F364784

General Info

Members Datasets Scaffolds Average Seq Length
254 176 135 274

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100003177|Ga0075430_1000031777
Length 303
Sequence VTAPTARTNAEGESMPEGRHSTGSRLYVDGATVGYDRRVVSEGLSVSIPDASFTVIVGPNACGKSTLLRALCRLLRPGSGHVILDGADIGAYKTKEVARRVGLLPQTSISPDGITVADLVARGRYPHQGFLRQWTEADEDAVARAMDQTAVTDLSGRLVDELSGGQRQRVWVAMALAQHADILLLDEPTTFLDIAHQIELLELFTDLHHVGHTLVAVLHDLNHAARYGTHLIAMKDGNVVAVGPPEEVVTAELVEEVFGLRCLVVPDPAVGTPQVVPLGRERARPEHAAGDAAHSLARKERKA

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
7 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
8 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
9 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
10 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
11 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
12 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
13 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
14 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
15 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
16 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
17 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
18 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
19 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
20 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
21 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
22 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
23 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
24 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
25 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
26 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
27 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
28 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
29 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
30 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
31 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
32 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
33 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
34 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
35 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
36 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
37 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
38 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
39 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
40 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
41 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
42 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
43 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
44 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
45 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
46 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
47 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
48 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
49 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
50 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
51 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
52 2636415599 Klebsiella variicola DX120E Isolate Unclassified
53 2643221553 Microbacterium sp. Root553 Isolate Unclassified
54 2643221613 Oerskovia sp. Root22 Isolate Unclassified
55 2643221721 Oerskovia sp. Root918 Isolate Unclassified
56 2671180195 Frankia sp. CcI49 Isolate Nodule
57 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
58 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
59 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
60 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
61 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
62 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
63 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
64 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
65 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
66 2773857922 Frankia sp. CcI49 Isolate Nodule
67 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
68 2775507074 Klebsiella sp. D5A Isolate Unclassified
69 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
70 2821118458 Enterobacter asburiae 609 Isolate Unclassified
71 2847085930 Erwinia persicina B64 Isolate Bulb
72 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
73 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
74 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
75 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
76 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
77 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
78 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
79 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
80 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
81 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
82 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
83 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
84 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
85 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
86 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
87 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
88 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
89 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
90 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
91 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
92 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
93 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
94 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
95 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
96 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
97 2937967321 Serratia sp. YC16 Isolate Unclassified
98 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
99 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
100 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
101 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
102 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
103 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
104 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
105 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
106 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
107 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
108 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
115 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
122 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
123 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
124 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
125 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
133 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
140 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
141 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
142 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
164 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
165 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
166 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
167 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
168 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
169 8004592986 Serratia sp. S119 Isolate Unclassified
170 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
171 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
172 8018221730 Enterobacter sp. CM29 Isolate Unclassified
173 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
174 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
175 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere
176 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 53.15
Metatranscriptomes 0
Isolates 46.85

Biome Distribution

Category Percentage (%)
Aerial Root 1.57
Bulb 0.39
Endosphere 6.3
Nodule 3.15
Rhizoplane 16.93
Rhizosphere 31.89
Stem 0
Stem Tuber 0.79
Unclassified 38.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100000498 3300005355 Bacteria 27450
2 Ga0068851_10009100 3300005834 Bacteria 4611
3 Ga0075365_10036885 3300006038 Bacteria 3170
4 Ga0075365_10212620 3300006038 Bacteria 1356
5 Ga0075365_10256022 3300006038 Bacteria 1230
6 Ga0075364_10036117 3300006051 Bacteria 3194
7 Ga0075364_10083269 3300006051 Bacteria 2117
8 Ga0075370_10008484 3300006353 Bacteria 5290
9 Ga0075370_10052360 3300006353 Bacteria 2316
10 Ga0075430_100003177 3300006846 Bacteria 13757
11 Ga0079104_1002352 3300006946 Bacteria 10343
12 Ga0105251_10003166 3300009011 Bacteria 12179
13 Ga0105251_10045083 3300009011 Bacteria 2127
14 Ga0105251_10049252 3300009011 Bacteria 2017
15 Ga0105244_10000015 3300009036 Bacteria 256814
16 Ga0105244_10010065 3300009036 Bacteria 5756
17 Ga0105244_10027374 3300009036 Bacteria 3073
18 Ga0105250_10000053 3300009092 Bacteria 114563
19 Ga0105250_10022157 3300009092 Bacteria 2563
20 Ga0105243_10022499 3300009148 Bacteria 4792
21 Ga0157371_10009764 3300013102 Bacteria 7529
22 Ga0157371_10122515 3300013102 Bacteria 1849
23 Ga0157369_10064229 3300013105 Bacteria 3954
24 Ga0157369_10150610 3300013105 Bacteria 2458
25 Ga0183366_1002 3300015679 Bacteria 791639
26 Ga0183370_1002 3300015680 Bacteria 791639
27 Ga0183369_1002 3300015685 Bacteria 791621
28 Ga0183368_1005 3300015687 Bacteria 791621
29 Ga0209147_100028 3300025229 Bacteria 383994
30 Ga0209051_1001556 3300025303 Bacteria 18974
31 Ga0207696_1000116 3300025711 Bacteria 148125
32 Ga0207696_1033813 3300025711 Bacteria 1531
33 Ga0207655_1000050 3300025728 Bacteria 294923
34 Ga0207655_1000061 3300025728 Bacteria 258893
35 Ga0207655_1005231 3300025728 Bacteria 8908
36 Ga0207655_1011145 3300025728 Bacteria 5380
37 Ga0207713_1000003 3300025735 Bacteria 860698
38 Ga0207713_1001634 3300025735 Bacteria 17473
39 Ga0207713_1002630 3300025735 Bacteria 12917
40 Ga0207713_1009687 3300025735 Bacteria 5401
41 Ga0207713_1017422 3300025735 Bacteria 3601
42 Ga0207644_10001027 3300025931 Bacteria 17865
43 Ga0207678_10539861 3300026067 Bacteria 1019
44 Ga0209281_1000603 3300027111 Bacteria 40741
45 Ga0209371_1004256 3300027312 Bacteria 6357
46 Ga0209371_1022724 3300027312 Bacteria 1492
47 Ga0209371_1028450 3300027312 Bacteria 1248
48 Ga0307515_10005103 3300028794 Bacteria 26677
49 Ga0307515_10028672 3300028794 Bacteria 9450
50 Ga0307515_10120454 3300028794 Bacteria 2976
51 Ga0268256_1003996 3300030500 Bacteria 6357
52 Ga0268256_1032322 3300030500 Bacteria 1248
53 Ga0307406_10023223 3300031901 Bacteria 3687
54 Ga0307414_10343266 3300032004 Bacteria 1279
55 Ga0395901_0059806 3300038443 Bacteria 3964
56 Ga0451791_1438364 3300041451 Bacteria 1061
57 Ga0439452_000423 3300042010 Bacteria 24568
58 Ga0495605_0051501 3300046474 Bacteria 2005
59 Ga0495679_029270 3300047446 Bacteria 1798
60 Ga0496102_0000012 3300048905 Bacteria 315470
61 Ga0496102_0014517 3300048905 Bacteria 6844
62 Ga0496116_0000140 3300048919 Bacteria 151165
63 Ga0496116_0008599 3300048919 Bacteria 8834
64 Ga0496116_0048754 3300048919 Bacteria 2839
65 Ga0496117_0001190 3300048920 Bacteria 39141
66 Ga0496117_0009036 3300048920 Bacteria 9368
67 Ga0496117_0044539 3300048920 Bacteria 3213
68 Ga0496117_0059345 3300048920 Bacteria 2643
69 Ga0496117_0067229 3300048920 Bacteria 2426
70 Ga0496118_0008770 3300048921 Bacteria 10366
71 Ga0496118_0022009 3300048921 Bacteria 5590
72 Ga0496118_0025779 3300048921 Bacteria 5030
73 Ga0496118_0083974 3300048921 Bacteria 2224
74 Ga0496118_0120116 3300048921 Bacteria 1716
75 Ga0496119_0000115 3300048922 Bacteria 114194
76 Ga0496119_0000814 3300048922 Bacteria 41672
77 Ga0496119_0001557 3300048922 Bacteria 27320
78 Ga0496119_0002794 3300048922 Bacteria 18718
79 Ga0496119_0003577 3300048922 Bacteria 16047
80 Ga0496119_0011478 3300048922 Bacteria 7327
81 Ga0496119_0012877 3300048922 Bacteria 6737
82 Ga0496119_0013404 3300048922 Bacteria 6535
83 Ga0496119_0087727 3300048922 Bacteria 1775
84 Ga0496119_0096824 3300048922 Bacteria 1664
85 Ga0496120_0000048 3300048923 Bacteria 187988
86 Ga0496120_0000060 3300048923 Bacteria 175196
87 Ga0496120_0001332 3300048923 Bacteria 30475
88 Ga0496120_0006242 3300048923 Bacteria 9204
89 Ga0496120_0008805 3300048923 Bacteria 7251
90 Ga0496120_0009155 3300048923 Bacteria 7061
91 Ga0496120_0011989 3300048923 Bacteria 5926
92 Ga0496120_0014125 3300048923 Bacteria 5333
93 Ga0496120_0015799 3300048923 Bacteria 4961
94 Ga0496121_0023809 3300048924 Bacteria 5879
95 Ga0496122_0000020 3300048925 Bacteria 401675
96 Ga0496122_0015701 3300048925 Bacteria 7220
97 Ga0496122_0021134 3300048925 Bacteria 5840
98 Ga0496122_0041245 3300048925 Bacteria 3653
99 Ga0496122_0129430 3300048925 Bacteria 1608
100 Ga0496122_0213749 3300048925 Bacteria 1114
101 Ga0496123_0000003 3300048926 Bacteria 866556
102 Ga0496123_0012305 3300048926 Bacteria 7309
103 Ga0496123_0039976 3300048926 Bacteria 3274
104 Ga0496123_0145673 3300048926 Bacteria 1287
105 Ga0496124_0000028 3300048927 Bacteria 357219
106 Ga0496124_0002725 3300048927 Bacteria 22524
107 Ga0496124_0005291 3300048927 Bacteria 14597
108 Ga0496124_0021233 3300048927 Bacteria 5986
109 Ga0496124_0032530 3300048927 Bacteria 4604
110 Ga0496124_0068263 3300048927 Bacteria 2955
111 Ga0496125_0000074 3300048928 Bacteria 235549
112 Ga0496125_0001412 3300048928 Bacteria 35063
113 Ga0496125_0003093 3300048928 Bacteria 20755
114 Ga0496125_0009984 3300048928 Bacteria 9649
115 Ga0496125_0011536 3300048928 Bacteria 8830
116 Ga0496125_0016008 3300048928 Bacteria 7220
117 Ga0496125_0016350 3300048928 Bacteria 7129
118 Ga0496125_0036413 3300048928 Bacteria 4297
119 Ga0496125_0056918 3300048928 Bacteria 3171
120 Ga0496126_0003323 3300048929 Bacteria 20460
121 Ga0496126_0011890 3300048929 Bacteria 8951
122 Ga0496126_0078831 3300048929 Bacteria 2917
123 Ga0496126_0101480 3300048929 Bacteria 2516
124 Ga0501031_0022310 3300049568 Bacteria 4126
125 Ga0501032_0030561 3300049569 Bacteria 3696
126 Ga0501034_0506663 3300049571 Bacteria 1120
127 Ga0501042_0248441 3300049578 Bacteria 1284
128 nmdc:mga00v17_150913_c1 3300050491 Bacteria 1493
129 nmdc:mga0yw44_35318_c1 3300050492 Bacteria 2937
130 nmdc:mga07m45_29074_c1 3300050496 Bacteria 3053
131 nmdc:mga0qj67_3103_c1 3300050509 Bacteria 11951
132 Ga0500643_000216 3300053087 Bacteria 54230
133 Ga0500593_000113 3300053117 Bacteria 31265
134 Ga0500573_0001668 3300053140 Bacteria 10782
135 Ga0500634_0022748 3300053161 Bacteria 3404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006051 Ga0075364_10083269 Ga0075364_100832692 239
2 3300006353 Ga0075370_10052360 Ga0075370_100523602 239
3 3300025303 Ga0209051_1001556 Ga0209051_10015562 245
4 3300025728 Ga0207655_1005231 Ga0207655_10052317 245
5 3300048919 Ga0496116_0048754 Ga0496116_0048754_760_1515 251
6 3300048920 Ga0496117_0067229 Ga0496117_0067229_39_794 251
7 3300048921 Ga0496118_0008770 Ga0496118_0008770_1476_2231 251
8 3300048922 Ga0496119_0013404 Ga0496119_0013404_686_1441 251
9 3300048923 Ga0496120_0009155 Ga0496120_0009155_1159_1914 251
10 3300048925 Ga0496122_0000020 Ga0496122_0000020_87168_87923 251
11 3300048926 Ga0496123_0000003 Ga0496123_0000003_302292_303047 251
12 3300048927 Ga0496124_0005291 Ga0496124_0005291_12265_13020 251
13 3300048928 Ga0496125_0036413 Ga0496125_0036413_444_1199 251
14 3300053087 Ga0500643_000216 Ga0500643_000216_33466_34227 253
15 iso_pu_bacteria 2848551377 2848552839 255
16 iso_pu_bacteria 2706794495 2707098903 256
17 iso_pu_bacteria 2854601825 2854606122 256
18 iso_pu_bacteria 2711768156 2712470453 257
19 iso_pu_bacteria 2857729791 2857729862 257
20 iso_pu_bacteria 2928121344 2928123113 257
21 3300009011 Ga0105251_10045083 Ga0105251_100450832 258
22 3300009036 Ga0105244_10027374 Ga0105244_100273742 258
23 3300013102 Ga0157371_10009764 Ga0157371_100097647 258
24 3300013102 Ga0157371_10122515 Ga0157371_101225152 258
25 3300013105 Ga0157369_10064229 Ga0157369_100642294 258
26 3300027312 Ga0209371_1022724 Ga0209371_10227242 258
27 3300048925 Ga0496122_0213749 Ga0496122_0213749_182_988 258
28 iso_pu_bacteria 2510065053 2510281014 258
29 iso_pu_bacteria 2510065055 2510294855 258
30 iso_pu_bacteria 2510065058 2510309162 258
31 iso_pu_bacteria 2773857672 2774131958 258
32 iso_pu_bacteria 2917832318 2917834997 258
33 iso_pu_bacteria 2919125081 2919126644 258
34 iso_pu_bacteria 2974298342 2974301082 258
35 iso_pu_bacteria 2984499530 2984503557 258
36 iso_pu_bacteria 2984504281 2984505159 258
37 iso_pu_bacteria 2990044586 2990047840 258
38 iso_pu_bacteria 8003856774 8003860350 258
39 3300048920 Ga0496117_0044539 Ga0496117_0044539_1479_2276 259
40 3300048921 Ga0496118_0120116 Ga0496118_0120116_669_1466 259
41 3300048922 Ga0496119_0087727 Ga0496119_0087727_885_1682 259
42 3300048925 Ga0496122_0129430 Ga0496122_0129430_160_945 259
43 3300048927 Ga0496124_0002725 Ga0496124_0002725_12304_13101 259
44 3300048928 Ga0496125_0001412 Ga0496125_0001412_12823_13620 259
45 3300048928 Ga0496125_0009984 Ga0496125_0009984_5264_6049 259
46 3300048929 Ga0496126_0003323 Ga0496126_0003323_7073_7870 259
47 iso_pu_bacteria 2537561728 2538427838 259
48 iso_pu_bacteria 2871282230 2871283285 259
49 iso_pu_bacteria 8057568493 8057569006 259
50 iso_pu_bacteria 8055157932 8055162216 261
51 3300006038 Ga0075365_10256022 Ga0075365_102560222 262
52 3300009036 Ga0105244_10000015 Ga0105244_1000001594 262
53 3300009036 Ga0105244_10010065 Ga0105244_100100653 262
54 3300025728 Ga0207655_1000061 Ga0207655_100006195 262
55 3300048919 Ga0496116_0008599 Ga0496116_0008599_4800_5612 262
56 3300048920 Ga0496117_0009036 Ga0496117_0009036_4617_5423 262
57 3300048921 Ga0496118_0022009 Ga0496118_0022009_3935_4741 262
58 3300048923 Ga0496120_0006242 Ga0496120_0006242_4546_5352 262
59 3300048923 Ga0496120_0011989 Ga0496120_0011989_3067_3879 262
60 3300048925 Ga0496122_0015701 Ga0496122_0015701_2784_3581 262
61 3300048926 Ga0496123_0012305 Ga0496123_0012305_3729_4526 262
62 3300048926 Ga0496123_0039976 Ga0496123_0039976_753_1661 262
63 3300048928 Ga0496125_0016008 Ga0496125_0016008_3640_4437 262
64 3300048929 Ga0496126_0011890 Ga0496126_0011890_3683_4489 262
65 3300049578 Ga0501042_0248441 Ga0501042_0248441_165_992 262
66 iso_pu_bacteria 2565956521 2566038586 262
67 iso_pu_bacteria 2847085930 2847086847 262
68 iso_pu_bacteria 2857729791 2857733140 262
69 iso_pu_bacteria 2904776348 2904779893 262
70 iso_pu_bacteria 2910809715 2910810102 262
71 iso_pu_bacteria 2919538618 2919539874 262
72 iso_pu_bacteria 2928121344 2928121840 262
73 iso_pu_bacteria 2932398195 2932400550 262
74 iso_pu_bacteria 2939674588 2939678318 262
75 iso_pu_bacteria 8055092621 8055095816 262
76 3300005834 Ga0068851_10009100 Ga0068851_100091003 263
77 3300006946 Ga0079104_1002352 Ga0079104_10023522 263
78 3300009092 Ga0105250_10022157 Ga0105250_100221572 263
79 3300009148 Ga0105243_10022499 Ga0105243_100224992 263
80 3300025711 Ga0207696_1033813 Ga0207696_10338132 263
81 3300025728 Ga0207655_1000050 Ga0207655_100005065 263
82 3300025735 Ga0207713_1001634 Ga0207713_10016343 263
83 3300025735 Ga0207713_1002630 Ga0207713_10026303 263
84 3300025735 Ga0207713_1009687 Ga0207713_10096872 263
85 3300025735 Ga0207713_1017422 Ga0207713_10174223 263
86 3300027111 Ga0209281_1000603 Ga0209281_100060316 263
87 3300027312 Ga0209371_1028450 Ga0209371_10284502 263
88 3300028794 Ga0307515_10028672 Ga0307515_100286723 263
89 3300030500 Ga0268256_1032322 Ga0268256_10323221 263
90 3300038443 Ga0395901_0059806 Ga0395901_0059806_2745_3587 263
91 3300042010 Ga0439452_000423 Ga0439452_000423_10113_10925 263
92 3300048927 Ga0496124_0068263 Ga0496124_0068263_1345_2157 263
93 3300048928 Ga0496125_0016350 Ga0496125_0016350_4002_4913 263
94 3300050496 nmdc:mga07m45_29074_c1 nmdc:mga07m45_29074_c1_2041_2910 263
95 iso_pu_bacteria 2772190666 2772440150 263
96 iso_pu_bacteria 2821118458 2821120547 263
97 iso_pu_bacteria 2857723135 2857723512 263
98 iso_pu_bacteria 2857733635 2857735437 263
99 iso_pu_bacteria 2888366609 2888370239 263
100 iso_pu_bacteria 2923634449 2923636559 263
101 iso_pu_bacteria 2937967321 2937968781 263
102 iso_pu_bacteria 8004592986 8004596311 263
103 iso_pu_bacteria 8015394850 8015397583 263
104 iso_pu_bacteria 8018221730 8018223778 263
105 3300009011 Ga0105251_10049252 Ga0105251_100492522 264
106 3300009092 Ga0105250_10000053 Ga0105250_1000005382 264
107 3300025229 Ga0209147_100028 Ga0209147_100028265 264
108 3300025711 Ga0207696_1000116 Ga0207696_100011662 264
109 3300025735 Ga0207713_1000003 Ga0207713_100000359 264
110 3300027312 Ga0209371_1004256 Ga0209371_10042563 264
111 3300030500 Ga0268256_1003996 Ga0268256_10039963 264
112 3300046474 Ga0495605_0051501 Ga0495605_0051501_383_1189 264
113 3300047446 Ga0495679_029270 Ga0495679_029270_831_1652 264
114 3300048919 Ga0496116_0000140 Ga0496116_0000140_105575_106381 264
115 3300048920 Ga0496117_0059345 Ga0496117_0059345_1156_1977 264
116 3300048921 Ga0496118_0025779 Ga0496118_0025779_3091_3912 264
117 3300048922 Ga0496119_0000814 Ga0496119_0000814_17895_18701 264
118 3300048922 Ga0496119_0001557 Ga0496119_0001557_20781_21602 264
119 3300048922 Ga0496119_0012877 Ga0496119_0012877_3215_4030 264
120 3300048923 Ga0496120_0000048 Ga0496120_0000048_23108_23914 264
121 3300048923 Ga0496120_0001332 Ga0496120_0001332_4545_5366 264
122 3300048923 Ga0496120_0008805 Ga0496120_0008805_2709_3524 264
123 3300048925 Ga0496122_0041245 Ga0496122_0041245_1360_2181 264
124 3300048928 Ga0496125_0056918 Ga0496125_0056918_260_1081 264
125 3300048929 Ga0496126_0078831 Ga0496126_0078831_1055_1870 264
126 3300048929 Ga0496126_0101480 Ga0496126_0101480_208_1029 264
127 3300053161 Ga0500634_0022748 Ga0500634_0022748_133_957 264
128 iso_pu_bacteria 2510461069 2510842710 264
129 iso_pu_bacteria 2585428094 2587862052 264
130 iso_pu_bacteria 2593339131 2595090595 264
131 iso_pu_bacteria 2599185169 2599408958 264
132 iso_pu_bacteria 2600255254 2601522525 264
133 iso_pu_bacteria 2600255255 2601527552 264
134 iso_pu_bacteria 2600255280 2601614383 264
135 iso_pu_bacteria 2600255281 2601619103 264
136 iso_pu_bacteria 2600255287 2601642277 264
137 iso_pu_bacteria 2600255288 2601647139 264
138 iso_pu_bacteria 2600255289 2601652530 264
139 iso_pu_bacteria 2600255290 2601657856 264
140 iso_pu_bacteria 2600255291 2601662100 264
141 iso_pu_bacteria 2600255298 2601695058 264
142 iso_pu_bacteria 2600255299 2601699730 264
143 iso_pu_bacteria 2600255300 2601706375 264
144 iso_pu_bacteria 2600255301 2601710681 264
145 iso_pu_bacteria 2600255302 2601715695 264
146 iso_pu_bacteria 2600255303 2601720081 264
147 iso_pu_bacteria 2600255304 2601726101 264
148 iso_pu_bacteria 2600255305 2601730642 264
149 iso_pu_bacteria 2600255306 2601735658 264
150 iso_pu_bacteria 2600255307 2601740926 264
151 iso_pu_bacteria 2600255309 2601750856 264
152 iso_pu_bacteria 2600255392 2602018110 264
153 iso_pu_bacteria 2602042052 2603659462 264
154 iso_pu_bacteria 2602042053 2603664737 264
155 iso_pu_bacteria 2602042103 2603838034 264
156 iso_pu_bacteria 2602042104 2603843112 264
157 iso_pu_bacteria 2602042105 2603848185 264
158 iso_pu_bacteria 2602042106 2603853260 264
159 iso_pu_bacteria 2602042109 2603867207 264
160 iso_pu_bacteria 2602042110 2603871311 264
161 iso_pu_bacteria 2602042111 2603876242 264
162 iso_pu_bacteria 2603880178 2606048504 264
163 iso_pu_bacteria 2603880184 2606069164 264
164 iso_pu_bacteria 2603880202 2606144986 264
165 iso_pu_bacteria 2603880211 2606175905 264
166 iso_pu_bacteria 2636415599 2637224833 264
167 iso_pu_bacteria 2675903046 2676406098 264
168 iso_pu_bacteria 2775507049 2776911419 264
169 iso_pu_bacteria 2775507074 2777022142 264
170 iso_pu_bacteria 2904513164 2904514279 264
171 iso_pu_bacteria 2908669403 2908673836 264
172 iso_pu_bacteria 2919108558 2919108654 264
173 iso_pu_bacteria 2933418574 2933422054 264
174 iso_pu_bacteria 2969079654 2969081813 264
175 iso_pu_bacteria 2971820967 2971823221 264
176 iso_pu_bacteria 2984559226 2984564239 264
177 iso_pu_bacteria 2984595703 2984596973 264
178 3300009011 Ga0105251_10003166 Ga0105251_100031668 265
179 3300013105 Ga0157369_10150610 Ga0157369_101506102 265
180 3300015679 Ga0183366_1002 Ga0183366_1002502 265
181 3300015680 Ga0183370_1002 Ga0183370_1002502 265
182 3300015685 Ga0183369_1002 Ga0183369_1002502 265
183 3300015687 Ga0183368_1005 Ga0183368_1005502 265
184 3300028794 Ga0307515_10005103 Ga0307515_100051038 265
185 3300048905 Ga0496102_0014517 Ga0496102_0014517_1414_2244 265
186 3300048922 Ga0496119_0011478 Ga0496119_0011478_2142_3095 265
187 3300048924 Ga0496121_0023809 Ga0496121_0023809_2832_3785 265
188 3300048925 Ga0496122_0021134 Ga0496122_0021134_4234_5187 265
189 3300048926 Ga0496123_0145673 Ga0496123_0145673_172_1125 265
190 3300048928 Ga0496125_0003093 Ga0496125_0003093_17661_18614 265
191 iso_pu_bacteria 2602042047 2603644162 265
192 iso_pu_bacteria 2602042067 2603704748 265
193 iso_pu_bacteria 2643221613 2644084053 265
194 iso_pu_bacteria 2643221721 2644666684 265
195 iso_pu_bacteria 2757320391 2757568741 265
196 iso_pu_bacteria 2775507192 2777838290 265
197 iso_pu_bacteria 2888578766 2888583391 265
198 iso_pu_bacteria 2935890801 2935892827 265
199 iso_pu_bacteria 2936340661 2936344865 265
200 3300025728 Ga0207655_1011145 Ga0207655_10111452 266
201 3300048922 Ga0496119_0000115 Ga0496119_0000115_81482_82288 266
202 3300048922 Ga0496119_0002794 Ga0496119_0002794_6721_7545 266
203 3300048922 Ga0496119_0003577 Ga0496119_0003577_3804_4628 266
204 3300048923 Ga0496120_0000060 Ga0496120_0000060_73754_74560 266
205 3300048923 Ga0496120_0014125 Ga0496120_0014125_360_1184 266
206 3300048923 Ga0496120_0015799 Ga0496120_0015799_3778_4602 266
207 3300048927 Ga0496124_0000028 Ga0496124_0000028_50693_51517 266
208 3300049568 Ga0501031_0022310 Ga0501031_0022310_1441_2268 266
209 3300049569 Ga0501032_0030561 Ga0501032_0030561_2412_3239 266
210 iso_pu_bacteria 2510917022 2511133471 266
211 iso_pu_bacteria 2582581307 2585272569 266
212 iso_pu_bacteria 2585427531 2585561367 266
213 iso_pu_bacteria 2585427609 2585906596 266
214 iso_pu_bacteria 2585428125 2587982018 266
215 iso_pu_bacteria 3005445848 3005451579 266
216 3300006038 Ga0075365_10036885 Ga0075365_100368852 267
217 3300006051 Ga0075364_10036117 Ga0075364_100361171 267
218 3300006353 Ga0075370_10008484 Ga0075370_100084843 267
219 3300026067 Ga0207678_10539861 Ga0207678_105398611 267
220 3300031901 Ga0307406_10023223 Ga0307406_100232233 267
221 3300032004 Ga0307414_10343266 Ga0307414_103432662 267
222 3300041451 Ga0451791_1438364 Ga0451791_1438364_158_1027 267
223 3300048905 Ga0496102_0000012 Ga0496102_0000012_272762_273646 267
224 3300048920 Ga0496117_0001190 Ga0496117_0001190_23266_24117 267
225 3300048921 Ga0496118_0083974 Ga0496118_0083974_1233_2123 267
226 3300048922 Ga0496119_0096824 Ga0496119_0096824_532_1344 267
227 3300048927 Ga0496124_0021233 Ga0496124_0021233_5070_5975 267
228 3300048928 Ga0496125_0000074 Ga0496125_0000074_119839_120693 267
229 3300048928 Ga0496125_0011536 Ga0496125_0011536_1131_1943 267
230 3300049571 Ga0501034_0506663 Ga0501034_0506663_193_1065 267
231 3300050491 nmdc:mga00v17_150913_c1 nmdc:mga00v17_150913_c1_33_842 267
232 3300050492 nmdc:mga0yw44_35318_c1 nmdc:mga0yw44_35318_c1_254_1063 267
233 3300053140 Ga0500573_0001668 Ga0500573_0001668_3178_4017 267
234 iso_pu_bacteria 2585427608 2585901997 267
235 iso_pu_bacteria 2643221553 2643784192 267
236 iso_pu_bacteria 2738543034 2739367388 267
237 iso_pu_bacteria 2868088558 2868089786 267
238 iso_pu_bacteria 8002811521 8002813361 267
239 iso_pu_bacteria 2862382967 2862384483 268
240 iso_pu_bacteria 8008558824 8008565370 268
241 3300005355 Ga0070671_100000498 Ga0070671_1000004986 270
242 3300006038 Ga0075365_10212620 Ga0075365_102126201 270
243 3300006846 Ga0075430_100003177 Ga0075430_1000031777 270
244 3300025931 Ga0207644_10001027 Ga0207644_100010279 270
245 3300028794 Ga0307515_10120454 Ga0307515_101204542 270
246 3300048927 Ga0496124_0032530 Ga0496124_0032530_3763_4593 270
247 3300050509 nmdc:mga0qj67_3103_c1 nmdc:mga0qj67_3103_c1_6273_7142 270
248 3300053117 Ga0500593_000113 Ga0500593_000113_9724_10557 270
249 iso_pu_bacteria 2671180195 2671839336 270
250 iso_pu_bacteria 2684623035 2686537480 270
251 iso_pu_bacteria 2687453743 2689995121 270
252 iso_pu_bacteria 2773857922 2774857492 270
253 iso_pu_bacteria 2895880812 2895881806 270
254 iso_pu_bacteria 8057345674 8057349421 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

41

190

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lb8-assembly1.cif.gz_C structure of a ferrichrome importer fhucdb from e. coli 0.919 9 261
5x40-assembly1.cif.gz_B structure of a cbio dimer bound with amppcp 0.9143 7 244
4dbl-assembly1.cif.gz_C crystal structure of e159q mutant of btucdf 0.913 6 262
4g1u-assembly1.cif.gz_D x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.9115 9 258
1l7v-assembly1.cif.gz_D bacterial abc transporter involved in b12 uptake 0.9113 6 243
ID Description Score Start End Superfamily
af_P15031_2_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9837 9 257 3.40.50.300
af_P15031_2_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.976 9 257 3.40.50.300
af_P23878_8_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9668 10 259 3.40.50.300
af_Q2G072_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9596 9 262 3.40.50.300
af_P23878_8_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9556 10 259 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1X7JWF5-F1-model_v4 Iron complex transport system ATP-binding protein 0.946 6 244 GO:0005524
GO:0016887
AF-A0A255TJ93-F1-model_v4 ABC transporter ATP-binding protein 0.9341 6 242 GO:0005524
GO:0016887
AF-A0A7C3XE57-F1-model_v4 ABC transporter ATP-binding protein 0.9286 5 266 GO:0005524
GO:0016887
AF-A0A7J3J1Q9-F1-model_v4 ABC transporter ATP-binding protein 0.9285 5 203 GO:0005524
GO:0016887
AF-A0A5P9BGF3-F1-model_v4 Iron(3+)-hydroxamate import ATP-binding protein FhuC 0.9248 52 246 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.69 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map