F364732

General Info

Members Datasets Scaffolds Average Seq Length
254 157 241 234

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100189702|Ga0068852_1001897022
Length 245
Sequence VTGPGDRPVSALEAMAYADRGTALTGWLARPAGAARAAVLVLPTIANITPAIERRARQLADAGCLALVADFYGEPVAGFEAAGALASVLRADVDHYRQRLAAGLAALRALPEAGGLPVAAIGYCMGGQAALELARAGADLAFVVSFHGVLTTDRRASADAPHKPRVLVCHGDADPLAPREHVVALWDELDGAGYDWHFHAYSGVKHGFTDPGSDARGLPAVAYDASADRQSWAALMSFADEVLGT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
4 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
5 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
6 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
7 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
8 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
9 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
10 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
11 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
12 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
13 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
14 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
97 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
98 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
99 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
100 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
101 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
123 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
126 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
138 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
143 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
144 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
145 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
146 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
147 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
148 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
149 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
150 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
151 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
152 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
155 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
156 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
157 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.88
Metatranscriptomes 0
Isolates 5.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.57
Nodule 0.39
Rhizoplane 9.06
Rhizosphere 64.17
Stem 0
Stem Tuber 0
Unclassified 11.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1778839 2162886007 Bacteria 7243
2 SwRhRL2b_contig_3273488 2162886007 Bacteria 68965
3 JGI24751J29686_10000766 3300002459 Bacteria 7568
4 Ga0065704_10070144 3300005289 Bacteria 333223
5 Ga0065704_10070650 3300005289 Bacteria 18309
6 Ga0065707_10084332 3300005295 Bacteria 7333
7 Ga0070658_10000125 3300005327 Bacteria 68211
8 Ga0070670_100104557 3300005331 Bacteria 2439
9 Ga0070670_100568889 3300005331 Bacteria 1012
10 Ga0070666_10003287 3300005335 Bacteria 9813
11 Ga0070666_10041200 3300005335 Bacteria 3085
12 Ga0070682_100072693 3300005337 Bacteria 2204
13 Ga0070668_100005320 3300005347 Bacteria 9556
14 Ga0070668_100032898 3300005347 Bacteria 3946
15 Ga0070668_100232485 3300005347 Bacteria 1525
16 Ga0070668_100339368 3300005347 Bacteria 1269
17 Ga0070669_100000666 3300005353 Bacteria 25307
18 Ga0070669_100000986 3300005353 Bacteria 20774
19 Ga0070671_100000052 3300005355 Bacteria 78614
20 Ga0070671_100196058 3300005355 Bacteria 1712
21 Ga0070671_100551021 3300005355 Bacteria 994
22 Ga0070667_100001382 3300005367 Bacteria 21733
23 Ga0070667_100001554 3300005367 Bacteria 20589
24 Ga0070667_100003201 3300005367 Bacteria 14032
25 Ga0070708_100202378 3300005445 Bacteria 1859
26 Ga0070707_100341226 3300005468 Bacteria 1455
27 Ga0070665_100001006 3300005548 Bacteria 35713
28 Ga0070665_100002217 3300005548 Bacteria 21678
29 Ga0070665_100171253 3300005548 Bacteria 2172
30 Ga0070665_100252898 3300005548 Bacteria 1763
31 Ga0068855_100004478 3300005563 Bacteria 17070
32 Ga0068855_100040874 3300005563 Bacteria 5499
33 Ga0068855_100217229 3300005563 Bacteria 2146
34 Ga0068857_100129968 3300005577 Bacteria 2271
35 Ga0068854_100012800 3300005578 Bacteria 5495
36 Ga0068852_100000317 3300005616 Bacteria 32757
37 Ga0068852_100019554 3300005616 Bacteria 5362
38 Ga0068852_100189702 3300005616 Bacteria 1939
39 Ga0068859_100003457 3300005617 Bacteria 16054
40 Ga0068864_100023102 3300005618 Bacteria 5221
41 Ga0068864_100036246 3300005618 Bacteria 4203
42 Ga0068863_100000116 3300005841 Bacteria 84030
43 Ga0068863_100012243 3300005841 Bacteria 8283
44 Ga0068863_100448056 3300005841 Bacteria 1267
45 Ga0068858_100008924 3300005842 Bacteria 9612
46 Ga0068858_100015629 3300005842 Bacteria 7139
47 Ga0068858_100025649 3300005842 Bacteria 5484
48 Ga0068858_100409637 3300005842 Bacteria 1303
49 Ga0068860_100000008 3300005843 Bacteria 427367
50 Ga0068860_100009560 3300005843 Bacteria 9631
51 Ga0068860_100053447 3300005843 Bacteria 3840
52 Ga0068860_100064012 3300005843 Bacteria 3493
53 Ga0068862_100008115 3300005844 Bacteria 8686
54 Ga0068862_100014855 3300005844 Bacteria 6468
55 Ga0068862_100015966 3300005844 Bacteria 6242
56 Ga0068862_100539865 3300005844 Bacteria 1112
57 Ga0075365_10317918 3300006038 Bacteria 1096
58 Ga0075368_10000047 3300006042 Bacteria 28954
59 Ga0075362_10001106 3300006177 Bacteria 8366
60 Ga0075367_10004787 3300006178 Bacteria 6656
61 Ga0075369_10031404 3300006186 Bacteria 2242
62 Ga0075366_10102888 3300006195 Bacteria 1715
63 Ga0075366_10149123 3300006195 Bacteria 1416
64 Ga0075370_10024058 3300006353 Bacteria 3360
65 Ga0075370_10114231 3300006353 Bacteria 1569
66 Ga0097620_100003457 3300006931 Bacteria 16054
67 Ga0079104_1022096 3300006946 Bacteria 1719
68 Ga0105251_10033134 3300009011 Bacteria 2568
69 Ga0105240_10016780 3300009093 Bacteria 9902
70 Ga0111539_10309154 3300009094 Bacteria 1839
71 Ga0105247_10343121 3300009101 Bacteria 1048
72 Ga0105248_10016138 3300009177 Bacteria 8218
73 Ga0105248_10080931 3300009177 Bacteria 3651
74 Ga0105248_10371887 3300009177 Bacteria 1609
75 Ga0105248_10655898 3300009177 Bacteria 1184
76 Ga0105249_10063044 3300009553 Bacteria 3404
77 Ga0105249_10072391 3300009553 Bacteria 3186
78 Ga0163162_10010083 3300013306 Bacteria 9185
79 Ga0163162_10025838 3300013306 Bacteria 5804
80 Ga0163162_10239676 3300013306 Bacteria 1944
81 Ga0163163_10399929 3300014325 Bacteria 1432
82 Ga0157380_10113653 3300014326 Bacteria 2280
83 Ga0157379_10484240 3300014968 Bacteria 1145
84 Ga0163161_10005657 3300017792 Bacteria 8669
85 Ga0209050_1000215 3300025298 Bacteria 129179
86 Ga0207696_1006612 3300025711 Bacteria 4648
87 Ga0207713_1008627 3300025735 Bacteria 5841
88 Ga0207710_10119678 3300025900 Bacteria 1256
89 Ga0207680_10025753 3300025903 Bacteria 3249
90 Ga0207647_10033551 3300025904 Bacteria 3286
91 Ga0207705_10000004 3300025909 Bacteria 705756
92 Ga0207695_10013384 3300025913 Bacteria 9789
93 Ga0207646_10325957 3300025922 Bacteria 1388
94 Ga0207681_10000145 3300025923 Bacteria 58987
95 Ga0207681_10001698 3300025923 Bacteria 14165
96 Ga0207650_10052741 3300025925 Bacteria 3013
97 Ga0207644_10000003 3300025931 Bacteria 585905
98 Ga0207644_10165903 3300025931 Bacteria 1720
99 Ga0207644_10400827 3300025931 Bacteria 1121
100 Ga0207711_10056468 3300025941 Bacteria 3374
101 Ga0207711_10111758 3300025941 Bacteria 2430
102 Ga0207667_10020753 3300025949 Bacteria 7299
103 Ga0207667_10051604 3300025949 Bacteria 4335
104 Ga0207667_10103669 3300025949 Bacteria 2934
105 Ga0207667_10289456 3300025949 Bacteria 1674
106 Ga0207712_10043356 3300025961 Bacteria 3103
107 Ga0207668_10013419 3300025972 Bacteria 5045
108 Ga0207668_10220054 3300025972 Bacteria 1524
109 Ga0207640_10002747 3300025981 Bacteria 9416
110 Ga0207658_10001095 3300025986 Bacteria 21870
111 Ga0207658_10002282 3300025986 Bacteria 14172
112 Ga0207658_10003038 3300025986 Bacteria 11994
113 Ga0207703_10010556 3300026035 Bacteria 7221
114 Ga0207703_10017824 3300026035 Bacteria 5546
115 Ga0207703_10156827 3300026035 Bacteria 1990
116 Ga0207678_10110572 3300026067 Bacteria 2344
117 Ga0207641_10000035 3300026088 Bacteria 214358
118 Ga0207641_10011194 3300026088 Bacteria 7359
119 Ga0207641_10265354 3300026088 Bacteria 1609
120 Ga0207676_10016050 3300026095 Bacteria 5417
121 Ga0207676_10596544 3300026095 Bacteria 1060
122 Ga0207674_10102816 3300026116 Bacteria 2837
123 Ga0207698_10000192 3300026142 Bacteria 38082
124 Ga0207698_10056871 3300026142 Bacteria 3022
125 Ga0207698_10103761 3300026142 Bacteria 2364
126 Ga0209813_10000088 3300027866 Bacteria 34192
127 Ga0268266_10014741 3300028379 Bacteria 6714
128 Ga0268266_10018510 3300028379 Bacteria 5935
129 Ga0268266_10077236 3300028379 Bacteria 2895
130 Ga0268266_10126637 3300028379 Bacteria 2280
131 Ga0268265_10029273 3300028380 Bacteria 3951
132 Ga0268265_10073353 3300028380 Bacteria 2673
133 Ga0268264_10000018 3300028381 Bacteria 495324
134 Ga0268264_10013822 3300028381 Bacteria 6640
135 Ga0268264_10147468 3300028381 Bacteria 2106
136 Ga0268264_10676940 3300028381 Bacteria 1023
137 Ga0268264_10802800 3300028381 Bacteria 940
138 Ga0307508_10037188 3300031616 Bacteria 4380
139 Ga0307410_10234433 3300031852 Bacteria 1419
140 Ga0307410_10494696 3300031852 Bacteria 1005
141 Ga0307412_10005211 3300031911 Bacteria 7289
142 Ga0307412_10328859 3300031911 Bacteria 1219
143 Ga0307416_100058412 3300032002 Bacteria 3127
144 Ga0307416_100227525 3300032002 Bacteria 1795
145 Ga0307414_10020848 3300032004 Bacteria 4094
146 Ga0307414_10057174 3300032004 Bacteria 2740
147 Ga0307414_10113603 3300032004 Bacteria 2067
148 Ga0307414_10124702 3300032004 Bacteria 1987
149 Ga0307411_10103991 3300032005 Bacteria 2016
150 Ga0316584_0109004 3300036712 Bacteria 2072
151 Ga0316581_0036825 3300037588 Bacteria 1486
152 Ga0451853_2051512 3300041512 Bacteria 1505
153 Ga0439462_0000346 3300042015 Bacteria 8755
154 Ga0450912_001485 3300042116 Bacteria 1439
155 Ga0450912_009331 3300042116 Bacteria 826
156 Ga0439435_0079943 3300042436 Bacteria 980
157 Ga0450893_0020858 3300042532 Bacteria 1129
158 Ga0495596_0000053 3300046500 Bacteria 84061
159 Ga0495610_0000901 3300046512 Bacteria 27625
160 Ga0495632_0048783 3300046519 Bacteria 2095
161 Ga0495643_0000199 3300046522 Bacteria 93741
162 Ga0495643_0024059 3300046522 Bacteria 3457
163 Ga0495643_0067749 3300046522 Bacteria 1879
164 Ga0495598_0169212 3300046537 Bacteria 773
165 Ga0495609_0024167 3300046538 Bacteria 2790
166 Ga0495668_0283321 3300046616 Bacteria 908
167 Ga0495625_0045300 3300046660 Bacteria 3180
168 Ga0495671_0120176 3300046692 Bacteria 1282
169 Ga0496100_0001417 3300048903 Bacteria 11726
170 Ga0496100_0013133 3300048903 Bacteria 4768
171 Ga0496101_0011815 3300048904 Bacteria 5808
172 Ga0496102_0000361 3300048905 Bacteria 54882
173 Ga0496102_0197201 3300048905 Bacteria 1897
174 Ga0496102_0512967 3300048905 Bacteria 1121
175 Ga0496103_0001313 3300048906 Bacteria 16890
176 Ga0496104_0000639 3300048907 Bacteria 30026
177 Ga0496104_0006359 3300048907 Bacteria 10390
178 Ga0496105_0000086 3300048908 Bacteria 66447
179 Ga0496105_0003288 3300048908 Bacteria 11928
180 Ga0496105_0214402 3300048908 Bacteria 1569
181 Ga0496106_0025296 3300048909 Bacteria 4417
182 Ga0496107_0005195 3300048910 Bacteria 8897
183 Ga0496107_0081245 3300048910 Bacteria 2364
184 Ga0496109_0063281 3300048912 Bacteria 3384
185 Ga0496109_0198810 3300048912 Bacteria 1884
186 Ga0496111_0256477 3300048914 Bacteria 1297
187 Ga0496111_0268355 3300048914 Bacteria 1266
188 Ga0496112_0005012 3300048915 Bacteria 11367
189 Ga0496113_0000579 3300048916 Bacteria 18255
190 Ga0496113_0013204 3300048916 Bacteria 5583
191 Ga0496114_0010948 3300048917 Bacteria 7232
192 Ga0496116_0109363 3300048919 Bacteria 1629
193 Ga0496117_0007043 3300048920 Bacteria 11125
194 Ga0496118_0012533 3300048921 Bacteria 8125
195 Ga0496118_0022651 3300048921 Bacteria 5482
196 Ga0496118_0099966 3300048921 Bacteria 1964
197 Ga0496119_0000365 3300048922 Bacteria 63466
198 Ga0496120_0001592 3300048923 Bacteria 26385
199 Ga0496120_0108141 3300048923 Bacteria 1457
200 Ga0496121_0000168 3300048924 Bacteria 144896
201 Ga0496121_0001098 3300048924 Bacteria 47733
202 Ga0496121_0028329 3300048924 Bacteria 5216
203 Ga0496121_0041265 3300048924 Bacteria 4036
204 Ga0496122_0000918 3300048925 Bacteria 53963
205 Ga0496123_0002384 3300048926 Bacteria 23561
206 Ga0496124_0003949 3300048927 Bacteria 17710
207 Ga0496125_0001601 3300048928 Bacteria 31988
208 Ga0496126_0000044 3300048929 Bacteria 335904
209 Ga0496126_0003145 3300048929 Bacteria 21275
210 Ga0496126_0037291 3300048929 Bacteria 4538
211 Ga0501047_0489620 3300049581 Bacteria 1057
212 Ga0501224_017073 3300049664 Bacteria 1078
213 Ga0501080_0419222 3300049742 Bacteria 1203
214 Ga0501044_0003461 3300049823 Bacteria 17782
215 Ga0501044_0229214 3300049823 Bacteria 1806
216 nmdc:mga03683_462_c1 3300050489 Bacteria 11721
217 nmdc:mga03n38_60990_c1 3300050490 Bacteria 1717
218 nmdc:mga0yw44_100521_c1 3300050492 Bacteria 1842
219 nmdc:mga0k408_107796_c1 3300050493 Bacteria 1645
220 nmdc:mga06z11_3120_c1 3300050494 Bacteria 6395
221 nmdc:mga04h51_334_c1 3300050495 Bacteria 11841
222 nmdc:mga07m45_19732_c1 3300050496 Bacteria 3654
223 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
224 nmdc:mga0sz30_38_c1 3300050516 Bacteria 47836
225 nmdc:mga0sz30_49904_c1 3300050516 Bacteria 1115
226 nmdc:mga0sz30_94311_c1 3300050516 Bacteria 1304
227 Ga0500643_000001 3300053087 Bacteria 1440111
228 Ga0500641_0121118 3300053096 Bacteria 1128
229 Ga0500595_009242 3300053119 Bacteria 3987
230 Ga0500608_005624 3300053122 Bacteria 5004
231 Ga0500618_012892 3300053125 Bacteria 2176
232 Ga0500559_0027307 3300053136 Bacteria 2436
233 Ga0500564_002419 3300053138 Bacteria 6915
234 Ga0500573_0381337 3300053140 Bacteria 674
235 Ga0500616_0067223 3300053153 Bacteria 1838
236 Ga0500616_0089436 3300053153 Bacteria 1528
237 Ga0500622_0000495 3300053156 Bacteria 36800
238 Ga0500622_0125207 3300053156 Bacteria 1242
239 Ga0500634_0235282 3300053161 Bacteria 774
240 Ga0500567_000495 3300053723 Bacteria 13541
241 Ga0500625_000018 3300053729 Bacteria 94860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053140 Ga0500573_0381337 Ga0500573_0381337_15_614 197
2 3300042015 Ga0439462_0000346 Ga0439462_0000346_53_667 202
3 3300048905 Ga0496102_0197201 Ga0496102_0197201_98_718 203
4 3300048914 Ga0496111_0256477 Ga0496111_0256477_513_1133 203
5 3300050516 nmdc:mga0sz30_49904_c1 nmdc:mga0sz30_49904_c1_452_1069 203
6 3300025900 Ga0207710_10119678 Ga0207710_101196782 219
7 iso_pu_bacteria 2896184354 2896184881 225
8 iso_pu_bacteria 2643221588 2643949209 226
9 iso_pu_bacteria 2919138771 2919139875 227
10 3300032004 Ga0307414_10020848 Ga0307414_100208483 228
11 iso_pu_bacteria 2510917021 2511128739 228
12 3300009094 Ga0111539_10309154 Ga0111539_103091542 229
13 3300026095 Ga0207676_10596544 Ga0207676_105965442 229
14 3300032004 Ga0307414_10124702 Ga0307414_101247022 229
15 3300036712 Ga0316584_0109004 Ga0316584_0109004_12_707 229
16 3300037588 Ga0316581_0036825 Ga0316581_0036825_288_983 229
17 iso_pu_bacteria 2738541275 2738709230 229
18 iso_pu_bacteria 2738541301 2738847655 229
19 iso_pu_bacteria 2738541304 2738863384 229
20 iso_pu_bacteria 2738543022 2739295902 229
21 iso_pu_bacteria 2738543033 2739357580 229
22 iso_pu_bacteria 2928100450 2928102981 229
23 iso_pu_bacteria 2928959182 2928959546 229
24 3300005548 Ga0070665_100171253 Ga0070665_1001712532 230
25 3300005842 Ga0068858_100409637 Ga0068858_1004096372 230
26 3300006946 Ga0079104_1022096 Ga0079104_10220962 230
27 3300013306 Ga0163162_10010083 Ga0163162_100100838 230
28 3300017792 Ga0163161_10005657 Ga0163161_100056577 230
29 3300028379 Ga0268266_10126637 Ga0268266_101266372 230
30 3300031852 Ga0307410_10234433 Ga0307410_102344332 230
31 3300031852 Ga0307410_10494696 Ga0307410_104946961 230
32 3300031911 Ga0307412_10005211 Ga0307412_100052112 230
33 3300032002 Ga0307416_100058412 Ga0307416_1000584123 230
34 3300032002 Ga0307416_100227525 Ga0307416_1002275252 230
35 3300032004 Ga0307414_10057174 Ga0307414_100571742 230
36 3300032004 Ga0307414_10113603 Ga0307414_101136032 230
37 3300032005 Ga0307411_10103991 Ga0307411_101039912 230
38 3300042116 Ga0450912_001485 Ga0450912_001485_427_1125 230
39 3300042532 Ga0450893_0020858 Ga0450893_0020858_83_781 230
40 3300046537 Ga0495598_0169212 Ga0495598_0169212_41_739 230
41 3300048929 Ga0496126_0037291 Ga0496126_0037291_2297_2989 230
42 3300049823 Ga0501044_0229214 Ga0501044_0229214_269_976 230
43 3300053119 Ga0500595_009242 Ga0500595_009242_3226_3933 230
44 3300053156 Ga0500622_0000495 Ga0500622_0000495_12921_13628 230
45 iso_pu_bacteria 2739367664 2739650148 230
46 iso_pu_bacteria 2739367865 2740028621 230
47 3300005337 Ga0070682_100072693 Ga0070682_1000726933 231
48 3300005367 Ga0070667_100001554 Ga0070667_1000015542 231
49 3300005445 Ga0070708_100202378 Ga0070708_1002023782 231
50 3300005468 Ga0070707_100341226 Ga0070707_1003412262 231
51 3300005548 Ga0070665_100002217 Ga0070665_1000022179 231
52 3300005618 Ga0068864_100023102 Ga0068864_1000231023 231
53 3300005841 Ga0068863_100000116 Ga0068863_10000011654 231
54 3300005842 Ga0068858_100015629 Ga0068858_1000156295 231
55 3300005843 Ga0068860_100000008 Ga0068860_100000008195 231
56 3300005844 Ga0068862_100008115 Ga0068862_1000081155 231
57 3300025298 Ga0209050_1000215 Ga0209050_100021576 231
58 3300025922 Ga0207646_10325957 Ga0207646_103259572 231
59 3300025986 Ga0207658_10003038 Ga0207658_1000303812 231
60 3300026035 Ga0207703_10010556 Ga0207703_100105565 231
61 3300026067 Ga0207678_10110572 Ga0207678_101105722 231
62 3300026088 Ga0207641_10000035 Ga0207641_1000003528 231
63 3300026095 Ga0207676_10016050 Ga0207676_100160504 231
64 3300028379 Ga0268266_10014741 Ga0268266_100147414 231
65 3300028381 Ga0268264_10000018 Ga0268264_10000018338 231
66 3300031911 Ga0307412_10328859 Ga0307412_103288592 231
67 3300042116 Ga0450912_009331 Ga0450912_009331_87_788 231
68 3300048907 Ga0496104_0006359 Ga0496104_0006359_4406_5104 231
69 3300048908 Ga0496105_0003288 Ga0496105_0003288_4731_5429 231
70 3300048923 Ga0496120_0108141 Ga0496120_0108141_47_745 231
71 3300048924 Ga0496121_0041265 Ga0496121_0041265_790_1488 231
72 3300002459 JGI24751J29686_10000766 JGI24751J29686_100007662 232
73 3300005563 Ga0068855_100004478 Ga0068855_10000447814 232
74 3300006353 Ga0075370_10024058 Ga0075370_100240582 232
75 3300009177 Ga0105248_10371887 Ga0105248_103718871 232
76 3300025949 Ga0207667_10020753 Ga0207667_100207533 232
77 3300031616 Ga0307508_10037188 Ga0307508_100371883 232
78 3300041512 Ga0451853_2051512 Ga0451853_2051512_70_774 232
79 3300042436 Ga0439435_0079943 Ga0439435_0079943_201_911 232
80 3300046500 Ga0495596_0000053 Ga0495596_0000053_74752_75459 232
81 3300046512 Ga0495610_0000901 Ga0495610_0000901_26115_26819 232
82 3300046519 Ga0495632_0048783 Ga0495632_0048783_410_1117 232
83 3300046522 Ga0495643_0000199 Ga0495643_0000199_48189_48893 232
84 3300046522 Ga0495643_0024059 Ga0495643_0024059_1771_2478 232
85 3300046522 Ga0495643_0067749 Ga0495643_0067749_765_1469 232
86 3300046538 Ga0495609_0024167 Ga0495609_0024167_278_985 232
87 3300046616 Ga0495668_0283321 Ga0495668_0283321_55_759 232
88 3300046660 Ga0495625_0045300 Ga0495625_0045300_2162_2869 232
89 3300046692 Ga0495671_0120176 Ga0495671_0120176_315_1022 232
90 3300048921 Ga0496118_0012533 Ga0496118_0012533_2482_3186 232
91 3300048924 Ga0496121_0001098 Ga0496121_0001098_22094_22798 232
92 3300049664 Ga0501224_017073 Ga0501224_017073_350_1054 232
93 3300050496 nmdc:mga07m45_19732_c1 nmdc:mga07m45_19732_c1_1972_2676 232
94 3300053087 Ga0500643_000001 Ga0500643_000001_1381805_1382512 232
95 3300053096 Ga0500641_0121118 Ga0500641_0121118_131_838 232
96 3300053153 Ga0500616_0067223 Ga0500616_0067223_756_1463 232
97 3300053153 Ga0500616_0089436 Ga0500616_0089436_444_1148 232
98 3300053156 Ga0500622_0125207 Ga0500622_0125207_424_1131 232
99 3300053161 Ga0500634_0235282 Ga0500634_0235282_49_753 232
100 2162886007 SwRhRL2b_contig_3273488 SwRhRL2b_0336.00004650 233
101 3300005289 Ga0065704_10070144 Ga0065704_10070144135 233
102 3300005289 Ga0065704_10070650 Ga0065704_100706504 233
103 3300005295 Ga0065707_10084332 Ga0065707_100843326 233
104 3300005331 Ga0070670_100568889 Ga0070670_1005688892 233
105 3300005335 Ga0070666_10041200 Ga0070666_100412002 233
106 3300005347 Ga0070668_100005320 Ga0070668_1000053204 233
107 3300005353 Ga0070669_100000986 Ga0070669_10000098616 233
108 3300005355 Ga0070671_100551021 Ga0070671_1005510211 233
109 3300005367 Ga0070667_100001382 Ga0070667_10000138217 233
110 3300005367 Ga0070667_100003201 Ga0070667_1000032015 233
111 3300005548 Ga0070665_100001006 Ga0070665_1000010069 233
112 3300005841 Ga0068863_100012243 Ga0068863_1000122436 233
113 3300005843 Ga0068860_100009560 Ga0068860_1000095607 233
114 3300005843 Ga0068860_100064012 Ga0068860_1000640122 233
115 3300005844 Ga0068862_100014855 Ga0068862_1000148554 233
116 3300005844 Ga0068862_100015966 Ga0068862_1000159662 233
117 3300006195 Ga0075366_10149123 Ga0075366_101491232 233
118 3300025711 Ga0207696_1006612 Ga0207696_10066124 233
119 3300025735 Ga0207713_1008627 Ga0207713_10086273 233
120 3300025903 Ga0207680_10025753 Ga0207680_100257533 233
121 3300025923 Ga0207681_10000145 Ga0207681_1000014516 233
122 3300025931 Ga0207644_10400827 Ga0207644_104008272 233
123 3300025961 Ga0207712_10043356 Ga0207712_100433563 233
124 3300025972 Ga0207668_10013419 Ga0207668_100134193 233
125 3300025986 Ga0207658_10001095 Ga0207658_100010955 233
126 3300025986 Ga0207658_10002282 Ga0207658_1000228212 233
127 3300026088 Ga0207641_10011194 Ga0207641_100111944 233
128 3300028379 Ga0268266_10018510 Ga0268266_100185105 233
129 3300028380 Ga0268265_10029273 Ga0268265_100292733 233
130 3300028381 Ga0268264_10013822 Ga0268264_100138222 233
131 3300048903 Ga0496100_0001417 Ga0496100_0001417_1170_1871 233
132 3300048904 Ga0496101_0011815 Ga0496101_0011815_2660_3361 233
133 3300048905 Ga0496102_0000361 Ga0496102_0000361_39083_39784 233
134 3300048906 Ga0496103_0001313 Ga0496103_0001313_15055_15756 233
135 3300048907 Ga0496104_0000639 Ga0496104_0000639_5405_6106 233
136 3300048908 Ga0496105_0000086 Ga0496105_0000086_22312_23013 233
137 3300048910 Ga0496107_0081245 Ga0496107_0081245_1178_1879 233
138 3300048915 Ga0496112_0005012 Ga0496112_0005012_8956_9657 233
139 3300048916 Ga0496113_0000579 Ga0496113_0000579_2545_3246 233
140 3300048919 Ga0496116_0109363 Ga0496116_0109363_288_989 233
141 3300048920 Ga0496117_0007043 Ga0496117_0007043_7540_8241 233
142 3300048921 Ga0496118_0022651 Ga0496118_0022651_2872_3573 233
143 3300048921 Ga0496118_0099966 Ga0496118_0099966_741_1448 233
144 3300048922 Ga0496119_0000365 Ga0496119_0000365_57233_57934 233
145 3300048923 Ga0496120_0001592 Ga0496120_0001592_15102_15803 233
146 3300048924 Ga0496121_0000168 Ga0496121_0000168_110895_111605 233
147 3300048924 Ga0496121_0028329 Ga0496121_0028329_789_1490 233
148 3300048925 Ga0496122_0000918 Ga0496122_0000918_2651_3352 233
149 3300048926 Ga0496123_0002384 Ga0496123_0002384_12562_13263 233
150 3300048927 Ga0496124_0003949 Ga0496124_0003949_9192_9893 233
151 3300048928 Ga0496125_0001601 Ga0496125_0001601_10427_11128 233
152 3300048929 Ga0496126_0000044 Ga0496126_0000044_7007_7708 233
153 3300049581 Ga0501047_0489620 Ga0501047_0489620_19_729 233
154 3300049742 Ga0501080_0419222 Ga0501080_0419222_283_993 233
155 3300049823 Ga0501044_0003461 Ga0501044_0003461_10571_11281 233
156 3300053125 Ga0500618_012892 Ga0500618_012892_55_765 233
157 3300005327 Ga0070658_10000125 Ga0070658_1000012512 234
158 3300005331 Ga0070670_100104557 Ga0070670_1001045572 234
159 3300005335 Ga0070666_10003287 Ga0070666_100032875 234
160 3300005347 Ga0070668_100032898 Ga0070668_1000328984 234
161 3300005347 Ga0070668_100232485 Ga0070668_1002324851 234
162 3300005347 Ga0070668_100339368 Ga0070668_1003393681 234
163 3300005353 Ga0070669_100000666 Ga0070669_10000066612 234
164 3300005355 Ga0070671_100000052 Ga0070671_10000005210 234
165 3300005355 Ga0070671_100196058 Ga0070671_1001960582 234
166 3300005548 Ga0070665_100252898 Ga0070665_1002528982 234
167 3300005563 Ga0068855_100040874 Ga0068855_1000408745 234
168 3300005563 Ga0068855_100217229 Ga0068855_1002172292 234
169 3300005577 Ga0068857_100129968 Ga0068857_1001299682 234
170 3300005578 Ga0068854_100012800 Ga0068854_1000128005 234
171 3300005616 Ga0068852_100000317 Ga0068852_1000003176 234
172 3300005616 Ga0068852_100019554 Ga0068852_1000195545 234
173 3300005616 Ga0068852_100189702 Ga0068852_1001897022 234
174 3300005617 Ga0068859_100003457 Ga0068859_10000345710 234
175 3300005618 Ga0068864_100036246 Ga0068864_1000362465 234
176 3300005841 Ga0068863_100448056 Ga0068863_1004480562 234
177 3300005842 Ga0068858_100008924 Ga0068858_1000089245 234
178 3300005842 Ga0068858_100025649 Ga0068858_1000256493 234
179 3300005843 Ga0068860_100053447 Ga0068860_1000534473 234
180 3300005844 Ga0068862_100539865 Ga0068862_1005398652 234
181 3300006038 Ga0075365_10317918 Ga0075365_103179182 234
182 3300006042 Ga0075368_10000047 Ga0075368_100000477 234
183 3300006177 Ga0075362_10001106 Ga0075362_100011063 234
184 3300006178 Ga0075367_10004787 Ga0075367_100047874 234
185 3300006186 Ga0075369_10031404 Ga0075369_100314043 234
186 3300006195 Ga0075366_10102888 Ga0075366_101028881 234
187 3300006353 Ga0075370_10114231 Ga0075370_101142312 234
188 3300006931 Ga0097620_100003457 Ga0097620_10000345710 234
189 3300009093 Ga0105240_10016780 Ga0105240_100167803 234
190 3300009177 Ga0105248_10016138 Ga0105248_100161388 234
191 3300009177 Ga0105248_10080931 Ga0105248_100809312 234
192 3300009553 Ga0105249_10063044 Ga0105249_100630442 234
193 3300013306 Ga0163162_10239676 Ga0163162_102396762 234
194 3300014325 Ga0163163_10399929 Ga0163163_103999292 234
195 3300014326 Ga0157380_10113653 Ga0157380_101136532 234
196 3300014968 Ga0157379_10484240 Ga0157379_104842401 234
197 3300025904 Ga0207647_10033551 Ga0207647_100335512 234
198 3300025909 Ga0207705_10000004 Ga0207705_10000004609 234
199 3300025913 Ga0207695_10013384 Ga0207695_100133847 234
200 3300025923 Ga0207681_10001698 Ga0207681_100016982 234
201 3300025925 Ga0207650_10052741 Ga0207650_100527413 234
202 3300025931 Ga0207644_10000003 Ga0207644_10000003490 234
203 3300025931 Ga0207644_10165903 Ga0207644_101659031 234
204 3300025941 Ga0207711_10056468 Ga0207711_100564682 234
205 3300025941 Ga0207711_10111758 Ga0207711_101117582 234
206 3300025949 Ga0207667_10051604 Ga0207667_100516044 234
207 3300025949 Ga0207667_10103669 Ga0207667_101036692 234
208 3300025949 Ga0207667_10289456 Ga0207667_102894562 234
209 3300025972 Ga0207668_10220054 Ga0207668_102200541 234
210 3300025981 Ga0207640_10002747 Ga0207640_100027476 234
211 3300026035 Ga0207703_10017824 Ga0207703_100178245 234
212 3300026035 Ga0207703_10156827 Ga0207703_101568272 234
213 3300026088 Ga0207641_10265354 Ga0207641_102653542 234
214 3300026116 Ga0207674_10102816 Ga0207674_101028163 234
215 3300026142 Ga0207698_10000192 Ga0207698_1000019217 234
216 3300026142 Ga0207698_10056871 Ga0207698_100568713 234
217 3300026142 Ga0207698_10103761 Ga0207698_101037612 234
218 3300027866 Ga0209813_10000088 Ga0209813_100000885 234
219 3300028379 Ga0268266_10077236 Ga0268266_100772362 234
220 3300028380 Ga0268265_10073353 Ga0268265_100733532 234
221 3300028381 Ga0268264_10147468 Ga0268264_101474682 234
222 3300028381 Ga0268264_10676940 Ga0268264_106769402 234
223 3300048903 Ga0496100_0013133 Ga0496100_0013133_29_754 234
224 3300048905 Ga0496102_0512967 Ga0496102_0512967_185_898 234
225 3300048908 Ga0496105_0214402 Ga0496105_0214402_428_1141 234
226 3300048909 Ga0496106_0025296 Ga0496106_0025296_1009_1734 234
227 3300048910 Ga0496107_0005195 Ga0496107_0005195_214_939 234
228 3300048912 Ga0496109_0063281 Ga0496109_0063281_1259_1972 234
229 3300048912 Ga0496109_0198810 Ga0496109_0198810_737_1462 234
230 3300048914 Ga0496111_0268355 Ga0496111_0268355_177_890 234
231 3300048916 Ga0496113_0013204 Ga0496113_0013204_1410_2135 234
232 3300048917 Ga0496114_0010948 Ga0496114_0010948_5135_5848 234
233 3300048929 Ga0496126_0003145 Ga0496126_0003145_7895_8608 234
234 3300050489 nmdc:mga03683_462_c1 nmdc:mga03683_462_c1_9389_10111 234
235 3300050490 nmdc:mga03n38_60990_c1 nmdc:mga03n38_60990_c1_714_1436 234
236 3300050492 nmdc:mga0yw44_100521_c1 nmdc:mga0yw44_100521_c1_231_953 234
237 3300050493 nmdc:mga0k408_107796_c1 nmdc:mga0k408_107796_c1_704_1408 234
238 3300050494 nmdc:mga06z11_3120_c1 nmdc:mga06z11_3120_c1_1126_1848 234
239 3300050495 nmdc:mga04h51_334_c1 nmdc:mga04h51_334_c1_3775_4497 234
240 3300050496 nmdc:mga07m45_4_c1 nmdc:mga07m45_4_c1_346460_347182 234
241 3300050516 nmdc:mga0sz30_38_c1 nmdc:mga0sz30_38_c1_42568_43290 234
242 3300050516 nmdc:mga0sz30_94311_c1 nmdc:mga0sz30_94311_c1_459_1169 234
243 3300053122 Ga0500608_005624 Ga0500608_005624_4030_4740 234
244 3300053136 Ga0500559_0027307 Ga0500559_0027307_773_1483 234
245 3300053138 Ga0500564_002419 Ga0500564_002419_235_945 234
246 3300053723 Ga0500567_000495 Ga0500567_000495_1612_2322 234
247 3300053729 Ga0500625_000018 Ga0500625_000018_62254_62964 234
248 2162886007 SwRhRL2b_contig_1778839 SwRhRL2b_0637.00003540 236
249 3300009011 Ga0105251_10033134 Ga0105251_100331342 236
250 3300009101 Ga0105247_10343121 Ga0105247_103431211 236
251 3300009177 Ga0105248_10655898 Ga0105248_106558982 236
252 3300009553 Ga0105249_10072391 Ga0105249_100723913 236
253 3300013306 Ga0163162_10025838 Ga0163162_100258383 236
254 3300028381 Ga0268264_10802800 Ga0268264_108028002 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

24

243

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.9311 5 236
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.9193 6 236
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.9184 5 236
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.9121 5 236
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.8998 5 236
ID Description Score Start End Superfamily
af_Q18927_1_243_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9336 5 234 3.40.50.1820
af_O17263_18_263_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9335 6 233 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9309 5 236 3.40.50.1820
af_Q18925_2_245_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.921 6 236 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9119 5 236 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A845A2H8-F1-model_v4 Prolyl oligopeptidase family serine peptidase 0.9851 6 236 GO:0052689
AF-A0A844YF18-F1-model_v4 Prolyl oligopeptidase family serine peptidase 0.9734 7 236 GO:0052689
AF-A0A845A2H8-F1-model_v4 Prolyl oligopeptidase family serine peptidase 0.9725 6 236 GO:0052689
AF-A0A1N6G937-F1-model_v4 Dienelactone hydrolase 0.9718 5 234 GO:0052689
AF-A0A352H5E6-F1-model_v4 deleted 0.9706 6 129

Feature Viewer

pLDDT pTM Quality
94.77 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map