F364627

General Info

Members Datasets Scaffolds Average Seq Length
254 141 508 109

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100417786|Ga0070682_1004177862
Length 123
Sequence MTNNTTTAPNPENLITWADFEKVDLRIGTIVRAESFPKARKPAYKLWVDLGEELGIKQSSAQITELYPQDSLPGQQVLCVVNFPPRQVADFISEILVTGFIVSEGKVVLAQPGKPVPNGTKLA

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
58 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
93 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
94 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
100 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
108 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
136 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
141 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.15
Nodule 0
Rhizoplane 1.18
Rhizosphere 93.7
Stem 0
Stem Tuber 0
Unclassified 18.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100417786 3300005337 Bacteria 1019
2 Ga0065707_10341491 3300005295 Bacteria 933
3 Ga0070676_10630483 3300005328 Unclassified 776
4 Ga0070670_100676591 3300005331 Unclassified 927
5 Ga0070677_10100114 3300005333 Viruses 1276
6 Ga0068869_100012050 3300005334 Bacteria 5697
7 Ga0070687_101444748 3300005343 Bacteria 515
8 Ga0070692_10300425 3300005345 Unclassified 980
9 Ga0070669_100002755 3300005353 Bacteria 12681
10 Ga0070671_101146546 3300005355 Bacteria 683
11 Ga0070703_10366420 3300005406 Unclassified 619
12 Ga0070714_100773415 3300005435 Unclassified 929
13 Ga0070705_100118451 3300005440 Unclassified 1705
14 Ga0070700_101505233 3300005441 Bacteria 572
15 Ga0070694_100230300 3300005444 Bacteria 1394
16 Ga0070694_101904474 3300005444 Bacteria 508
17 Ga0070708_100053069 3300005445 Bacteria 3596
18 Ga0070708_100069751 3300005445 Bacteria 3161
19 Ga0070708_100107729 3300005445 Bacteria 2558
20 Ga0070708_100514173 3300005445 Bacteria 1129
21 Ga0070708_101093494 3300005445 Bacteria 747
22 Ga0070663_100767926 3300005455 Unclassified 824
23 Ga0070662_100534357 3300005457 Bacteria 981
24 Ga0070662_101249456 3300005457 Bacteria 639
25 Ga0070706_100007960 3300005467 Bacteria 9893
26 Ga0070706_100024833 3300005467 Bacteria 5517
27 Ga0070706_100039668 3300005467 Bacteria 4346
28 Ga0070706_100214144 3300005467 Bacteria 1798
29 Ga0070706_100740871 3300005467 Bacteria 911
30 Ga0070707_100013406 3300005468 Bacteria 7666
31 Ga0070707_100067571 3300005468 Bacteria 3439
32 Ga0070707_100086873 3300005468 Bacteria 3025
33 Ga0070707_101430804 3300005468 Bacteria 658
34 Ga0070698_100000778 3300005471 Bacteria 34585
35 Ga0070698_100016545 3300005471 Bacteria 7781
36 Ga0070698_100084929 3300005471 Unclassified 3153
37 Ga0070698_100362950 3300005471 Bacteria 1380
38 Ga0070698_100365069 3300005471 Bacteria 1376
39 Ga0070699_100000458 3300005518 Bacteria 39195
40 Ga0070699_100052955 3300005518 Bacteria 3512
41 Ga0070699_100110157 3300005518 Bacteria 2417
42 Ga0070699_100137388 3300005518 Bacteria 2157
43 Ga0070699_100216937 3300005518 Bacteria 1704
44 Ga0070699_100362836 3300005518 Unclassified 1306
45 Ga0070697_100007208 3300005536 Bacteria 8646
46 Ga0070697_100185045 3300005536 Bacteria 1766
47 Ga0070697_101258798 3300005536 Bacteria 660
48 Ga0070695_100291038 3300005545 Bacteria 1204
49 Ga0070696_100077568 3300005546 Bacteria 2348
50 Ga0070693_100068142 3300005547 Bacteria 2088
51 Ga0070704_100008324 3300005549 Bacteria 6213
52 Ga0070704_100559897 3300005549 Bacteria 1000
53 Ga0070704_100791233 3300005549 Unclassified 847
54 Ga0068856_102223932 3300005614 Bacteria 557
55 Ga0068856_102667810 3300005614 Bacteria 505
56 Ga0068859_100390606 3300005617 Bacteria 1487
57 Ga0068864_100171734 3300005618 Bacteria 1977
58 Ga0068864_100210446 3300005618 Unclassified 1790
59 Ga0068866_11318618 3300005718 Unclassified 525
60 Ga0068861_100267000 3300005719 Bacteria 1468
61 Ga0068863_100013306 3300005841 Bacteria 7936
62 Ga0068863_100648251 3300005841 Bacteria 1047
63 Ga0068863_102028362 3300005841 Bacteria 585
64 Ga0068860_100160535 3300005843 Bacteria 2167
65 Ga0068860_100364586 3300005843 Unclassified 1424
66 Ga0068860_102072495 3300005843 Unclassified 590
67 Ga0068862_100074620 3300005844 Bacteria 2932
68 Ga0068862_101347146 3300005844 Unclassified 716
69 Ga0068862_102626751 3300005844 Unclassified 515
70 Ga0070717_10010125 3300006028 Bacteria 7099
71 Ga0075428_100002164 3300006844 Bacteria 21251
72 Ga0075428_100122850 3300006844 Bacteria 2826
73 Ga0075430_100000893 3300006846 Bacteria 23384
74 Ga0075430_100999659 3300006846 Bacteria 689
75 Ga0075431_100022517 3300006847 Bacteria 6442
76 Ga0075431_100062794 3300006847 Bacteria 3833
77 Ga0075431_100076077 3300006847 Bacteria 3464
78 Ga0075431_100190588 3300006847 Bacteria 2101
79 Ga0075431_101024370 3300006847 Bacteria 792
80 Ga0075433_10000230 3300006852 Bacteria 31980
81 Ga0075433_10009354 3300006852 Bacteria 7835
82 Ga0075433_10011237 3300006852 Bacteria 7208
83 Ga0075433_10276182 3300006852 Bacteria 1489
84 Ga0075433_10458647 3300006852 Bacteria 1123
85 Ga0075433_11084146 3300006852 Bacteria 697
86 Ga0075434_100202094 3300006871 Bacteria 2007
87 Ga0075434_100207333 3300006871 Bacteria 1981
88 Ga0075434_100516790 3300006871 Bacteria 1214
89 Ga0075434_100767138 3300006871 Unclassified 981
90 Ga0075429_100000757 3300006880 Bacteria 25402
91 Ga0075429_100001793 3300006880 Bacteria 17793
92 Ga0075429_100041111 3300006880 Bacteria 4026
93 Ga0075429_100052416 3300006880 Bacteria 3550
94 Ga0075429_100134597 3300006880 Bacteria 2163
95 Ga0075429_101014358 3300006880 Unclassified 725
96 Ga0068865_101126247 3300006881 Bacteria 692
97 Ga0075436_101175994 3300006914 Bacteria 578
98 Ga0097620_100390589 3300006931 Bacteria 1487
99 Ga0075435_100048246 3300007076 Bacteria 3421
100 Ga0075435_100105651 3300007076 Bacteria 2337
101 Ga0099794_10214470 3300007265 Bacteria 988
102 Ga0111539_10008974 3300009094 Bacteria 12658
103 Ga0111539_10467869 3300009094 Bacteria 1468
104 Ga0111539_10682951 3300009094 Bacteria 1195
105 Ga0114129_10000599 3300009147 Bacteria 44461
106 Ga0114129_10008029 3300009147 Bacteria 15033
107 Ga0114129_10016080 3300009147 Bacteria 10644
108 Ga0114129_10023637 3300009147 Bacteria 8711
109 Ga0114129_10143572 3300009147 Bacteria 3271
110 Ga0114129_10396443 3300009147 Bacteria 1820
111 Ga0114129_11175978 3300009147 Bacteria 956
112 Ga0105243_10110773 3300009148 Bacteria 2296
113 Ga0105241_10696604 3300009174 Bacteria 927
114 Ga0105242_10516166 3300009176 Bacteria 1139
115 Ga0105242_11812099 3300009176 Unclassified 649
116 Ga0105248_10506511 3300009177 Bacteria 1361
117 Ga0105238_10483774 3300009551 Bacteria 1237
118 Ga0105249_10503163 3300009553 Bacteria 1257
119 Ga0105249_12580633 3300009553 Bacteria 580
120 Ga0105239_10017723 3300010375 Bacteria 7879
121 Ga0157336_1026068 3300012477 Bacteria 560
122 Ga0157326_1000860 3300012513 Bacteria 3497
123 Ga0157373_11216785 3300013100 Bacteria 568
124 Ga0163162_10024603 3300013306 Bacteria 5946
125 Ga0163162_11183559 3300013306 Bacteria 867
126 Ga0163162_11567560 3300013306 Bacteria 751
127 Ga0163163_10514698 3300014325 Unclassified 1259
128 Ga0157380_10349870 3300014326 Bacteria 1382
129 Ga0157380_10492107 3300014326 Bacteria 1189
130 Ga0157379_10364124 3300014968 Bacteria 1325
131 Ga0209025_1022799 3300025294 Bacteria 3302
132 Ga0209050_1020926 3300025298 Bacteria 2411
133 Ga0207653_10124052 3300025885 Unclassified 932
134 Ga0207645_10530408 3300025907 Unclassified 798
135 Ga0207684_10001904 3300025910 Bacteria 21671
136 Ga0207684_10135551 3300025910 Bacteria 2114
137 Ga0207684_10262446 3300025910 Bacteria 1490
138 Ga0207684_10276684 3300025910 Bacteria 1448
139 Ga0207684_10899446 3300025910 Bacteria 744
140 Ga0207684_11001132 3300025910 Bacteria 699
141 Ga0207654_10057379 3300025911 Bacteria 2262
142 Ga0207695_10649997 3300025913 Bacteria 935
143 Ga0207646_10012923 3300025922 Bacteria 8002
144 Ga0207646_10014058 3300025922 Bacteria 7615
145 Ga0207646_10050628 3300025922 Bacteria 3716
146 Ga0207646_10394450 3300025922 Bacteria 1250
147 Ga0207650_10564430 3300025925 Unclassified 955
148 Ga0207664_10265617 3300025929 Unclassified 1502
149 Ga0207644_11340782 3300025931 Bacteria 601
150 Ga0207706_10395170 3300025933 Bacteria 1199
151 Ga0207686_11199261 3300025934 Unclassified 621
152 Ga0207709_10048469 3300025935 Bacteria 2588
153 Ga0207704_11034315 3300025938 Bacteria 696
154 Ga0207691_10488487 3300025940 Bacteria 1046
155 Ga0207711_10057183 3300025941 Bacteria 3353
156 Ga0207668_10014274 3300025972 Bacteria 4915
157 Ga0207678_10360307 3300026067 Bacteria 1255
158 Ga0207641_11074540 3300026088 Bacteria 803
159 Ga0207648_10186817 3300026089 Bacteria 1836
160 Ga0207428_10569877 3300027907 Bacteria 818
161 Ga0268265_10063145 3300028380 Bacteria 2848
162 Ga0268264_10182514 3300028381 Unclassified 1907
163 Ga0268264_10246962 3300028381 Bacteria 1656
164 Ga0268264_10378603 3300028381 Bacteria 1355
165 Ga0307509_10111119 3300031507 Bacteria 2744
166 Ga0307408_100966158 3300031548 Bacteria 783
167 Ga0307413_10349760 3300031824 Unclassified 1140
168 Ga0307411_11159632 3300032005 Bacteria 699
169 Ga0307507_10021339 3300033179 Bacteria 7214
170 Ga0373948_0105007 3300034817 Unclassified 669
171 Ga0373932_0008913 3300035112 Bacteria 2404
172 Ga0395899_0066393 3300037312 Bacteria 2649
173 Ga0395899_0847390 3300037312 Unclassified 561
174 Ga0395900_0008206 3300037418 Bacteria 10749
175 Ga0395900_0036424 3300037418 Bacteria 5073
176 Ga0395898_0019793 3300037466 Bacteria 6845
177 Ga0395901_0000399 3300038443 Bacteria 51867
178 Ga0451791_1516970 3300041451 Unclassified 593
179 Ga0451849_0051892 3300041505 Unclassified 561
180 Ga0451577_0337673 3300042876 Bacteria 1366
181 Ga0451577_0971087 3300042876 Unclassified 764
182 Ga0466982_0013349 3300044672 Bacteria 4415
183 Ga0466965_0597390 3300044683 Bacteria 627
184 Ga0453684_0007524 3300044712 Bacteria 19981
185 Ga0453684_0420903 3300044712 Bacteria 1492
186 Ga0451576_0095992 3300045051 Bacteria 3084
187 Ga0451576_0880816 3300045051 Bacteria 939
188 Ga0451576_1150311 3300045051 Bacteria 811
189 Ga0451576_2328193 3300045051 Bacteria 549
190 Ga0451576_2449453 3300045051 Bacteria 533
191 Ga0495580_0000331 3300046472 Bacteria 38649
192 Ga0495580_0238311 3300046472 Bacteria 1248
193 Ga0495659_0012817 3300046664 Bacteria 2722
194 Ga0495659_0030740 3300046664 Unclassified 1871
195 Ga0495669_0058942 3300046684 Bacteria 1733
196 Ga0496106_0499435 3300048909 Bacteria 977
197 Ga0496108_0376395 3300048911 Bacteria 1240
198 Ga0501031_0702605 3300049568 Bacteria 649
199 Ga0501032_0634001 3300049569 Unclassified 679
200 Ga0501034_0048662 3300049571 Bacteria 4279
201 Ga0501034_0107076 3300049571 Bacteria 2788
202 Ga0501036_0088860 3300049572 Unclassified 2611
203 Ga0501048_0090603 3300049582 Bacteria 2157
204 Ga0501068_1200642 3300049584 Bacteria 503
205 Ga0501074_0136855 3300049590 Bacteria 1752
206 Ga0501075_0845963 3300049591 Unclassified 696
207 Ga0501076_0196287 3300049592 Unclassified 1648
208 Ga0501079_0090380 3300049741 Bacteria 2372
209 Ga0501079_0535994 3300049741 Bacteria 920
210 Ga0501079_0646313 3300049741 Unclassified 833
211 Ga0501080_1036287 3300049742 Unclassified 710
212 Ga0501081_0127946 3300049743 Bacteria 1813
213 Ga0501035_0220624 3300049822 Unclassified 1619
214 Ga0501035_0309599 3300049822 Bacteria 1329
215 Ga0501044_0436031 3300049823 Unclassified 1219
216 Ga0501044_1177983 3300049823 Unclassified 634
217 nmdc:mga05p37_118323_c1 3300050507 Bacteria 3256
218 nmdc:mga05p37_137934_c1 3300050507 Bacteria 2990
219 nmdc:mga05p37_1462081_c1 3300050507 Unclassified 683
220 nmdc:mga05p37_241682_c1 3300050507 Bacteria 2171
221 nmdc:mga05p37_29985_c1 3300050507 Bacteria 6637
222 nmdc:mga05p37_60003_c1 3300050507 Bacteria 4684
223 nmdc:mga05p37_699290_c1 3300050507 Bacteria 1126
224 nmdc:mga05p37_7885_c1 3300050507 Bacteria 12567
225 nmdc:mga09592_1012_c1 3300050508 Bacteria 22338
226 nmdc:mga09592_1181210_c1 3300050508 Unclassified 633
227 nmdc:mga09592_205769_c1 3300050508 Bacteria 1705
228 nmdc:mga09592_25101_c1 3300050508 Bacteria 4931
229 nmdc:mga09592_494567_c1 3300050508 Bacteria 1053
230 nmdc:mga09592_71817_c1 3300050508 Bacteria 2938
231 nmdc:mga0qj67_108228_c1 3300050509 Bacteria 2243
232 nmdc:mga0qj67_1576599_c1 3300050509 Bacteria 504
233 nmdc:mga06r32_1549_c1 3300050510 Bacteria 20719
234 nmdc:mga06r32_70273_c1 3300050510 Bacteria 3385
235 nmdc:mga06r32_708967_c1 3300050510 Bacteria 971
236 nmdc:mga08y16_29427_c1 3300050511 Bacteria 5787
237 nmdc:mga08y16_373031_c1 3300050511 Bacteria 1463
238 nmdc:mga0n895_195086_c1 3300050512 Bacteria 2056
239 nmdc:mga0n895_38036_c1 3300050512 Bacteria 4660
240 nmdc:mga0n895_800728_c1 3300050512 Unclassified 933
241 nmdc:mga0rr50_23701_c1 3300050513 Bacteria 4238
242 nmdc:mga0a205_34506_c1 3300050515 Bacteria 4853
243 nmdc:mga0a205_895_c1 3300050515 Bacteria 17939
244 nmdc:mga0a205_92450_c1 3300050515 Bacteria 2923
245 Ga0495619_0568211 3300053085 Unclassified 777
246 Ga0500644_0097797 3300053088 Bacteria 1110
247 Ga0500555_106372 3300053103 Bacteria 709
248 Ga0500608_000979 3300053122 Bacteria 10258
249 Ga0500616_0025921 3300053153 Bacteria 3250
250 Ga0500616_0028220 3300053153 Bacteria 3094
251 Ga0500622_0014266 3300053156 Bacteria 4271
252 Ga0501084_0064483 3300054114 Bacteria 3066
253 Ga0530510_0312472 3300061734 Bacteria 1177
254 2595319064 2593339198 Bacteria 7267884
255 Ga0070682_100417786
256 Ga0065707_10341491
257 Ga0070676_10630483
258 Ga0070670_100676591
259 Ga0070677_10100114
260 Ga0068869_100012050
261 Ga0070687_101444748
262 Ga0070692_10300425
263 Ga0070669_100002755
264 Ga0070671_101146546
265 Ga0070703_10366420
266 Ga0070714_100773415
267 Ga0070705_100118451
268 Ga0070700_101505233
269 Ga0070694_100230300
270 Ga0070694_101904474
271 Ga0070708_100053069
272 Ga0070708_100069751
273 Ga0070708_100107729
274 Ga0070708_100514173
275 Ga0070708_101093494
276 Ga0070663_100767926
277 Ga0070662_100534357
278 Ga0070662_101249456
279 Ga0070706_100007960
280 Ga0070706_100024833
281 Ga0070706_100039668
282 Ga0070706_100214144
283 Ga0070706_100740871
284 Ga0070707_100013406
285 Ga0070707_100067571
286 Ga0070707_100086873
287 Ga0070707_101430804
288 Ga0070698_100000778
289 Ga0070698_100016545
290 Ga0070698_100084929
291 Ga0070698_100362950
292 Ga0070698_100365069
293 Ga0070699_100000458
294 Ga0070699_100052955
295 Ga0070699_100110157
296 Ga0070699_100137388
297 Ga0070699_100216937
298 Ga0070699_100362836
299 Ga0070697_100007208
300 Ga0070697_100185045
301 Ga0070697_101258798
302 Ga0070695_100291038
303 Ga0070696_100077568
304 Ga0070693_100068142
305 Ga0070704_100008324
306 Ga0070704_100559897
307 Ga0070704_100791233
308 Ga0068856_102223932
309 Ga0068856_102667810
310 Ga0068859_100390606
311 Ga0068864_100171734
312 Ga0068864_100210446
313 Ga0068866_11318618
314 Ga0068861_100267000
315 Ga0068863_100013306
316 Ga0068863_100648251
317 Ga0068863_102028362
318 Ga0068860_100160535
319 Ga0068860_100364586
320 Ga0068860_102072495
321 Ga0068862_100074620
322 Ga0068862_101347146
323 Ga0068862_102626751
324 Ga0070717_10010125
325 Ga0075428_100002164
326 Ga0075428_100122850
327 Ga0075430_100000893
328 Ga0075430_100999659
329 Ga0075431_100022517
330 Ga0075431_100062794
331 Ga0075431_100076077
332 Ga0075431_100190588
333 Ga0075431_101024370
334 Ga0075433_10000230
335 Ga0075433_10009354
336 Ga0075433_10011237
337 Ga0075433_10276182
338 Ga0075433_10458647
339 Ga0075433_11084146
340 Ga0075434_100202094
341 Ga0075434_100207333
342 Ga0075434_100516790
343 Ga0075434_100767138
344 Ga0075429_100000757
345 Ga0075429_100001793
346 Ga0075429_100041111
347 Ga0075429_100052416
348 Ga0075429_100134597
349 Ga0075429_101014358
350 Ga0068865_101126247
351 Ga0075436_101175994
352 Ga0097620_100390589
353 Ga0075435_100048246
354 Ga0075435_100105651
355 Ga0099794_10214470
356 Ga0111539_10008974
357 Ga0111539_10467869
358 Ga0111539_10682951
359 Ga0114129_10000599
360 Ga0114129_10008029
361 Ga0114129_10016080
362 Ga0114129_10023637
363 Ga0114129_10143572
364 Ga0114129_10396443
365 Ga0114129_11175978
366 Ga0105243_10110773
367 Ga0105241_10696604
368 Ga0105242_10516166
369 Ga0105242_11812099
370 Ga0105248_10506511
371 Ga0105238_10483774
372 Ga0105249_10503163
373 Ga0105249_12580633
374 Ga0105239_10017723
375 Ga0157336_1026068
376 Ga0157326_1000860
377 Ga0157373_11216785
378 Ga0163162_10024603
379 Ga0163162_11183559
380 Ga0163162_11567560
381 Ga0163163_10514698
382 Ga0157380_10349870
383 Ga0157380_10492107
384 Ga0157379_10364124
385 Ga0209025_1022799
386 Ga0209050_1020926
387 Ga0207653_10124052
388 Ga0207645_10530408
389 Ga0207684_10001904
390 Ga0207684_10135551
391 Ga0207684_10262446
392 Ga0207684_10276684
393 Ga0207684_10899446
394 Ga0207684_11001132
395 Ga0207654_10057379
396 Ga0207695_10649997
397 Ga0207646_10012923
398 Ga0207646_10014058
399 Ga0207646_10050628
400 Ga0207646_10394450
401 Ga0207650_10564430
402 Ga0207664_10265617
403 Ga0207644_11340782
404 Ga0207706_10395170
405 Ga0207686_11199261
406 Ga0207709_10048469
407 Ga0207704_11034315
408 Ga0207691_10488487
409 Ga0207711_10057183
410 Ga0207668_10014274
411 Ga0207678_10360307
412 Ga0207641_11074540
413 Ga0207648_10186817
414 Ga0207428_10569877
415 Ga0268265_10063145
416 Ga0268264_10182514
417 Ga0268264_10246962
418 Ga0268264_10378603
419 Ga0307509_10111119
420 Ga0307408_100966158
421 Ga0307413_10349760
422 Ga0307411_11159632
423 Ga0307507_10021339
424 Ga0373948_0105007
425 Ga0373932_0008913
426 Ga0395899_0066393
427 Ga0395899_0847390
428 Ga0395900_0008206
429 Ga0395900_0036424
430 Ga0395898_0019793
431 Ga0395901_0000399
432 Ga0451791_1516970
433 Ga0451849_0051892
434 Ga0451577_0337673
435 Ga0451577_0971087
436 Ga0466982_0013349
437 Ga0466965_0597390
438 Ga0453684_0007524
439 Ga0453684_0420903
440 Ga0451576_0095992
441 Ga0451576_0880816
442 Ga0451576_1150311
443 Ga0451576_2328193
444 Ga0451576_2449453
445 Ga0495580_0000331
446 Ga0495580_0238311
447 Ga0495659_0012817
448 Ga0495659_0030740
449 Ga0495669_0058942
450 Ga0496106_0499435
451 Ga0496108_0376395
452 Ga0501031_0702605
453 Ga0501032_0634001
454 Ga0501034_0048662
455 Ga0501034_0107076
456 Ga0501036_0088860
457 Ga0501048_0090603
458 Ga0501068_1200642
459 Ga0501074_0136855
460 Ga0501075_0845963
461 Ga0501076_0196287
462 Ga0501079_0090380
463 Ga0501079_0535994
464 Ga0501079_0646313
465 Ga0501080_1036287
466 Ga0501081_0127946
467 Ga0501035_0220624
468 Ga0501035_0309599
469 Ga0501044_0436031
470 Ga0501044_1177983
471 nmdc:mga05p37_118323_c1
472 nmdc:mga05p37_137934_c1
473 nmdc:mga05p37_1462081_c1
474 nmdc:mga05p37_241682_c1
475 nmdc:mga05p37_29985_c1
476 nmdc:mga05p37_60003_c1
477 nmdc:mga05p37_699290_c1
478 nmdc:mga05p37_7885_c1
479 nmdc:mga09592_1012_c1
480 nmdc:mga09592_1181210_c1
481 nmdc:mga09592_205769_c1
482 nmdc:mga09592_25101_c1
483 nmdc:mga09592_494567_c1
484 nmdc:mga09592_71817_c1
485 nmdc:mga0qj67_108228_c1
486 nmdc:mga0qj67_1576599_c1
487 nmdc:mga06r32_1549_c1
488 nmdc:mga06r32_70273_c1
489 nmdc:mga06r32_708967_c1
490 nmdc:mga08y16_29427_c1
491 nmdc:mga08y16_373031_c1
492 nmdc:mga0n895_195086_c1
493 nmdc:mga0n895_38036_c1
494 nmdc:mga0n895_800728_c1
495 nmdc:mga0rr50_23701_c1
496 nmdc:mga0a205_34506_c1
497 nmdc:mga0a205_895_c1
498 nmdc:mga0a205_92450_c1
499 Ga0495619_0568211
500 Ga0500644_0097797
501 Ga0500555_106372
502 Ga0500608_000979
503 Ga0500616_0025921
504 Ga0500616_0028220
505 Ga0500622_0014266
506 Ga0501084_0064483
507 Ga0530510_0312472
508 2595319064

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01588

tRNA_bind

Putative tRNA binding domain

25

121

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q2i-assembly1.cif.gz_A crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. 0.9843 11 119
2q2i-assembly1.cif.gz_B crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. 0.9779 11 119
1gd7-assembly1.cif.gz_B crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities. 0.9764 11 119
2q2h-assembly1.cif.gz_B crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens with a genetically fused phage-display derived peptide substrate at the n-terminus. 0.9718 11 119
2nzo-assembly2.cif.gz_D crystal structure of a secretion chaperone csaa from bacillus subtilis in the space group p 32 2 1 0.9715 11 119
ID Description Score Start End Superfamily
2q2iB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9779 11 119 2.40.50.140
af_Q54B13_2_117_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9754 9 119 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9748 11 119 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9661 11 119 2.40.50.140
2q2iB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9515 11 119 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A538R6C9-F1-model_v4 tRNA-binding protein 1.001 23 119 GO:0000049
AF-A0A4R1BNJ5-F1-model_v4 tRNA-binding protein 0.9986 11 119 GO:0000049
AF-A0A356R983-F1-model_v4 tRNA-binding protein 0.998 20 118 GO:0000049
AF-A0A356U280-F1-model_v4 tRNA-binding protein 0.9979 25 119 GO:0000049
AF-A0A0C1L863-F1-model_v4 tRNA-binding protein 0.9978 11 119 GO:0000049

Map