F364814

General Info

Members Datasets Scaffolds Average Seq Length
254 132 508 219

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10235646|Ga0111539_102356462
Length 237
Sequence LKRTSPGAVFFQIEEEVMFVRIALALFVIIAVAAPPAFAQKAEVGVWAGWTLSDGVSGNAFLAGDGNIYDRVDPKDGGSWGFNVGFLIGDNAEVGFMYGHEFSTLQISGTNDVEVGDLGITGYHGYFAYNFGDSTAKIRPFVFGGLGATSFSDVDFQTINRSGTISGESQFSTTWGAGVKVLANGRFGGRFAVRITPTYIKTDSVGWWCDPYWGCYLVGNAQYSNQFEFSGGVTARF

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
99 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
100 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
103 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.85
Metatranscriptomes 3.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 1.97
Rhizosphere 93.7
Stem 0
Stem Tuber 0
Unclassified 33.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10235646 3300009094 Bacteria 2131
2 MBSR1b_contig_9084504 2162886012 Unclassified 1740
3 Ga0058859_11563588 3300004798 Unclassified 1017
4 Ga0058859_11810933 3300004798 Bacteria 920
5 Ga0058859_11823357 3300004798 Unclassified 835
6 Ga0058860_10103903 3300004801 Bacteria 1360
7 Ga0058860_11306554 3300004801 Unclassified 739
8 Ga0058860_12229083 3300004801 Bacteria 1142
9 Ga0058860_12230151 3300004801 Unclassified 967
10 Ga0058862_12797356 3300004803 Bacteria 866
11 Ga0065714_10243772 3300005288 Bacteria 789
12 Ga0065704_10140439 3300005289 Unclassified 1523
13 Ga0065712_10074845 3300005290 Bacteria 3976
14 Ga0065712_10125987 3300005290 Unclassified 1607
15 Ga0065715_10101965 3300005293 Unclassified 3155
16 Ga0065715_10148698 3300005293 Bacteria 1755
17 Ga0065715_10226761 3300005293 Bacteria 1249
18 Ga0065715_10259665 3300005293 Unclassified 1117
19 Ga0065707_10085463 3300005295 Bacteria 6134
20 Ga0065707_10093662 3300005295 Bacteria 3596
21 Ga0070670_100053619 3300005331 Bacteria 3463
22 Ga0070677_10116487 3300005333 Bacteria 1200
23 Ga0068869_100209089 3300005334 Bacteria 1542
24 Ga0070680_100403756 3300005336 Bacteria 1165
25 Ga0070689_100065638 3300005340 Bacteria 2827
26 Ga0070689_100319849 3300005340 Unclassified 1296
27 Ga0070689_100959658 3300005340 Unclassified 759
28 Ga0070687_100460783 3300005343 Unclassified 848
29 Ga0070669_100001352 3300005353 Bacteria 17658
30 Ga0070669_100061447 3300005353 Bacteria 2761
31 Ga0070675_100032322 3300005354 Bacteria 4234
32 Ga0070675_100072929 3300005354 Bacteria 2850
33 Ga0070675_100082057 3300005354 Unclassified 2690
34 Ga0070675_100133142 3300005354 Unclassified 2120
35 Ga0070675_100177769 3300005354 Bacteria 1839
36 Ga0070675_100516062 3300005354 Bacteria 1078
37 Ga0070675_101074800 3300005354 Bacteria 740
38 Ga0070671_100105430 3300005355 Bacteria 2366
39 Ga0070674_100508652 3300005356 Bacteria 1004
40 Ga0070674_100693136 3300005356 Unclassified 870
41 Ga0070673_100006369 3300005364 Bacteria 7669
42 Ga0070673_100122477 3300005364 Unclassified 2172
43 Ga0070673_100358828 3300005364 Bacteria 1295
44 Ga0070688_100106262 3300005365 Bacteria 1859
45 Ga0070703_10063892 3300005406 Bacteria 1211
46 Ga0070701_10298576 3300005438 Unclassified 989
47 Ga0070700_100180944 3300005441 Bacteria 1467
48 Ga0070700_100185732 3300005441 Unclassified 1450
49 Ga0070694_100039203 3300005444 Unclassified 3152
50 Ga0070694_100135143 3300005444 Bacteria 1786
51 Ga0070678_100004068 3300005456 Bacteria 8235
52 Ga0070662_100335232 3300005457 Bacteria 1236
53 Ga0068867_101029342 3300005459 Unclassified 748
54 Ga0070699_100467346 3300005518 Bacteria 1144
55 Ga0070672_100037218 3300005543 Unclassified 3711
56 Ga0070672_100118822 3300005543 Bacteria 2162
57 Ga0070672_100469813 3300005543 Bacteria 1085
58 Ga0070672_100543307 3300005543 Unclassified 1008
59 Ga0070686_100024451 3300005544 Bacteria 3621
60 Ga0070686_100255159 3300005544 Unclassified 1283
61 Ga0070696_100859327 3300005546 Bacteria 750
62 Ga0070704_100207266 3300005549 Bacteria 1586
63 Ga0070704_100476349 3300005549 Bacteria 1079
64 Ga0070704_100689690 3300005549 Unclassified 905
65 Ga0070664_100246523 3300005564 Bacteria 1605
66 Ga0070664_100310271 3300005564 Unclassified 1427
67 Ga0070664_100379562 3300005564 Unclassified 1290
68 Ga0068857_100281576 3300005577 Bacteria 1530
69 Ga0068859_100072768 3300005617 Unclassified 3474
70 Ga0068859_100078339 3300005617 Unclassified 3345
71 Ga0068859_100230776 3300005617 Bacteria 1939
72 Ga0068864_100558793 3300005618 Bacteria 1107
73 Ga0068866_10119991 3300005718 Bacteria 1480
74 Ga0068861_100053502 3300005719 Unclassified 3072
75 Ga0068861_100641901 3300005719 Unclassified 980
76 Ga0068870_10403329 3300005840 Unclassified 890
77 Ga0068858_100656959 3300005842 Bacteria 1019
78 Ga0068862_100176719 3300005844 Bacteria 1914
79 Ga0068862_100586386 3300005844 Unclassified 1069
80 Ga0075363_100413154 3300006048 Bacteria 794
81 Ga0075367_10025150 3300006178 Bacteria 3365
82 Ga0097621_100010547 3300006237 Bacteria 6768
83 Ga0075370_10306303 3300006353 Unclassified 945
84 Ga0068871_100111924 3300006358 Bacteria 2297
85 Ga0075428_100000012 3300006844 Bacteria 176329
86 Ga0075428_100004392 3300006844 Bacteria 15567
87 Ga0075428_100012183 3300006844 Bacteria 9563
88 Ga0075428_100029476 3300006844 Bacteria 6072
89 Ga0075428_100528537 3300006844 Bacteria 1261
90 Ga0075428_100766902 3300006844 Unclassified 1026
91 Ga0075428_100841725 3300006844 Unclassified 974
92 Ga0075430_100412557 3300006846 Bacteria 1115
93 Ga0075431_100012583 3300006847 Bacteria 8541
94 Ga0075431_100050965 3300006847 Bacteria 4268
95 Ga0075431_100311818 3300006847 Bacteria 1588
96 Ga0075431_100429107 3300006847 Bacteria 1320
97 Ga0075434_100016637 3300006871 Bacteria 7072
98 Ga0075429_100033159 3300006880 Bacteria 4487
99 Ga0075429_100092619 3300006880 Bacteria 2636
100 Ga0075429_100963891 3300006880 Unclassified 746
101 Ga0068865_100994123 3300006881 Unclassified 734
102 Ga0097620_100072769 3300006931 Unclassified 3474
103 Ga0097620_100078339 3300006931 Unclassified 3345
104 Ga0097620_100230776 3300006931 Bacteria 1939
105 Ga0075435_100011408 3300007076 Bacteria 6535
106 Ga0111539_10000001 3300009094 Bacteria 1035431
107 Ga0111539_10000032 3300009094 Bacteria 159626
108 Ga0111539_10001361 3300009094 Bacteria 32552
109 Ga0111539_10004175 3300009094 Bacteria 18951
110 Ga0111539_10006309 3300009094 Bacteria 15299
111 Ga0111539_10019789 3300009094 Bacteria 8300
112 Ga0111539_10042638 3300009094 Bacteria 5446
113 Ga0111539_10046024 3300009094 Bacteria 5221
114 Ga0111539_10083729 3300009094 Bacteria 3750
115 Ga0111539_10109178 3300009094 Bacteria 3247
116 Ga0114129_10020822 3300009147 Bacteria 9315
117 Ga0114129_10023566 3300009147 Bacteria 8725
118 Ga0114129_10070489 3300009147 Bacteria 4874
119 Ga0114129_11533452 3300009147 Unclassified 818
120 Ga0114129_11633540 3300009147 Bacteria 788
121 Ga0105243_10394030 3300009148 Bacteria 1284
122 Ga0105248_10078783 3300009177 Unclassified 3704
123 Ga0105248_10216187 3300009177 Bacteria 2159
124 Ga0105248_10603724 3300009177 Unclassified 1238
125 Ga0105249_10002171 3300009553 Bacteria 16993
126 Ga0105249_10549996 3300009553 Unclassified 1205
127 Ga0157375_10256229 3300013308 Unclassified 1911
128 Ga0157375_10984904 3300013308 Bacteria 983
129 Ga0163163_10000017 3300014325 Bacteria 208781
130 Ga0157380_10002298 3300014326 Bacteria 12844
131 Ga0157380_10119098 3300014326 Bacteria 2233
132 Ga0157380_10270041 3300014326 Bacteria 1550
133 Ga0157380_10476774 3300014326 Bacteria 1206
134 Ga0157376_10117700 3300014969 Bacteria 2350
135 Ga0157376_10535478 3300014969 Bacteria 1157
136 Ga0163161_10605842 3300017792 Unclassified 903
137 Ga0207682_10137807 3300025893 Bacteria 1093
138 Ga0207643_10232765 3300025908 Bacteria 1130
139 Ga0207660_10113330 3300025917 Bacteria 2044
140 Ga0207681_10005766 3300025923 Bacteria 7596
141 Ga0207681_10017591 3300025923 Bacteria 4491
142 Ga0207650_10031062 3300025925 Bacteria 3855
143 Ga0207659_10005034 3300025926 Bacteria 8012
144 Ga0207659_10038304 3300025926 Bacteria 3334
145 Ga0207659_10156917 3300025926 Unclassified 1783
146 Ga0207659_10598943 3300025926 Unclassified 939
147 Ga0207659_10637534 3300025926 Unclassified 910
148 Ga0207644_10501366 3300025931 Bacteria 1001
149 Ga0207670_10047647 3300025936 Bacteria 2856
150 Ga0207669_10510056 3300025937 Unclassified 964
151 Ga0207704_10865062 3300025938 Unclassified 758
152 Ga0207691_10042190 3300025940 Unclassified 4206
153 Ga0207691_10047687 3300025940 Unclassified 3931
154 Ga0207689_10128982 3300025942 Bacteria 2081
155 Ga0207679_10380170 3300025945 Bacteria 1238
156 Ga0207651_10104461 3300025960 Bacteria 2111
157 Ga0207651_10132294 3300025960 Unclassified 1912
158 Ga0207651_10546785 3300025960 Bacteria 1006
159 Ga0207712_10328805 3300025961 Unclassified 1264
160 Ga0207658_10891369 3300025986 Unclassified 810
161 Ga0207658_10984949 3300025986 Unclassified 769
162 Ga0207677_10126734 3300026023 Unclassified 1931
163 Ga0207708_10171157 3300026075 Bacteria 1720
164 Ga0207676_10937991 3300026095 Bacteria 850
165 Ga0207674_10785997 3300026116 Unclassified 919
166 Ga0207675_100217668 3300026118 Bacteria 1839
167 Ga0207675_100345816 3300026118 Unclassified 1456
168 Ga0207683_10012120 3300026121 Bacteria 7359
169 Ga0207683_10139341 3300026121 Unclassified 2185
170 Ga0209983_1015441 3300027665 Unclassified 1575
171 Ga0209966_1028687 3300027695 Bacteria 1119
172 Ga0209974_10026655 3300027876 Unclassified 1913
173 Ga0207428_10000205 3300027907 Bacteria 82100
174 Ga0207428_10003659 3300027907 Bacteria 14816
175 Ga0207428_10008956 3300027907 Bacteria 9015
176 Ga0207428_10030970 3300027907 Bacteria 4419
177 Ga0207428_10060187 3300027907 Bacteria 3009
178 Ga0207428_10126355 3300027907 Unclassified 1958
179 Ga0268265_10100491 3300028380 Bacteria 2335
180 Ga0268265_10145917 3300028380 Bacteria 1988
181 Ga0268265_10437621 3300028380 Bacteria 1218
182 Ga0316575_10124273 3300031665 Unclassified 1056
183 Ga0316576_10143078 3300031727 Unclassified 1801
184 Ga0373935_0798661 3300035692 Bacteria 697
185 Ga0451807_1728737 3300041486 Unclassified 843
186 Ga0451853_1944009 3300041512 Bacteria 1731
187 Ga0450923_004164 3300042125 Bacteria 2252
188 Ga0439435_0019838 3300042436 Bacteria 1728
189 Ga0439460_0118222 3300042461 Unclassified 865
190 Ga0451576_0006895 3300045051 Bacteria 13754
191 Ga0451576_0240209 3300045051 Bacteria 1892
192 Ga0495621_0128955 3300046539 Unclassified 983
193 Ga0495656_0122878 3300046615 Unclassified 1227
194 Ga0496101_0752560 3300048904 Unclassified 769
195 Ga0496109_0612326 3300048912 Bacteria 1025
196 Ga0496113_0112830 3300048916 Bacteria 2118
197 Ga0496114_0553495 3300048917 Unclassified 1016
198 Ga0501039_0178572 3300049575 Unclassified 1670
199 Ga0501039_0263440 3300049575 Unclassified 1355
200 Ga0501039_0499236 3300049575 Unclassified 955
201 Ga0501040_0640941 3300049576 Bacteria 768
202 Ga0501041_0144014 3300049577 Bacteria 1487
203 Ga0501041_0186591 3300049577 Archaea 1299
204 Ga0501042_0061417 3300049578 Bacteria 2685
205 Ga0501042_0620952 3300049578 Unclassified 786
206 Ga0501046_0727858 3300049580 Unclassified 698
207 Ga0501048_0112011 3300049582 Unclassified 1927
208 Ga0501071_0039364 3300049587 Bacteria 3382
209 Ga0501072_0057099 3300049588 Bacteria 3076
210 Ga0501072_0191290 3300049588 Unclassified 1632
211 Ga0501073_0235421 3300049589 Bacteria 1265
212 Ga0501073_0555039 3300049589 Bacteria 794
213 Ga0501075_0049336 3300049591 Bacteria 3164
214 Ga0501075_0197718 3300049591 Bacteria 1533
215 Ga0501075_0379958 3300049591 Bacteria 1077
216 Ga0501076_0027742 3300049592 Bacteria 4391
217 Ga0501076_0218874 3300049592 Bacteria 1556
218 Ga0501077_0100480 3300049593 Bacteria 1833
219 Ga0501079_0033049 3300049741 Unclassified 3979
220 Ga0501079_0548623 3300049741 Unclassified 909
221 Ga0501080_0456596 3300049742 Bacteria 1145
222 Ga0501081_0140617 3300049743 Bacteria 1730
223 Ga0501081_0288578 3300049743 Bacteria 1202
224 Ga0501081_0632943 3300049743 Unclassified 801
225 Ga0501045_0053439 3300049824 Bacteria 2952
226 nmdc:mga05p37_1457_c2 3300050507 Bacteria 23873
227 nmdc:mga05p37_283204_c1 3300050507 Unclassified 1976
228 nmdc:mga09592_31930_c1 3300050508 Bacteria 4389
229 nmdc:mga09592_70278_c1 3300050508 Bacteria 2970
230 nmdc:mga06r32_25271_c1 3300050510 Bacteria 5524
231 nmdc:mga06r32_278053_c1 3300050510 Bacteria 1661
232 nmdc:mga06r32_346248_c1 3300050510 Bacteria 1471
233 nmdc:mga06r32_396494_c1 3300050510 Bacteria 1362
234 nmdc:mga06r32_419883_c1 3300050510 Bacteria 1319
235 nmdc:mga08y16_1294_c1 3300050511 Bacteria 24821
236 nmdc:mga08y16_169049_c1 3300050511 Bacteria 2271
237 nmdc:mga08y16_17799_c1 3300050511 Bacteria 7485
238 nmdc:mga08y16_22326_c1 3300050511 Bacteria 6678
239 nmdc:mga08y16_230_c1 3300050511 Bacteria 50237
240 nmdc:mga08y16_285686_c1 3300050511 Bacteria 1701
241 nmdc:mga08y16_36166_c1 3300050511 Bacteria 5186
242 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
243 nmdc:mga08y16_80134_c1 3300050511 Bacteria 3404
244 nmdc:mga08y16_803112_c1 3300050511 Unclassified 933
245 nmdc:mga0n895_380605_c1 3300050512 Unclassified 1428
246 nmdc:mga0n895_54977_c1 3300050512 Bacteria 3917
247 nmdc:mga0rr50_118574_c1 3300050513 Bacteria 2103
248 nmdc:mga0a205_301216_c1 3300050515 Unclassified 1476
249 nmdc:mga0a205_329283_c1 3300050515 Bacteria 1397
250 nmdc:mga0a205_84551_c1 3300050515 Bacteria 3065
251 Ga0501082_0065274 3300060353 Bacteria 3135
252 Ga0501082_0298804 3300060353 Bacteria 1402
253 Ga0530510_0089538 3300061734 Bacteria 2244
254 Ga0530510_0788390 3300061734 Unclassified 725
255 Ga0111539_10235646
256 MBSR1b_contig_9084504
257 Ga0058859_11563588
258 Ga0058859_11810933
259 Ga0058859_11823357
260 Ga0058860_10103903
261 Ga0058860_11306554
262 Ga0058860_12229083
263 Ga0058860_12230151
264 Ga0058862_12797356
265 Ga0065714_10243772
266 Ga0065704_10140439
267 Ga0065712_10074845
268 Ga0065712_10125987
269 Ga0065715_10101965
270 Ga0065715_10148698
271 Ga0065715_10226761
272 Ga0065715_10259665
273 Ga0065707_10085463
274 Ga0065707_10093662
275 Ga0070670_100053619
276 Ga0070677_10116487
277 Ga0068869_100209089
278 Ga0070680_100403756
279 Ga0070689_100065638
280 Ga0070689_100319849
281 Ga0070689_100959658
282 Ga0070687_100460783
283 Ga0070669_100001352
284 Ga0070669_100061447
285 Ga0070675_100032322
286 Ga0070675_100072929
287 Ga0070675_100082057
288 Ga0070675_100133142
289 Ga0070675_100177769
290 Ga0070675_100516062
291 Ga0070675_101074800
292 Ga0070671_100105430
293 Ga0070674_100508652
294 Ga0070674_100693136
295 Ga0070673_100006369
296 Ga0070673_100122477
297 Ga0070673_100358828
298 Ga0070688_100106262
299 Ga0070703_10063892
300 Ga0070701_10298576
301 Ga0070700_100180944
302 Ga0070700_100185732
303 Ga0070694_100039203
304 Ga0070694_100135143
305 Ga0070678_100004068
306 Ga0070662_100335232
307 Ga0068867_101029342
308 Ga0070699_100467346
309 Ga0070672_100037218
310 Ga0070672_100118822
311 Ga0070672_100469813
312 Ga0070672_100543307
313 Ga0070686_100024451
314 Ga0070686_100255159
315 Ga0070696_100859327
316 Ga0070704_100207266
317 Ga0070704_100476349
318 Ga0070704_100689690
319 Ga0070664_100246523
320 Ga0070664_100310271
321 Ga0070664_100379562
322 Ga0068857_100281576
323 Ga0068859_100072768
324 Ga0068859_100078339
325 Ga0068859_100230776
326 Ga0068864_100558793
327 Ga0068866_10119991
328 Ga0068861_100053502
329 Ga0068861_100641901
330 Ga0068870_10403329
331 Ga0068858_100656959
332 Ga0068862_100176719
333 Ga0068862_100586386
334 Ga0075363_100413154
335 Ga0075367_10025150
336 Ga0097621_100010547
337 Ga0075370_10306303
338 Ga0068871_100111924
339 Ga0075428_100000012
340 Ga0075428_100004392
341 Ga0075428_100012183
342 Ga0075428_100029476
343 Ga0075428_100528537
344 Ga0075428_100766902
345 Ga0075428_100841725
346 Ga0075430_100412557
347 Ga0075431_100012583
348 Ga0075431_100050965
349 Ga0075431_100311818
350 Ga0075431_100429107
351 Ga0075434_100016637
352 Ga0075429_100033159
353 Ga0075429_100092619
354 Ga0075429_100963891
355 Ga0068865_100994123
356 Ga0097620_100072769
357 Ga0097620_100078339
358 Ga0097620_100230776
359 Ga0075435_100011408
360 Ga0111539_10000001
361 Ga0111539_10000032
362 Ga0111539_10001361
363 Ga0111539_10004175
364 Ga0111539_10006309
365 Ga0111539_10019789
366 Ga0111539_10042638
367 Ga0111539_10046024
368 Ga0111539_10083729
369 Ga0111539_10109178
370 Ga0114129_10020822
371 Ga0114129_10023566
372 Ga0114129_10070489
373 Ga0114129_11533452
374 Ga0114129_11633540
375 Ga0105243_10394030
376 Ga0105248_10078783
377 Ga0105248_10216187
378 Ga0105248_10603724
379 Ga0105249_10002171
380 Ga0105249_10549996
381 Ga0157375_10256229
382 Ga0157375_10984904
383 Ga0163163_10000017
384 Ga0157380_10002298
385 Ga0157380_10119098
386 Ga0157380_10270041
387 Ga0157380_10476774
388 Ga0157376_10117700
389 Ga0157376_10535478
390 Ga0163161_10605842
391 Ga0207682_10137807
392 Ga0207643_10232765
393 Ga0207660_10113330
394 Ga0207681_10005766
395 Ga0207681_10017591
396 Ga0207650_10031062
397 Ga0207659_10005034
398 Ga0207659_10038304
399 Ga0207659_10156917
400 Ga0207659_10598943
401 Ga0207659_10637534
402 Ga0207644_10501366
403 Ga0207670_10047647
404 Ga0207669_10510056
405 Ga0207704_10865062
406 Ga0207691_10042190
407 Ga0207691_10047687
408 Ga0207689_10128982
409 Ga0207679_10380170
410 Ga0207651_10104461
411 Ga0207651_10132294
412 Ga0207651_10546785
413 Ga0207712_10328805
414 Ga0207658_10891369
415 Ga0207658_10984949
416 Ga0207677_10126734
417 Ga0207708_10171157
418 Ga0207676_10937991
419 Ga0207674_10785997
420 Ga0207675_100217668
421 Ga0207675_100345816
422 Ga0207683_10012120
423 Ga0207683_10139341
424 Ga0209983_1015441
425 Ga0209966_1028687
426 Ga0209974_10026655
427 Ga0207428_10000205
428 Ga0207428_10003659
429 Ga0207428_10008956
430 Ga0207428_10030970
431 Ga0207428_10060187
432 Ga0207428_10126355
433 Ga0268265_10100491
434 Ga0268265_10145917
435 Ga0268265_10437621
436 Ga0316575_10124273
437 Ga0316576_10143078
438 Ga0373935_0798661
439 Ga0451807_1728737
440 Ga0451853_1944009
441 Ga0450923_004164
442 Ga0439435_0019838
443 Ga0439460_0118222
444 Ga0451576_0006895
445 Ga0451576_0240209
446 Ga0495621_0128955
447 Ga0495656_0122878
448 Ga0496101_0752560
449 Ga0496109_0612326
450 Ga0496113_0112830
451 Ga0496114_0553495
452 Ga0501039_0178572
453 Ga0501039_0263440
454 Ga0501039_0499236
455 Ga0501040_0640941
456 Ga0501041_0144014
457 Ga0501041_0186591
458 Ga0501042_0061417
459 Ga0501042_0620952
460 Ga0501046_0727858
461 Ga0501048_0112011
462 Ga0501071_0039364
463 Ga0501072_0057099
464 Ga0501072_0191290
465 Ga0501073_0235421
466 Ga0501073_0555039
467 Ga0501075_0049336
468 Ga0501075_0197718
469 Ga0501075_0379958
470 Ga0501076_0027742
471 Ga0501076_0218874
472 Ga0501077_0100480
473 Ga0501079_0033049
474 Ga0501079_0548623
475 Ga0501080_0456596
476 Ga0501081_0140617
477 Ga0501081_0288578
478 Ga0501081_0632943
479 Ga0501045_0053439
480 nmdc:mga05p37_1457_c2
481 nmdc:mga05p37_283204_c1
482 nmdc:mga09592_31930_c1
483 nmdc:mga09592_70278_c1
484 nmdc:mga06r32_25271_c1
485 nmdc:mga06r32_278053_c1
486 nmdc:mga06r32_346248_c1
487 nmdc:mga06r32_396494_c1
488 nmdc:mga06r32_419883_c1
489 nmdc:mga08y16_1294_c1
490 nmdc:mga08y16_169049_c1
491 nmdc:mga08y16_17799_c1
492 nmdc:mga08y16_22326_c1
493 nmdc:mga08y16_230_c1
494 nmdc:mga08y16_285686_c1
495 nmdc:mga08y16_36166_c1
496 nmdc:mga08y16_3_c1
497 nmdc:mga08y16_80134_c1
498 nmdc:mga08y16_803112_c1
499 nmdc:mga0n895_380605_c1
500 nmdc:mga0n895_54977_c1
501 nmdc:mga0rr50_118574_c1
502 nmdc:mga0a205_301216_c1
503 nmdc:mga0a205_329283_c1
504 nmdc:mga0a205_84551_c1
505 Ga0501082_0065274
506 Ga0501082_0298804
507 Ga0530510_0089538
508 Ga0530510_0788390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05736

OprF

OprF membrane domain

24

197

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1p4t-assembly1.cif.gz_A crystal structure of neisserial surface protein a (nspa) 0.7721 27 222
1p4t-assembly1.cif.gz_A crystal structure of neisserial surface protein a (nspa) 0.7443 27 222
3nb3-assembly1.cif.gz_A the host outer membrane proteins ompa and ompc are packed at specific sites in the shigella phage sf6 virion as structural components 0.7405 23 222
4rlc-assembly1.cif.gz_A crystal structure of the n-terminal beta-barrel domain of pseudomonas aeruginosa oprf 0.7287 23 222
2x27-assembly1.cif.gz_X crystal structure of the outer membrane protein oprg from pseudomonas aeruginosa 0.7252 23 222
ID Description Score Start End Superfamily
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.7721 27 222 2.40.160.20
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.7443 27 222 2.40.160.20
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.7405 23 222 2.40.160.20
4rlcA00 Mainly Beta;Beta Barrel;Porin; 0.7287 23 222 2.40.160.20
2x27X00 Mainly Beta;Beta Barrel;Porin; 0.7252 23 222 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A2E2NWQ7-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8358 25 222
AF-A0A2S7KSJ4-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8154 23 222
AF-A0A7R8B747-F1-model_v4 deleted 0.8119 19 222
AF-A0A7V2MF65-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.7951 15 222
AF-A0A838NG16-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.7938 27 222

Map