F364739

General Info

Members Datasets Scaffolds Average Seq Length
254 166 508 186

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100508984|Ga0068864_1005089841
Length 220
Sequence MWNRKFWAVALICMGMITLWHALDGEVNMEEASSLEKTSPGMEKITLGGGCFWCLEPIFDDLKGVEDVKSGYSGGTVANPTYRQVCSGTTGHAEVIEITFDPAVLSLKELLEIFFVFHDPTTLNRQGADVGTQYRSVIFYRTPEQKSVAEQVMKQLQLKNIWPDPIVTELSPFKSFYVAEDYHQEYFKLNGTQPYCKFVIAPKVAKFRQQYQTKLKRHSP

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
56 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
82 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
85 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
86 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
87 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
88 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 3.94
Rhizosphere 94.88
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100508984 3300005618 Bacteria 1159
2 Ga0065707_10395759 3300005295 Bacteria 859
3 Ga0070676_10952305 3300005328 Bacteria 642
4 Ga0070690_100116553 3300005330 Bacteria 1788
5 Ga0070670_100430708 3300005331 Bacteria 1167
6 Ga0070680_100033271 3300005336 Bacteria 4154
7 Ga0068868_101627467 3300005338 Bacteria 607
8 Ga0070689_100299310 3300005340 Bacteria 1338
9 Ga0070689_101034555 3300005340 Bacteria 732
10 Ga0070669_100140913 3300005353 Bacteria 1859
11 Ga0070671_100335589 3300005355 Bacteria 1289
12 Ga0070688_100012555 3300005365 Bacteria 4748
13 Ga0070688_100043735 3300005365 Bacteria 2761
14 Ga0070701_10026965 3300005438 Bacteria 2809
15 Ga0070705_100031017 3300005440 Bacteria 2956
16 Ga0070700_100549484 3300005441 Bacteria 897
17 Ga0070694_100071064 3300005444 Bacteria 2398
18 Ga0070694_100438734 3300005444 Bacteria 1029
19 Ga0070708_100033226 3300005445 Bacteria 4482
20 Ga0070708_100111037 3300005445 Bacteria 2520
21 Ga0070708_100138498 3300005445 Bacteria 2256
22 Ga0068867_100023504 3300005459 Bacteria 4412
23 Ga0070685_10204191 3300005466 Bacteria 1286
24 Ga0070685_10797723 3300005466 Bacteria 696
25 Ga0070706_100001087 3300005467 Bacteria 29403
26 Ga0070706_100190582 3300005467 Bacteria 1916
27 Ga0070706_100342021 3300005467 Bacteria 1395
28 Ga0070706_100385454 3300005467 Bacteria 1305
29 Ga0070707_100031913 3300005468 Bacteria 5018
30 Ga0070707_100491225 3300005468 Bacteria 1189
31 Ga0070707_100728205 3300005468 Bacteria 955
32 Ga0070698_100055991 3300005471 Bacteria 3996
33 Ga0070698_100085469 3300005471 Bacteria 3142
34 Ga0070698_100820991 3300005471 Bacteria 874
35 Ga0070699_100000020 3300005518 Bacteria 182025
36 Ga0070699_100002699 3300005518 Bacteria 15852
37 Ga0070699_100175568 3300005518 Bacteria 1900
38 Ga0070697_100554507 3300005536 Bacteria 1008
39 Ga0070697_100582873 3300005536 Bacteria 982
40 Ga0070672_100285624 3300005543 Bacteria 1396
41 Ga0070686_100055241 3300005544 Bacteria 2543
42 Ga0070695_100017052 3300005545 Bacteria 4405
43 Ga0070695_100073981 3300005545 Bacteria 2238
44 Ga0070695_100095933 3300005545 Bacteria 1988
45 Ga0070695_100433592 3300005545 Bacteria 1003
46 Ga0070696_100094482 3300005546 Bacteria 2134
47 Ga0070696_100137676 3300005546 Bacteria 1781
48 Ga0070696_100222778 3300005546 Bacteria 1416
49 Ga0070704_100519612 3300005549 Bacteria 1036
50 Ga0068855_100119469 3300005563 Bacteria 3018
51 Ga0068854_100158420 3300005578 Bacteria 1751
52 Ga0068854_101513619 3300005578 Bacteria 609
53 Ga0068861_100320378 3300005719 Bacteria 1350
54 Ga0068870_10416565 3300005840 Bacteria 878
55 Ga0068863_100047079 3300005841 Bacteria 4092
56 Ga0068863_100077843 3300005841 Bacteria 3139
57 Ga0068863_101571239 3300005841 Bacteria 667
58 Ga0068860_100014090 3300005843 Bacteria 7844
59 Ga0068862_100045219 3300005844 Bacteria 3756
60 Ga0081538_10251532 3300005981 Bacteria 673
61 Ga0075366_10004625 3300006195 Bacteria 7396
62 Ga0075428_100075961 3300006844 Bacteria 3668
63 Ga0075431_100475320 3300006847 Bacteria 1243
64 Ga0075433_10032225 3300006852 Bacteria 4488
65 Ga0075433_10036497 3300006852 Bacteria 4235
66 Ga0075433_10123746 3300006852 Bacteria 2298
67 Ga0075433_10405885 3300006852 Bacteria 1202
68 Ga0075434_100044690 3300006871 Bacteria 4393
69 Ga0075434_100094519 3300006871 Bacteria 2994
70 Ga0075434_100269950 3300006871 Bacteria 1720
71 Ga0075434_101133276 3300006871 Bacteria 795
72 Ga0075429_100009425 3300006880 Bacteria 8478
73 Ga0075429_100050912 3300006880 Bacteria 3603
74 Ga0075436_100040583 3300006914 Bacteria 3211
75 Ga0075436_100087085 3300006914 Bacteria 2169
76 Ga0075435_100082888 3300007076 Bacteria 2636
77 Ga0075435_100138833 3300007076 Bacteria 2038
78 Ga0075435_100505559 3300007076 Bacteria 1045
79 Ga0111539_10464119 3300009094 Bacteria 1474
80 Ga0111539_10823371 3300009094 Bacteria 1080
81 Ga0114129_10000424 3300009147 Bacteria 50149
82 Ga0114129_10004575 3300009147 Bacteria 19511
83 Ga0114129_10105027 3300009147 Bacteria 3904
84 Ga0114129_10143345 3300009147 Bacteria 3274
85 Ga0114129_10174317 3300009147 Bacteria 2930
86 Ga0114129_10252255 3300009147 Bacteria 2368
87 Ga0105248_10861899 3300009177 Bacteria 1022
88 Ga0157369_10267241 3300013105 Bacteria 1783
89 Ga0163162_10673980 3300013306 Bacteria 1157
90 Ga0157372_11663137 3300013307 Bacteria 735
91 Ga0157375_10404845 3300013308 Bacteria 1531
92 Ga0157375_10432682 3300013308 Bacteria 1482
93 Ga0163163_10597631 3300014325 Bacteria 1167
94 Ga0157380_10596255 3300014326 Bacteria 1092
95 Ga0157380_11586040 3300014326 Bacteria 710
96 Ga0197907_10980991 3300020069 Bacteria 1348
97 Ga0206355_1484065 3300020076 Bacteria 1114
98 Ga0206352_10563799 3300020078 Bacteria 1339
99 Ga0207653_10012163 3300025885 Bacteria 2687
100 Ga0207684_10012336 3300025910 Bacteria 7437
101 Ga0207684_10070008 3300025910 Bacteria 2981
102 Ga0207684_10074900 3300025910 Bacteria 2876
103 Ga0207684_10765705 3300025910 Bacteria 817
104 Ga0207707_10031497 3300025912 Bacteria 4640
105 Ga0207660_10037885 3300025917 Bacteria 3363
106 Ga0207652_10051364 3300025921 Bacteria 3534
107 Ga0207646_10032247 3300025922 Bacteria 4741
108 Ga0207646_10046555 3300025922 Bacteria 3891
109 Ga0207646_10135003 3300025922 Bacteria 2221
110 Ga0207646_10638250 3300025922 Bacteria 955
111 Ga0207681_10125064 3300025923 Bacteria 1892
112 Ga0207644_10087566 3300025931 Bacteria 2315
113 Ga0207706_10110985 3300025933 Bacteria 2412
114 Ga0207670_10256885 3300025936 Bacteria 1353
115 Ga0207711_10611369 3300025941 Bacteria 1017
116 Ga0207689_10420121 3300025942 Bacteria 1116
117 Ga0207679_10023932 3300025945 Bacteria 4183
118 Ga0207667_10198714 3300025949 Bacteria 2057
119 Ga0207651_10390035 3300025960 Bacteria 1182
120 Ga0207712_10412825 3300025961 Bacteria 1137
121 Ga0207640_10184854 3300025981 Bacteria 1566
122 Ga0207703_10372858 3300026035 Bacteria 1319
123 Ga0207648_10034783 3300026089 Bacteria 4441
124 Ga0207648_10583867 3300026089 Bacteria 1029
125 Ga0207676_10250358 3300026095 Bacteria 1594
126 Ga0207676_10664015 3300026095 Bacteria 1007
127 Ga0207675_100452060 3300026118 Bacteria 1273
128 Ga0207675_100594951 3300026118 Bacteria 1109
129 Ga0207428_10240015 3300027907 Bacteria 1354
130 Ga0268265_10523004 3300028380 Bacteria 1122
131 Ga0268264_10125305 3300028381 Bacteria 2269
132 Ga0311003_180108 3300029282 Bacteria 582
133 Ga0316577_10060518 3300031733 Bacteria 2113
134 Ga0307407_10840475 3300031903 Bacteria 701
135 Ga0373934_0004685 3300035086 Bacteria 5056
136 Ga0373953_0004117 3300035117 Bacteria 4610
137 Ga0373954_0043864 3300035118 Bacteria 2086
138 Ga0373956_0152031 3300035119 Bacteria 1089
139 Ga0373955_0035688 3300035172 Bacteria 2634
140 Ga0316574_0021476 3300035398 Unclassified 3834
141 Ga0373924_0087083 3300035410 Bacteria 1333
142 Ga0373933_0058908 3300035724 Bacteria 2311
143 Ga0373937_0191517 3300036401 Bacteria 1921
144 Ga0316582_0126247 3300036647 Bacteria 1715
145 Ga0316584_0331143 3300036712 Unclassified 1096
146 Ga0436364_1106542 3300037853 Bacteria 971
147 Ga0395901_0172999 3300038443 Bacteria 2266
148 Ga0436360_0203663 3300039438 Bacteria 1199
149 Ga0451577_0480062 3300042876 Bacteria 1128
150 Ga0453683_0077989 3300044673 Bacteria 2075
151 Ga0453683_0265971 3300044673 Bacteria 1094
152 Ga0466959_0422021 3300045049 Bacteria 905
153 Ga0451576_0052925 3300045051 Bacteria 4254
154 Ga0466958_0302106 3300045836 Bacteria 1028
155 Ga0495592_0179621 3300046454 Bacteria 1442
156 Ga0495651_0181721 3300046462 Bacteria 1488
157 Ga0495582_0218904 3300046473 Bacteria 1089
158 Ga0495608_0289418 3300046511 Bacteria 1015
159 Ga0495618_0181885 3300046514 Bacteria 1336
160 Ga0495628_0023717 3300046516 Bacteria 5031
161 Ga0495652_0401447 3300046529 Bacteria 970
162 Ga0495587_0038221 3300046536 Bacteria 2879
163 Ga0495635_0250395 3300046663 Bacteria 1194
164 Ga0495657_0043316 3300046675 Bacteria 3070
165 Ga0495599_0147237 3300046678 Bacteria 1459
166 Ga0495658_0155626 3300046683 Bacteria 1407
167 Ga0495600_0053529 3300046809 Bacteria 2636
168 Ga0495604_0063284 3300047317 Bacteria 2822
169 Ga0495680_0131014 3300047322 Bacteria 1842
170 Ga0495675_0071107 3300047444 Bacteria 2196
171 Ga0495684_0557716 3300047471 Bacteria 779
172 Ga0495686_0216025 3300047472 Bacteria 1093
173 Ga0496102_0030825 3300048905 Bacteria 4802
174 Ga0496104_0040621 3300048907 Bacteria 4361
175 Ga0496105_0024943 3300048908 Bacteria 4861
176 Ga0496106_0084565 3300048909 Bacteria 2441
177 Ga0496107_0072040 3300048910 Bacteria 2512
178 Ga0496108_0152184 3300048911 Bacteria 1996
179 Ga0496109_0040612 3300048912 Bacteria 4213
180 Ga0496110_0002209 3300048913 Bacteria 14542
181 Ga0496111_0026671 3300048914 Bacteria 4081
182 Ga0496113_0013694 3300048916 Bacteria 5507
183 Ga0501031_0010361 3300049568 Bacteria 6070
184 Ga0501031_0061114 3300049568 Bacteria 2455
185 Ga0501031_0152874 3300049568 Bacteria 1508
186 Ga0501032_0017894 3300049569 Bacteria 4972
187 Ga0501033_0009663 3300049570 Bacteria 7418
188 Ga0501033_0384645 3300049570 Bacteria 980
189 Ga0501034_0002499 3300049571 Bacteria 22072
190 Ga0501034_0083924 3300049571 Bacteria 3187
191 Ga0501036_0000576 3300049572 Bacteria 26456
192 Ga0501036_0738674 3300049572 Bacteria 812
193 Ga0501037_0001802 3300049573 Bacteria 15558
194 Ga0501037_0044795 3300049573 Bacteria 3248
195 Ga0501037_0343391 3300049573 Bacteria 1031
196 Ga0501038_0004322 3300049574 Bacteria 13211
197 Ga0501043_0003428 3300049579 Bacteria 13019
198 Ga0501046_0005620 3300049580 Bacteria 11192
199 Ga0501046_0040174 3300049580 Bacteria 3740
200 Ga0501047_0043674 3300049581 Bacteria 4329
201 Ga0501047_0071022 3300049581 Bacteria 3352
202 Ga0501047_0542191 3300049581 Bacteria 988
203 Ga0501067_0006542 3300049583 Bacteria 6459
204 Ga0501068_0002437 3300049584 Bacteria 9874
205 Ga0501068_0004490 3300049584 Bacteria 7598
206 Ga0501069_0000623 3300049585 Bacteria 16337
207 Ga0501070_0002029 3300049586 Bacteria 17801
208 Ga0501070_0009950 3300049586 Bacteria 8040
209 Ga0501070_0234252 3300049586 Bacteria 1504
210 Ga0501071_0011006 3300049587 Bacteria 6075
211 Ga0501072_0002524 3300049588 Bacteria 13705
212 Ga0501073_0001399 3300049589 Bacteria 17801
213 Ga0501073_0035660 3300049589 Bacteria 3534
214 Ga0501074_0001043 3300049590 Bacteria 18032
215 Ga0501074_0013859 3300049590 Bacteria 5860
216 Ga0501076_0957072 3300049592 Bacteria 706
217 Ga0501080_0005998 3300049742 Bacteria 10890
218 Ga0501083_0000971 3300049744 Bacteria 18994
219 Ga0501083_0007656 3300049744 Bacteria 7657
220 Ga0501035_0011332 3300049822 Bacteria 8263
221 Ga0501044_0031661 3300049823 Bacteria 5565
222 nmdc:mga0k408_4467_c1 3300050493 Bacteria 7421
223 nmdc:mga05p37_103841_c1 3300050507 Bacteria 3497
224 nmdc:mga05p37_167995_c1 3300050507 Bacteria 2677
225 nmdc:mga05p37_247334_c1 3300050507 Bacteria 2140
226 nmdc:mga05p37_285497_c1 3300050507 Bacteria 1966
227 nmdc:mga05p37_3272_c1 3300050507 Bacteria 18874
228 nmdc:mga05p37_405567_c1 3300050507 Bacteria 1590
229 nmdc:mga09592_274654_c1 3300050508 Bacteria 1462
230 nmdc:mga09592_28147_c1 3300050508 Bacteria 4668
231 nmdc:mga09592_50297_c1 3300050508 Unclassified 3515
232 nmdc:mga09592_932106_c1 3300050508 Bacteria 729
233 nmdc:mga0qj67_265212_c1 3300050509 Bacteria 1393
234 nmdc:mga06r32_323453_c1 3300050510 Bacteria 1527
235 nmdc:mga06r32_61843_c1 3300050510 Bacteria 3605
236 nmdc:mga0n895_230_c1 3300050512 Bacteria 35390
237 nmdc:mga0n895_44243_c1 3300050512 Bacteria 4342
238 nmdc:mga0n895_46714_c1 3300050512 Bacteria 4231
239 nmdc:mga0rr50_1319063_c1 3300050513 Bacteria 612
240 nmdc:mga0rr50_204716_c1 3300050513 Bacteria 1623
241 nmdc:mga0rr50_53930_c1 3300050513 Bacteria 2993
242 nmdc:mga08x19_302456_c1 3300050514 Bacteria 1111
243 nmdc:mga08x19_43136_c1 3300050514 Bacteria 2878
244 nmdc:mga0a205_23746_c1 3300050515 Bacteria 5818
245 nmdc:mga0a205_259039_c1 3300050515 Bacteria 1617
246 nmdc:mga0a205_45399_c1 3300050515 Bacteria 4236
247 nmdc:mga0a205_743490_c1 3300050515 Bacteria 830
248 nmdc:mga0a205_7990_c1 3300050515 Bacteria 9611
249 Ga0495595_0224537 3300053084 Bacteria 937
250 Ga0501084_0000590 3300054114 Bacteria 27782
251 Ga0501084_0825320 3300054114 Bacteria 780
252 Ga0501082_0022267 3300060353 Bacteria 5460
253 Ga0501082_0212549 3300060353 Bacteria 1682
254 Ga0530510_0801284 3300061734 Bacteria 719
255 Ga0068864_100508984
256 Ga0065707_10395759
257 Ga0070676_10952305
258 Ga0070690_100116553
259 Ga0070670_100430708
260 Ga0070680_100033271
261 Ga0068868_101627467
262 Ga0070689_100299310
263 Ga0070689_101034555
264 Ga0070669_100140913
265 Ga0070671_100335589
266 Ga0070688_100012555
267 Ga0070688_100043735
268 Ga0070701_10026965
269 Ga0070705_100031017
270 Ga0070700_100549484
271 Ga0070694_100071064
272 Ga0070694_100438734
273 Ga0070708_100033226
274 Ga0070708_100111037
275 Ga0070708_100138498
276 Ga0068867_100023504
277 Ga0070685_10204191
278 Ga0070685_10797723
279 Ga0070706_100001087
280 Ga0070706_100190582
281 Ga0070706_100342021
282 Ga0070706_100385454
283 Ga0070707_100031913
284 Ga0070707_100491225
285 Ga0070707_100728205
286 Ga0070698_100055991
287 Ga0070698_100085469
288 Ga0070698_100820991
289 Ga0070699_100000020
290 Ga0070699_100002699
291 Ga0070699_100175568
292 Ga0070697_100554507
293 Ga0070697_100582873
294 Ga0070672_100285624
295 Ga0070686_100055241
296 Ga0070695_100017052
297 Ga0070695_100073981
298 Ga0070695_100095933
299 Ga0070695_100433592
300 Ga0070696_100094482
301 Ga0070696_100137676
302 Ga0070696_100222778
303 Ga0070704_100519612
304 Ga0068855_100119469
305 Ga0068854_100158420
306 Ga0068854_101513619
307 Ga0068861_100320378
308 Ga0068870_10416565
309 Ga0068863_100047079
310 Ga0068863_100077843
311 Ga0068863_101571239
312 Ga0068860_100014090
313 Ga0068862_100045219
314 Ga0081538_10251532
315 Ga0075366_10004625
316 Ga0075428_100075961
317 Ga0075431_100475320
318 Ga0075433_10032225
319 Ga0075433_10036497
320 Ga0075433_10123746
321 Ga0075433_10405885
322 Ga0075434_100044690
323 Ga0075434_100094519
324 Ga0075434_100269950
325 Ga0075434_101133276
326 Ga0075429_100009425
327 Ga0075429_100050912
328 Ga0075436_100040583
329 Ga0075436_100087085
330 Ga0075435_100082888
331 Ga0075435_100138833
332 Ga0075435_100505559
333 Ga0111539_10464119
334 Ga0111539_10823371
335 Ga0114129_10000424
336 Ga0114129_10004575
337 Ga0114129_10105027
338 Ga0114129_10143345
339 Ga0114129_10174317
340 Ga0114129_10252255
341 Ga0105248_10861899
342 Ga0157369_10267241
343 Ga0163162_10673980
344 Ga0157372_11663137
345 Ga0157375_10404845
346 Ga0157375_10432682
347 Ga0163163_10597631
348 Ga0157380_10596255
349 Ga0157380_11586040
350 Ga0197907_10980991
351 Ga0206355_1484065
352 Ga0206352_10563799
353 Ga0207653_10012163
354 Ga0207684_10012336
355 Ga0207684_10070008
356 Ga0207684_10074900
357 Ga0207684_10765705
358 Ga0207707_10031497
359 Ga0207660_10037885
360 Ga0207652_10051364
361 Ga0207646_10032247
362 Ga0207646_10046555
363 Ga0207646_10135003
364 Ga0207646_10638250
365 Ga0207681_10125064
366 Ga0207644_10087566
367 Ga0207706_10110985
368 Ga0207670_10256885
369 Ga0207711_10611369
370 Ga0207689_10420121
371 Ga0207679_10023932
372 Ga0207667_10198714
373 Ga0207651_10390035
374 Ga0207712_10412825
375 Ga0207640_10184854
376 Ga0207703_10372858
377 Ga0207648_10034783
378 Ga0207648_10583867
379 Ga0207676_10250358
380 Ga0207676_10664015
381 Ga0207675_100452060
382 Ga0207675_100594951
383 Ga0207428_10240015
384 Ga0268265_10523004
385 Ga0268264_10125305
386 Ga0311003_180108
387 Ga0316577_10060518
388 Ga0307407_10840475
389 Ga0373934_0004685
390 Ga0373953_0004117
391 Ga0373954_0043864
392 Ga0373956_0152031
393 Ga0373955_0035688
394 Ga0316574_0021476
395 Ga0373924_0087083
396 Ga0373933_0058908
397 Ga0373937_0191517
398 Ga0316582_0126247
399 Ga0316584_0331143
400 Ga0436364_1106542
401 Ga0395901_0172999
402 Ga0436360_0203663
403 Ga0451577_0480062
404 Ga0453683_0077989
405 Ga0453683_0265971
406 Ga0466959_0422021
407 Ga0451576_0052925
408 Ga0466958_0302106
409 Ga0495592_0179621
410 Ga0495651_0181721
411 Ga0495582_0218904
412 Ga0495608_0289418
413 Ga0495618_0181885
414 Ga0495628_0023717
415 Ga0495652_0401447
416 Ga0495587_0038221
417 Ga0495635_0250395
418 Ga0495657_0043316
419 Ga0495599_0147237
420 Ga0495658_0155626
421 Ga0495600_0053529
422 Ga0495604_0063284
423 Ga0495680_0131014
424 Ga0495675_0071107
425 Ga0495684_0557716
426 Ga0495686_0216025
427 Ga0496102_0030825
428 Ga0496104_0040621
429 Ga0496105_0024943
430 Ga0496106_0084565
431 Ga0496107_0072040
432 Ga0496108_0152184
433 Ga0496109_0040612
434 Ga0496110_0002209
435 Ga0496111_0026671
436 Ga0496113_0013694
437 Ga0501031_0010361
438 Ga0501031_0061114
439 Ga0501031_0152874
440 Ga0501032_0017894
441 Ga0501033_0009663
442 Ga0501033_0384645
443 Ga0501034_0002499
444 Ga0501034_0083924
445 Ga0501036_0000576
446 Ga0501036_0738674
447 Ga0501037_0001802
448 Ga0501037_0044795
449 Ga0501037_0343391
450 Ga0501038_0004322
451 Ga0501043_0003428
452 Ga0501046_0005620
453 Ga0501046_0040174
454 Ga0501047_0043674
455 Ga0501047_0071022
456 Ga0501047_0542191
457 Ga0501067_0006542
458 Ga0501068_0002437
459 Ga0501068_0004490
460 Ga0501069_0000623
461 Ga0501070_0002029
462 Ga0501070_0009950
463 Ga0501070_0234252
464 Ga0501071_0011006
465 Ga0501072_0002524
466 Ga0501073_0001399
467 Ga0501073_0035660
468 Ga0501074_0001043
469 Ga0501074_0013859
470 Ga0501076_0957072
471 Ga0501080_0005998
472 Ga0501083_0000971
473 Ga0501083_0007656
474 Ga0501035_0011332
475 Ga0501044_0031661
476 nmdc:mga0k408_4467_c1
477 nmdc:mga05p37_103841_c1
478 nmdc:mga05p37_167995_c1
479 nmdc:mga05p37_247334_c1
480 nmdc:mga05p37_285497_c1
481 nmdc:mga05p37_3272_c1
482 nmdc:mga05p37_405567_c1
483 nmdc:mga09592_274654_c1
484 nmdc:mga09592_28147_c1
485 nmdc:mga09592_50297_c1
486 nmdc:mga09592_932106_c1
487 nmdc:mga0qj67_265212_c1
488 nmdc:mga06r32_323453_c1
489 nmdc:mga06r32_61843_c1
490 nmdc:mga0n895_230_c1
491 nmdc:mga0n895_44243_c1
492 nmdc:mga0n895_46714_c1
493 nmdc:mga0rr50_1319063_c1
494 nmdc:mga0rr50_204716_c1
495 nmdc:mga0rr50_53930_c1
496 nmdc:mga08x19_302456_c1
497 nmdc:mga08x19_43136_c1
498 nmdc:mga0a205_23746_c1
499 nmdc:mga0a205_259039_c1
500 nmdc:mga0a205_45399_c1
501 nmdc:mga0a205_743490_c1
502 nmdc:mga0a205_7990_c1
503 Ga0495595_0224537
504 Ga0501084_0000590
505 Ga0501084_0825320
506 Ga0501082_0022267
507 Ga0501082_0212549
508 Ga0530510_0801284

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

44

197

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.9813 2 154
2j89-assembly1.cif.gz_A functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases 0.9762 3 151
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9762 4 157
7e43-assembly2.cif.gz_A structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9737 2 154
7e43-assembly1.cif.gz_B structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9728 2 154
ID Description Score Start End Superfamily
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9726 3 154 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9676 1 157 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9663 3 151 3.30.1060.10
af_Q09859_1_167_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9633 4 157 3.30.1060.10
af_P0A086_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9611 1 160 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A2V7KRC5-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 1.001 3 177 GO:0008113
GO:0033744
GO:0036211
AF-A0A3B0W2T2-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 1.001 2 147 GO:0008113
AF-A0A533Q6U3-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 1 3 178 GO:0008113
GO:0033744
GO:0036211
AF-A0A5C7Z3G9-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9996 3 177 GO:0008113
GO:0033744
GO:0036211
AF-A0A1I3SVW2-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9994 3 178 GO:0008113
GO:0033744
GO:0036211

Map