10005188
381 Ga0207694_10002932
382 Ga0207694_10301385
383 Ga0207650_10020713
384 Ga0207650_10042839
385 Ga0207650_10547445
386 Ga0207659_10033944
387 Ga0207659_10348507
388 Ga0207644_10006227
389 Ga0207644_10482580
390 Ga0207690_10177733
391 Ga0207706_10000173
392 Ga0207706_10498732
393 Ga0207686_10040161
394 Ga0207686_10187403
395 Ga0207704_10071151
396 Ga0207704_10212332
397 Ga0207691_10012667
398 Ga0207691_10034664
399 Ga0207689_10001199
400 Ga0207689_10008493
401 Ga0207689_10089040
402 Ga0207661_10005139
403 Ga0207651_10006992
404 Ga0207651_10123780
405 Ga0207712_10020005
406 Ga0207712_10142561
407 Ga0207668_10015310
408 Ga0207668_10133237
409 Ga0207668_10198237
410 Ga0207668_10405568
411 Ga0207640_10213986
412 Ga0207658_10006188
413 Ga0207677_10078475
414 Ga0207703_10044239
415 Ga0207678_10102707
416 Ga0207648_10005783
417 Ga0207648_10016765
418 Ga0207648_10117255
419 Ga0207648_10578335
420 Ga0207675_100420859
421 Ga0207683_10093215
422 Ga0207683_10101464
423 Ga0207683_10125751
424 Ga0207428_10098129
425 Ga0268266_10018579
426 Ga0268265_10023526
427 Ga0268265_10199499
428 Ga0268264_10010264
429 Ga0268264_10197183
430 Ga0307515_10001310
431 Ga0265332_10013540
432 Ga0265327_10007703
433 Ga0265327_10104444
434 Ga0307509_10028379
435 Ga0307408_100401910
436 Ga0307408_100543995
437 Ga0265314_10220142
438 Ga0316576_10230067
439 Ga0307413_10058719
440 Ga0307410_10269522
441 Ga0307409_100580031
442 Ga0307409_101417285
443 Ga0307416_100043613
444 Ga0307510_10004416
445 Ga0316584_0009019
446 Ga0395899_0000563
447 Ga0395900_0000173
448 Ga0395898_0070566
449 Ga0395905_0009847
450 Ga0395905_0041076
451 Ga0395901_0000294
452 Ga0436365_0004784
453 Ga0436365_0281988
454 Ga0436365_0425322
455 Ga0436365_1101370
456 Ga0436365_1238752
457 Ga0436361_0123021
458 Ga0451807_0317645
459 Ga0439448_0011847
460 Ga0439446_0043897
461 Ga0466968_0057734
462 Ga0466970_0057941
463 Ga0495585_0000838
464 Ga0495648_0005100
465 Ga0495668_0000044
466 Ga0495625_0001984
467 Ga0495625_0003910
468 Ga0495625_0315218
469 Ga0495625_0332865
470 Ga0495600_0070806
471 Ga0495672_0040098
472 Ga0495683_0040523
473 Ga0495687_123108
474 Ga0495686_0001308
475 Ga0495614_0004553
476 Ga0496124_0020192
477 Ga0495682_0064359
478 Ga0501033_0463510
479 Ga0501034_0309565
480 Ga0501040_0136712
481 Ga0501072_0346357
482 Ga0501238_006001
483 Ga0501044_0003228
484 nmdc:mga0k408_116_c3
485 nmdc:mga0k408_237_c1
486 nmdc:mga05p37_184457_c1
487 nmdc:mga05p37_652136_c1
488 nmdc:mga09592_138368_c1
489 nmdc:mga09592_77367_c1
490 nmdc:mga0qj67_459059_c1
491 nmdc:mga06r32_19127_c1
492 nmdc:mga08y16_180780_c1
493 nmdc:mga08y16_240386_c1
494 nmdc:mga0rr50_97038_c1
495 nmdc:mga0a205_19831_c1
496 Ga0500608_001862
497 Ga0500618_000061
498 Ga0500561_0178286
499 Ga0500616_0002344
500 Ga0500622_0000786
501 Ga0590071_000742
502 Ga0590074_017854
503 Ga0590075_000215
504 Ga0590075_066979
505 Ga0590077_017520
506 2842907793
507 2923516799
508 2929921692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13709

DUF4159

Domain of unknown function (DUF4159)

47

247

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.8197 7 206
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.8083 7 206
7am7-assembly3.cif.gz_C crystal structure of peptiligase mutant - m222p/l217h/a225n/f189w/n218d 0.5986 24 97
3a3p-assembly1.cif.gz_A crystal structure of complex between e201a/sa-subtilisin and tk-propeptide 0.5973 39 96
1bh6-assembly1.cif.gz_A subtilisin dy in complex with the synthetic inhibitor n-benzyloxycarbonyl-ala-pro-phe-chloromethyl ketone 0.5906 39 97
ID Description Score Start End Superfamily
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7964 7 206 3.40.50.12140
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7849 7 206 3.40.50.12140
af_Q4CVT1_429_588_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.6976 62 96 3.30.870.10
3hsiB01 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.6854 54 96 3.30.870.10
3ir7A07 Alpha Beta;3-Layer(aba) Sandwich;Dimethylsulfoxide Reductase; domain 2;Dimethylsulfoxide Reductase, domain 2 0.6384 54 105 3.40.228.10
ID Description Score Start End GO Terms
AF-A0A1I7I7J0-F1-model_v4 DUF4159 domain-containing protein 0.9923 6 208
AF-A0A7Y4VX50-F1-model_v4 DUF4159 domain-containing protein 0.9916 5 208
AF-A0A4D7JHL3-F1-model_v4 Twin-arginine translocation pathway signal 0.9909 4 208
AF-A0A4P8RGC5-F1-model_v4 Twin-arginine translocation pathway signal 0.9906 5 208
AF-A0A5B7WZN0-F1-model_v4 DUF4159 domain-containing protein 0.9904 5 208

Map