F364354

General Info

Members Datasets Scaffolds Average Seq Length
253 191 253 90

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0073983|Ga0495672_0073983_1118_1429
Length 103
Sequence MNRRYRRVTAMECTHLDSVHVLVLPDEVEGCEECLATGMRWVHLRMCQTCGHIGCCDNSIGKHATAHHQATGHPIIRSAEPGEDWSWCYPDELMFRLEDGDTA

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
97 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
102 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
127 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
128 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
129 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
187 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
191 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.95
Nodule 0
Rhizoplane 7.91
Rhizosphere 85.77
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1006238 3300000546 Bacteria 1293
2 JGI25159J45721_1000211 3300002987 Bacteria 27426
3 JGI25160J50197_1000418 3300003354 Bacteria 26966
4 JGI25161J50226_1000265 3300003374 Bacteria 30827
5 Ga0055543_1000356 3300004625 Bacteria 30865
6 Ga0065165_1001587 3300005262 Bacteria 23359
7 Ga0070658_10780624 3300005327 Bacteria 830
8 Ga0070683_100095868 3300005329 Bacteria 2790
9 Ga0068868_100007828 3300005338 Bacteria 7627
10 Ga0070660_100765532 3300005339 Bacteria 811
11 Ga0070689_100153157 3300005340 Bacteria 1860
12 Ga0070691_10000004 3300005341 Bacteria 80156
13 Ga0070691_10129182 3300005341 Bacteria 1279
14 Ga0070692_10009302 3300005345 Bacteria 4428
15 Ga0070692_10046838 3300005345 Bacteria 2236
16 Ga0070669_100174792 3300005353 Bacteria 1676
17 Ga0070675_100000050 3300005354 Bacteria 72016
18 Ga0070674_100061966 3300005356 Bacteria 2612
19 Ga0070673_100360981 3300005364 Bacteria 1291
20 Ga0070688_100000010 3300005365 Bacteria 84103
21 Ga0070688_100076412 3300005365 Bacteria 2155
22 Ga0070659_100003678 3300005366 Bacteria 10933
23 Ga0070667_100582783 3300005367 Bacteria 1030
24 Ga0070713_100119207 3300005436 Bacteria 2312
25 Ga0070711_100226482 3300005439 Bacteria 1456
26 Ga0070708_100000355 3300005445 Bacteria 34767
27 Ga0070678_100257420 3300005456 Bacteria 1466
28 Ga0070662_100009977 3300005457 Bacteria 6219
29 Ga0068867_100041277 3300005459 Bacteria 3371
30 Ga0068867_100584559 3300005459 Bacteria 972
31 Ga0070685_10000010 3300005466 Bacteria 146946
32 Ga0070685_10151067 3300005466 Bacteria 1472
33 Ga0070707_100001422 3300005468 Bacteria 23458
34 Ga0070699_100229613 3300005518 Unclassified 1655
35 Ga0070684_100048700 3300005535 Bacteria 3676
36 Ga0070684_100770237 3300005535 Bacteria 899
37 Ga0070672_100000031 3300005543 Bacteria 62241
38 Ga0070686_100048395 3300005544 Bacteria 2693
39 Ga0070665_100753114 3300005548 Bacteria 987
40 Ga0070665_100819829 3300005548 Bacteria 943
41 Ga0068854_100016877 3300005578 Bacteria 4876
42 Ga0068866_10004817 3300005718 Bacteria 5540
43 Ga0068866_10021172 3300005718 Bacteria 2992
44 Ga0068861_100202018 3300005719 Bacteria 1669
45 Ga0068861_101020441 3300005719 Bacteria 791
46 Ga0068870_10044920 3300005840 Bacteria 2310
47 Ga0068863_100008832 3300005841 Bacteria 9842
48 Ga0081455_10000575 3300005937 Bacteria 47885
49 Ga0075430_100026320 3300006846 Bacteria 4950
50 Ga0068865_100007642 3300006881 Bacteria 6657
51 Ga0068865_100054085 3300006881 Bacteria 2788
52 Ga0068865_100916251 3300006881 Bacteria 763
53 Ga0105245_10006841 3300009098 Bacteria 10002
54 Ga0105247_10162441 3300009101 Bacteria 1480
55 Ga0105243_10010381 3300009148 Bacteria 7071
56 Ga0105242_10000063 3300009176 Bacteria 74721
57 Ga0105242_10100717 3300009176 Bacteria 2447
58 Ga0105248_10000037 3300009177 Bacteria 180751
59 Ga0105248_10192317 3300009177 Bacteria 2299
60 Ga0105238_12907659 3300009551 Bacteria 515
61 Ga0105249_12314222 3300009553 Bacteria 610
62 Ga0105239_10210502 3300010375 Bacteria 2179
63 Ga0105239_13199685 3300010375 Bacteria 533
64 Ga0157371_10040382 3300013102 Bacteria 3333
65 Ga0157370_10356119 3300013104 Bacteria 1349
66 Ga0157374_11093033 3300013296 Bacteria 818
67 Ga0157378_10008596 3300013297 Bacteria 8884
68 Ga0157378_10023605 3300013297 Bacteria 5409
69 Ga0163162_10404613 3300013306 Bacteria 1497
70 Ga0157372_10000146 3300013307 Bacteria 77952
71 Ga0157375_10030090 3300013308 Bacteria 5115
72 Ga0157375_10993158 3300013308 Bacteria 979
73 Ga0157380_10396816 3300014326 Bacteria 1307
74 Ga0157376_11812392 3300014969 Bacteria 646
75 Ga0163161_10088739 3300017792 Bacteria 2286
76 Ga0224712_10022571 3300022467 Bacteria 2171
77 Ga0209436_123662 3300025208 Bacteria 766
78 Ga0209130_1000048 3300025284 Bacteria 233357
79 Ga0207426_1000075 3300025302 Bacteria 321337
80 Ga0207642_10003444 3300025899 Bacteria 4997
81 Ga0207642_10149265 3300025899 Unclassified 1242
82 Ga0207705_10533741 3300025909 Bacteria 912
83 Ga0207654_11079856 3300025911 Unclassified 584
84 Ga0207663_10433224 3300025916 Bacteria 1011
85 Ga0207662_10006451 3300025918 Bacteria 6333
86 Ga0207649_10000003 3300025920 Bacteria 388908
87 Ga0207646_10001932 3300025922 Bacteria 24884
88 Ga0207681_10009296 3300025923 Bacteria 6003
89 Ga0207659_10000055 3300025926 Bacteria 74252
90 Ga0207687_10006279 3300025927 Bacteria 7862
91 Ga0207687_10013237 3300025927 Bacteria 5386
92 Ga0207700_10328358 3300025928 Bacteria 1327
93 Ga0207690_10002537 3300025932 Bacteria 11031
94 Ga0207706_10001190 3300025933 Bacteria 26240
95 Ga0207686_10000124 3300025934 Bacteria 62335
96 Ga0207709_10017116 3300025935 Bacteria 4040
97 Ga0207670_10106106 3300025936 Bacteria 2015
98 Ga0207669_10152843 3300025937 Bacteria 1619
99 Ga0207704_10000104 3300025938 Bacteria 46614
100 Ga0207704_10782971 3300025938 Bacteria 795
101 Ga0207691_10000178 3300025940 Bacteria 60110
102 Ga0207711_10000011 3300025941 Bacteria 518817
103 Ga0207661_10028812 3300025944 Bacteria 4257
104 Ga0207661_10082507 3300025944 Bacteria 2658
105 Ga0207679_10241163 3300025945 Bacteria 1532
106 Ga0207668_10519511 3300025972 Bacteria 1027
107 Ga0207640_10166718 3300025981 Bacteria 1636
108 Ga0207658_10094669 3300025986 Bacteria 2325
109 Ga0207658_10509629 3300025986 Bacteria 1073
110 Ga0207677_10157657 3300026023 Bacteria 1760
111 Ga0207708_10039547 3300026075 Bacteria 3594
112 Ga0207641_10006453 3300026088 Bacteria 9884
113 Ga0207648_10022395 3300026089 Bacteria 5674
114 Ga0207648_10097253 3300026089 Bacteria 2576
115 Ga0207675_100184736 3300026118 Bacteria 1998
116 Ga0207683_10083558 3300026121 Bacteria 2838
117 Ga0268266_10495219 3300028379 Bacteria 1166
118 Ga0265337_1001256 3300028556 Bacteria 12773
119 Ga0265337_1159001 3300028556 Bacteria 612
120 Ga0265326_10000127 3300028558 Bacteria 39017
121 Ga0265326_10022712 3300028558 Bacteria 1796
122 Ga0265319_1000010 3300028563 Bacteria 188773
123 Ga0265319_1009263 3300028563 Bacteria 4214
124 Ga0265334_10021700 3300028573 Bacteria 2621
125 Ga0265334_10319318 3300028573 Bacteria 531
126 Ga0265318_10004682 3300028577 Bacteria 6570
127 Ga0265318_10153466 3300028577 Bacteria 844
128 Ga0265322_10000005 3300028654 Bacteria 246112
129 Ga0265322_10006271 3300028654 Bacteria 3499
130 Ga0265336_10087556 3300028666 Bacteria 928
131 Ga0265338_10000287 3300028800 Bacteria 90818
132 Ga0265338_10159944 3300028800 Bacteria 1740
133 Ga0265338_10508222 3300028800 Bacteria 847
134 Ga0265324_10000264 3300029957 Bacteria 39067
135 Ga0265324_10052760 3300029957 Bacteria 1397
136 Ga0265324_10060204 3300029957 Bacteria 1298
137 Ga0265330_10112902 3300031235 Bacteria 1159
138 Ga0265332_10081570 3300031238 Bacteria 1371
139 Ga0265332_10300559 3300031238 Bacteria 663
140 Ga0265328_10005664 3300031239 Bacteria 5337
141 Ga0265320_10000010 3300031240 Bacteria 250501
142 Ga0265320_10277916 3300031240 Bacteria 741
143 Ga0265325_10020453 3300031241 Bacteria 3647
144 Ga0265325_10051053 3300031241 Bacteria 2127
145 Ga0265329_10001050 3300031242 Bacteria 13701
146 Ga0265329_10088616 3300031242 Bacteria 981
147 Ga0265340_10009216 3300031247 Bacteria 5302
148 Ga0265339_10028796 3300031249 Bacteria 3156
149 Ga0265339_10079078 3300031249 Bacteria 1740
150 Ga0265339_10255085 3300031249 Bacteria 847
151 Ga0265331_10000217 3300031250 Bacteria 69142
152 Ga0265331_10135725 3300031250 Bacteria 1120
153 Ga0265331_10174540 3300031250 Bacteria 971
154 Ga0265327_10000040 3300031251 Bacteria 291052
155 Ga0265327_10040580 3300031251 Bacteria 2515
156 Ga0265316_10003729 3300031344 Bacteria 15319
157 Ga0265313_10022748 3300031595 Bacteria 3392
158 Ga0265313_10071947 3300031595 Bacteria 1590
159 Ga0265314_10000491 3300031711 Bacteria 51373
160 Ga0265314_10077552 3300031711 Bacteria 2203
161 Ga0265314_10129876 3300031711 Bacteria 1573
162 Ga0265342_10245738 3300031712 Bacteria 956
163 Ga0316584_0780072 3300036712 Bacteria 650
164 Ga0395899_0088976 3300037312 Bacteria 2240
165 Ga0395900_0062167 3300037418 Bacteria 3838
166 Ga0395898_0032384 3300037466 Bacteria 5218
167 Ga0395901_0038794 3300038443 Bacteria 4927
168 Ga0451804_0057938 3300041463 Bacteria 650
169 Ga0451807_2713979 3300041486 Bacteria 1307
170 Ga0451835_0327608 3300041492 Bacteria 626
171 Ga0451837_0718245 3300041494 Unclassified 535
172 Ga0451839_1388815 3300041496 Bacteria 1096
173 Ga0451849_0423017 3300041505 Bacteria 1664
174 Ga0451853_1171343 3300041512 Bacteria 1589
175 Ga0466963_0126438 3300044694 Bacteria 1762
176 Ga0466957_0240880 3300044842 Bacteria 1200
177 Ga0466960_0177436 3300044901 Bacteria 1153
178 Ga0466958_0413531 3300045836 Bacteria 871
179 Ga0466967_0512658 3300045976 Bacteria 1178
180 Ga0495590_0077752 3300046457 Bacteria 1168
181 Ga0495629_0051041 3300046459 Bacteria 2895
182 Ga0495641_0016090 3300046461 Bacteria 3953
183 Ga0495664_0902815 3300046477 Bacteria 517
184 Ga0495606_0000017 3300046507 Bacteria 284549
185 Ga0495608_0000013 3300046511 Bacteria 228481
186 Ga0495610_0027064 3300046512 Bacteria 3054
187 Ga0495630_0000032 3300046517 Bacteria 134425
188 Ga0495587_0000272 3300046536 Bacteria 36939
189 Ga0495587_0107045 3300046536 Bacteria 1608
190 Ga0495587_0588783 3300046536 Unclassified 613
191 Ga0495645_0289655 3300046543 Bacteria 1074
192 Ga0495645_0338399 3300046543 Bacteria 972
193 Ga0495667_0000038 3300046559 Bacteria 131349
194 Ga0495588_0000073 3300046674 Bacteria 219005
195 Ga0495657_0000003 3300046675 Bacteria 279680
196 Ga0495657_0260183 3300046675 Bacteria 1043
197 Ga0495599_0332610 3300046678 Bacteria 913
198 Ga0495647_0001114 3300046681 Bacteria 8208
199 Ga0495613_0000027 3300046689 Bacteria 146674
200 Ga0495624_0000691 3300046690 Bacteria 26457
201 Ga0495600_0032852 3300046809 Bacteria 3367
202 Ga0495604_0000723 3300047317 Bacteria 27948
203 Ga0495604_0032236 3300047317 Bacteria 4155
204 Ga0495672_0073983 3300047320 Bacteria 1920
205 Ga0495676_0007903 3300047321 Bacteria 9752
206 Ga0495676_0028720 3300047321 Bacteria 4746
207 Ga0495680_0001001 3300047322 Bacteria 31451
208 Ga0495680_0137650 3300047322 Bacteria 1789
209 Ga0495675_0000002 3300047444 Bacteria 216469
210 Ga0495673_0127882 3300047469 Bacteria 1001
211 Ga0495686_0599585 3300047472 Bacteria 570
212 Ga0495593_0130474 3300047673 Bacteria 1276
213 Ga0495602_0000034 3300048088 Bacteria 140722
214 Ga0495602_0303169 3300048088 Bacteria 1168
215 Ga0496100_0000001 3300048903 Bacteria 530179
216 Ga0496101_0000028 3300048904 Bacteria 198664
217 Ga0496102_0000749 3300048905 Bacteria 31723
218 Ga0496103_0000481 3300048906 Bacteria 33518
219 Ga0496104_0113142 3300048907 Bacteria 2603
220 Ga0496106_0000218 3300048909 Bacteria 40075
221 Ga0496107_0000002 3300048910 Bacteria 320871
222 Ga0496108_0000005 3300048911 Bacteria 535059
223 Ga0496108_0086767 3300048911 Bacteria 2657
224 Ga0496109_0000002 3300048912 Bacteria 443393
225 Ga0496109_0000221 3300048912 Bacteria 56054
226 Ga0496111_0000121 3300048914 Bacteria 33902
227 Ga0496112_0012664 3300048915 Bacteria 7755
228 Ga0496113_0000005 3300048916 Bacteria 105956
229 Ga0496114_0000003 3300048917 Bacteria 630981
230 Ga0496114_1282550 3300048917 Unclassified 619
231 Ga0496115_0000016 3300048918 Bacteria 187067
232 Ga0496115_0001530 3300048918 Bacteria 16611
233 Ga0496124_0251952 3300048927 Bacteria 1305
234 Ga0501046_0444956 3300049580 Bacteria 932
235 Ga0501047_0331979 3300049581 Bacteria 1359
236 Ga0501069_0200318 3300049585 Bacteria 1157
237 Ga0501069_0722399 3300049585 Bacteria 601
238 Ga0501070_0329853 3300049586 Bacteria 1240
239 Ga0501070_0420473 3300049586 Bacteria 1079
240 Ga0501074_0098180 3300049590 Bacteria 2096
241 Ga0501080_0084566 3300049742 Bacteria 2948
242 Ga0501080_0436171 3300049742 Bacteria 1176
243 Ga0501035_1189188 3300049822 Bacteria 592
244 Ga0495601_0000017 3300053077 Bacteria 204209
245 Ga0495601_0400610 3300053077 Bacteria 890
246 Ga0495612_0003068 3300053078 Bacteria 6928
247 Ga0495655_0000005 3300053083 Bacteria 257472
248 Ga0495655_0064095 3300053083 Bacteria 1011
249 Ga0495595_0000007 3300053084 Bacteria 228504
250 Ga0495595_0036298 3300053084 Bacteria 2236
251 Ga0495619_0000026 3300053085 Bacteria 167387
252 Ga0500566_0001830 3300053094 Bacteria 12505
253 Ga0500628_000013 3300053129 Bacteria 106419

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028577 Ga0265318_10153466 Ga0265318_101534662 75
2 3300028654 Ga0265322_10006271 Ga0265322_100062713 75
3 3300028800 Ga0265338_10159944 Ga0265338_101599443 75
4 3300031249 Ga0265339_10079078 Ga0265339_100790783 75
5 3300031595 Ga0265313_10071947 Ga0265313_100719471 75
6 3300031711 Ga0265314_10077552 Ga0265314_100775523 75
7 3300028573 Ga0265334_10319318 Ga0265334_103193182 76
8 3300028556 Ga0265337_1159001 Ga0265337_11590012 79
9 3300028558 Ga0265326_10022712 Ga0265326_100227121 79
10 3300028563 Ga0265319_1009263 Ga0265319_10092632 79
11 3300028573 Ga0265334_10021700 Ga0265334_100217004 79
12 3300028577 Ga0265318_10004682 Ga0265318_100046827 79
13 3300028800 Ga0265338_10508222 Ga0265338_105082222 79
14 3300029957 Ga0265324_10060204 Ga0265324_100602042 79
15 3300031235 Ga0265330_10112902 Ga0265330_101129022 79
16 3300031238 Ga0265332_10081570 Ga0265332_100815702 79
17 3300031239 Ga0265328_10005664 Ga0265328_100056646 79
18 3300031240 Ga0265320_10277916 Ga0265320_102779162 79
19 3300031241 Ga0265325_10020453 Ga0265325_100204532 79
20 3300031242 Ga0265329_10088616 Ga0265329_100886162 79
21 3300031247 Ga0265340_10009216 Ga0265340_100092166 79
22 3300031249 Ga0265339_10255085 Ga0265339_102550852 79
23 3300031250 Ga0265331_10174540 Ga0265331_101745402 79
24 3300031251 Ga0265327_10040580 Ga0265327_100405803 79
25 3300031344 Ga0265316_10003729 Ga0265316_100037299 79
26 3300031595 Ga0265313_10022748 Ga0265313_100227484 79
27 3300031711 Ga0265314_10129876 Ga0265314_101298762 79
28 3300031712 Ga0265342_10245738 Ga0265342_102457382 79
29 3300002987 JGI25159J45721_1000211 JGI25159J45721_100021115 82
30 3300003354 JGI25160J50197_1000418 JGI25160J50197_100041815 82
31 3300014326 Ga0157380_10396816 Ga0157380_103968162 82
32 3300005937 Ga0081455_10000575 Ga0081455_100005755 85
33 3300036712 Ga0316584_0780072 Ga0316584_0780072_119_427 85
34 3300044901 Ga0466960_0177436 Ga0466960_0177436_96_353 85
35 3300005338 Ga0068868_100007828 Ga0068868_1000078287 86
36 3300005345 Ga0070692_10009302 Ga0070692_100093023 86
37 3300005353 Ga0070669_100174792 Ga0070669_1001747923 86
38 3300005356 Ga0070674_100061966 Ga0070674_1000619663 86
39 3300005364 Ga0070673_100360981 Ga0070673_1003609812 86
40 3300005367 Ga0070667_100582783 Ga0070667_1005827832 86
41 3300005457 Ga0070662_100009977 Ga0070662_1000099775 86
42 3300005459 Ga0068867_100041277 Ga0068867_1000412773 86
43 3300005459 Ga0068867_100584559 Ga0068867_1005845592 86
44 3300005544 Ga0070686_100048395 Ga0070686_1000483954 86
45 3300005578 Ga0068854_100016877 Ga0068854_1000168774 86
46 3300005718 Ga0068866_10021172 Ga0068866_100211724 86
47 3300005719 Ga0068861_100202018 Ga0068861_1002020182 86
48 3300006881 Ga0068865_100007642 Ga0068865_1000076424 86
49 3300009176 Ga0105242_10100717 Ga0105242_101007172 86
50 3300013297 Ga0157378_10008596 Ga0157378_100085967 86
51 3300025899 Ga0207642_10149265 Ga0207642_101492653 86
52 3300025918 Ga0207662_10006451 Ga0207662_100064513 86
53 3300025923 Ga0207681_10009296 Ga0207681_100092962 86
54 3300025927 Ga0207687_10013237 Ga0207687_100132376 86
55 3300025933 Ga0207706_10001190 Ga0207706_1000119023 86
56 3300025937 Ga0207669_10152843 Ga0207669_101528433 86
57 3300025981 Ga0207640_10166718 Ga0207640_101667183 86
58 3300025986 Ga0207658_10509629 Ga0207658_105096292 86
59 3300026075 Ga0207708_10039547 Ga0207708_100395475 86
60 3300026089 Ga0207648_10022395 Ga0207648_100223956 86
61 3300026089 Ga0207648_10097253 Ga0207648_100972533 86
62 3300026118 Ga0207675_100184736 Ga0207675_1001847364 86
63 3300046457 Ga0495590_0077752 Ga0495590_0077752_514_774 86
64 3300005445 Ga0070708_100000355 Ga0070708_10000035517 87
65 3300005468 Ga0070707_100001422 Ga0070707_10000142221 87
66 3300025922 Ga0207646_10001932 Ga0207646_100019323 87
67 3300005719 Ga0068861_101020441 Ga0068861_1010204411 88
68 3300003374 JGI25161J50226_1000265 JGI25161J50226_100026517 89
69 3300004625 Ga0055543_1000356 Ga0055543_100035617 89
70 3300005262 Ga0065165_1001587 Ga0065165_100158711 89
71 3300025208 Ga0209436_123662 Ga0209436_1236622 89
72 3300025284 Ga0209130_1000048 Ga0209130_1000048212 89
73 3300025302 Ga0207426_1000075 Ga0207426_1000075229 89
74 3300045976 Ga0466967_0512658 Ga0466967_0512658_841_1116 89
75 3300046477 Ga0495664_0902815 Ga0495664_0902815_96_365 89
76 3300046543 Ga0495645_0338399 Ga0495645_0338399_555_824 89
77 3300053077 Ga0495601_0400610 Ga0495601_0400610_16_285 89
78 3300005518 Ga0070699_100229613 Ga0070699_1002296132 90
79 3300006881 Ga0068865_100054085 Ga0068865_1000540854 90
80 3300009177 Ga0105248_10000037 Ga0105248_10000037148 90
81 3300025938 Ga0207704_10000104 Ga0207704_1000010429 90
82 3300025941 Ga0207711_10000011 Ga0207711_10000011395 90
83 3300028556 Ga0265337_1001256 Ga0265337_100125615 90
84 3300028558 Ga0265326_10000127 Ga0265326_100001279 90
85 3300028654 Ga0265322_10000005 Ga0265322_10000005174 90
86 3300029957 Ga0265324_10000264 Ga0265324_1000026446 90
87 3300031240 Ga0265320_10000010 Ga0265320_10000010220 90
88 3300031242 Ga0265329_10001050 Ga0265329_1000105013 90
89 3300031249 Ga0265339_10028796 Ga0265339_100287964 90
90 3300031250 Ga0265331_10000217 Ga0265331_1000021724 90
91 3300031251 Ga0265327_10000040 Ga0265327_1000004086 90
92 3300031711 Ga0265314_10000491 Ga0265314_1000049149 90
93 3300037312 Ga0395899_0088976 Ga0395899_0088976_1356_1640 90
94 3300037418 Ga0395900_0062167 Ga0395900_0062167_2753_3037 90
95 3300037466 Ga0395898_0032384 Ga0395898_0032384_2857_3141 90
96 3300038443 Ga0395901_0038794 Ga0395901_0038794_1508_1792 90
97 3300044694 Ga0466963_0126438 Ga0466963_0126438_819_1091 90
98 3300046536 Ga0495587_0588783 Ga0495587_0588783_66_338 90
99 3300047321 Ga0495676_0007903 Ga0495676_0007903_9363_9635 90
100 3300047469 Ga0495673_0127882 Ga0495673_0127882_329_601 90
101 3300048903 Ga0496100_0000001 Ga0496100_0000001_87391_87663 90
102 3300048904 Ga0496101_0000028 Ga0496101_0000028_87380_87652 90
103 3300048909 Ga0496106_0000218 Ga0496106_0000218_20394_20666 90
104 3300048910 Ga0496107_0000002 Ga0496107_0000002_160825_161097 90
105 3300049585 Ga0501069_0200318 Ga0501069_0200318_61_333 90
106 3300049586 Ga0501070_0329853 Ga0501070_0329853_873_1145 90
107 3300005339 Ga0070660_100765532 Ga0070660_1007655322 91
108 3300005340 Ga0070689_100153157 Ga0070689_1001531572 91
109 3300005341 Ga0070691_10129182 Ga0070691_101291822 91
110 3300005345 Ga0070692_10046838 Ga0070692_100468382 91
111 3300005354 Ga0070675_100000050 Ga0070675_10000005027 91
112 3300005365 Ga0070688_100076412 Ga0070688_1000764122 91
113 3300005366 Ga0070659_100003678 Ga0070659_10000367813 91
114 3300005436 Ga0070713_100119207 Ga0070713_1001192073 91
115 3300005439 Ga0070711_100226482 Ga0070711_1002264822 91
116 3300005466 Ga0070685_10151067 Ga0070685_101510672 91
117 3300005535 Ga0070684_100048700 Ga0070684_1000487004 91
118 3300005548 Ga0070665_100753114 Ga0070665_1007531142 91
119 3300005718 Ga0068866_10004817 Ga0068866_100048176 91
120 3300005841 Ga0068863_100008832 Ga0068863_1000088326 91
121 3300006881 Ga0068865_100916251 Ga0068865_1009162512 91
122 3300009098 Ga0105245_10006841 Ga0105245_100068416 91
123 3300009176 Ga0105242_10000063 Ga0105242_1000006356 91
124 3300009551 Ga0105238_12907659 Ga0105238_129076591 91
125 3300013102 Ga0157371_10040382 Ga0157371_100403823 91
126 3300013104 Ga0157370_10356119 Ga0157370_103561194 91
127 3300013296 Ga0157374_11093033 Ga0157374_110930332 91
128 3300013297 Ga0157378_10023605 Ga0157378_100236053 91
129 3300013306 Ga0163162_10404613 Ga0163162_104046132 91
130 3300013307 Ga0157372_10000146 Ga0157372_1000014619 91
131 3300017792 Ga0163161_10088739 Ga0163161_100887392 91
132 3300022467 Ga0224712_10022571 Ga0224712_100225712 91
133 3300025899 Ga0207642_10003444 Ga0207642_100034443 91
134 3300025916 Ga0207663_10433224 Ga0207663_104332242 91
135 3300025926 Ga0207659_10000055 Ga0207659_1000005528 91
136 3300025927 Ga0207687_10006279 Ga0207687_100062793 91
137 3300025928 Ga0207700_10328358 Ga0207700_103283582 91
138 3300025932 Ga0207690_10002537 Ga0207690_100025372 91
139 3300025934 Ga0207686_10000124 Ga0207686_100001247 91
140 3300025936 Ga0207670_10106106 Ga0207670_101061062 91
141 3300025938 Ga0207704_10782971 Ga0207704_107829712 91
142 3300025944 Ga0207661_10028812 Ga0207661_100288125 91
143 3300025986 Ga0207658_10094669 Ga0207658_100946694 91
144 3300026088 Ga0207641_10006453 Ga0207641_100064537 91
145 3300041463 Ga0451804_0057938 Ga0451804_0057938_119_403 91
146 3300041486 Ga0451807_2713979 Ga0451807_2713979_678_962 91
147 3300041492 Ga0451835_0327608 Ga0451835_0327608_207_491 91
148 3300041496 Ga0451839_1388815 Ga0451839_1388815_321_596 91
149 3300041505 Ga0451849_0423017 Ga0451849_0423017_44_319 91
150 3300041512 Ga0451853_1171343 Ga0451853_1171343_1264_1548 91
151 3300044842 Ga0466957_0240880 Ga0466957_0240880_275_550 91
152 3300045836 Ga0466958_0413531 Ga0466958_0413531_35_310 91
153 3300046459 Ga0495629_0051041 Ga0495629_0051041_1715_1999 91
154 3300046511 Ga0495608_0000013 Ga0495608_0000013_85476_85751 91
155 3300046536 Ga0495587_0107045 Ga0495587_0107045_507_782 91
156 3300046543 Ga0495645_0289655 Ga0495645_0289655_465_740 91
157 3300046559 Ga0495667_0000038 Ga0495667_0000038_50911_51186 91
158 3300046675 Ga0495657_0000003 Ga0495657_0000003_136675_136950 91
159 3300046689 Ga0495613_0000027 Ga0495613_0000027_128733_129008 91
160 3300046809 Ga0495600_0032852 Ga0495600_0032852_1059_1334 91
161 3300047317 Ga0495604_0000723 Ga0495604_0000723_14330_14605 91
162 3300047317 Ga0495604_0032236 Ga0495604_0032236_3074_3349 91
163 3300047321 Ga0495676_0028720 Ga0495676_0028720_4275_4550 91
164 3300047322 Ga0495680_0001001 Ga0495680_0001001_25484_25759 91
165 3300047322 Ga0495680_0137650 Ga0495680_0137650_776_1060 91
166 3300047444 Ga0495675_0000002 Ga0495675_0000002_136675_136950 91
167 3300047472 Ga0495686_0599585 Ga0495686_0599585_234_509 91
168 3300048088 Ga0495602_0000034 Ga0495602_0000034_88353_88628 91
169 3300048088 Ga0495602_0303169 Ga0495602_0303169_370_645 91
170 3300048905 Ga0496102_0000749 Ga0496102_0000749_14202_14486 91
171 3300048906 Ga0496103_0000481 Ga0496103_0000481_26173_26457 91
172 3300048907 Ga0496104_0113142 Ga0496104_0113142_695_970 91
173 3300048911 Ga0496108_0000005 Ga0496108_0000005_425462_425737 91
174 3300048912 Ga0496109_0000002 Ga0496109_0000002_109355_109630 91
175 3300048914 Ga0496111_0000121 Ga0496111_0000121_6402_6677 91
176 3300048915 Ga0496112_0012664 Ga0496112_0012664_3823_4098 91
177 3300048916 Ga0496113_0000005 Ga0496113_0000005_81833_82108 91
178 3300048917 Ga0496114_0000003 Ga0496114_0000003_497596_497871 91
179 3300048917 Ga0496114_1282550 Ga0496114_1282550_306_590 91
180 3300048918 Ga0496115_0001530 Ga0496115_0001530_15368_15643 91
181 3300049580 Ga0501046_0444956 Ga0501046_0444956_100_375 91
182 3300049581 Ga0501047_0331979 Ga0501047_0331979_909_1184 91
183 3300049585 Ga0501069_0722399 Ga0501069_0722399_258_533 91
184 3300049586 Ga0501070_0420473 Ga0501070_0420473_542_826 91
185 3300049590 Ga0501074_0098180 Ga0501074_0098180_484_768 91
186 3300049742 Ga0501080_0084566 Ga0501080_0084566_839_1123 91
187 3300049742 Ga0501080_0436171 Ga0501080_0436171_566_841 91
188 3300049822 Ga0501035_1189188 Ga0501035_1189188_24_299 91
189 3300053077 Ga0495601_0000017 Ga0495601_0000017_17996_18271 91
190 3300053083 Ga0495655_0000005 Ga0495655_0000005_250298_250582 91
191 3300053083 Ga0495655_0064095 Ga0495655_0064095_482_757 91
192 3300053084 Ga0495595_0000007 Ga0495595_0000007_85499_85774 91
193 3300053084 Ga0495595_0036298 Ga0495595_0036298_894_1169 91
194 3300053085 Ga0495619_0000026 Ga0495619_0000026_86790_87065 91
195 3300053094 Ga0500566_0001830 Ga0500566_0001830_6808_7092 91
196 3300053129 Ga0500628_000013 Ga0500628_000013_7066_7350 91
197 3300000546 LJNas_1006238 LJNas_10062382 92
198 3300005327 Ga0070658_10780624 Ga0070658_107806242 92
199 3300005329 Ga0070683_100095868 Ga0070683_1000958681 92
200 3300005341 Ga0070691_10000004 Ga0070691_1000000413 92
201 3300005365 Ga0070688_100000010 Ga0070688_10000001021 92
202 3300005456 Ga0070678_100257420 Ga0070678_1002574202 92
203 3300005466 Ga0070685_10000010 Ga0070685_10000010106 92
204 3300005535 Ga0070684_100770237 Ga0070684_1007702372 92
205 3300005543 Ga0070672_100000031 Ga0070672_10000003149 92
206 3300005548 Ga0070665_100819829 Ga0070665_1008198291 92
207 3300005840 Ga0068870_10044920 Ga0068870_100449202 92
208 3300006846 Ga0075430_100026320 Ga0075430_1000263204 92
209 3300009101 Ga0105247_10162441 Ga0105247_101624412 92
210 3300009148 Ga0105243_10010381 Ga0105243_100103815 92
211 3300009177 Ga0105248_10192317 Ga0105248_101923172 92
212 3300009553 Ga0105249_12314222 Ga0105249_123142222 92
213 3300010375 Ga0105239_10210502 Ga0105239_102105022 92
214 3300010375 Ga0105239_13199685 Ga0105239_131996851 92
215 3300013308 Ga0157375_10030090 Ga0157375_100300905 92
216 3300013308 Ga0157375_10993158 Ga0157375_109931582 92
217 3300014969 Ga0157376_11812392 Ga0157376_118123922 92
218 3300025909 Ga0207705_10533741 Ga0207705_105337412 92
219 3300025911 Ga0207654_11079856 Ga0207654_110798561 92
220 3300025920 Ga0207649_10000003 Ga0207649_1000000335 92
221 3300025935 Ga0207709_10017116 Ga0207709_100171163 92
222 3300025940 Ga0207691_10000178 Ga0207691_1000017837 92
223 3300025944 Ga0207661_10082507 Ga0207661_100825073 92
224 3300025945 Ga0207679_10241163 Ga0207679_102411633 92
225 3300025972 Ga0207668_10519511 Ga0207668_105195112 92
226 3300026023 Ga0207677_10157657 Ga0207677_101576572 92
227 3300026121 Ga0207683_10083558 Ga0207683_100835583 92
228 3300028379 Ga0268266_10495219 Ga0268266_104952192 92
229 3300028563 Ga0265319_1000010 Ga0265319_100001036 92
230 3300028666 Ga0265336_10087556 Ga0265336_100875562 92
231 3300028800 Ga0265338_10000287 Ga0265338_1000028773 92
232 3300029957 Ga0265324_10052760 Ga0265324_100527601 92
233 3300031238 Ga0265332_10300559 Ga0265332_103005592 92
234 3300031241 Ga0265325_10051053 Ga0265325_100510533 92
235 3300031250 Ga0265331_10135725 Ga0265331_101357252 92
236 3300041494 Ga0451837_0718245 Ga0451837_0718245_185_463 92
237 3300046461 Ga0495641_0016090 Ga0495641_0016090_3136_3423 92
238 3300046507 Ga0495606_0000017 Ga0495606_0000017_63821_64108 92
239 3300046512 Ga0495610_0027064 Ga0495610_0027064_2071_2358 92
240 3300046517 Ga0495630_0000032 Ga0495630_0000032_81377_81664 92
241 3300046536 Ga0495587_0000272 Ga0495587_0000272_27398_27691 92
242 3300046674 Ga0495588_0000073 Ga0495588_0000073_165945_166229 92
243 3300046675 Ga0495657_0260183 Ga0495657_0260183_657_935 92
244 3300046678 Ga0495599_0332610 Ga0495599_0332610_470_748 92
245 3300046681 Ga0495647_0001114 Ga0495647_0001114_628_915 92
246 3300046690 Ga0495624_0000691 Ga0495624_0000691_10131_10412 92
247 3300047320 Ga0495672_0073983 Ga0495672_0073983_1118_1429 92
248 3300047673 Ga0495593_0130474 Ga0495593_0130474_509_787 92
249 3300048911 Ga0496108_0086767 Ga0496108_0086767_901_1179 92
250 3300048912 Ga0496109_0000221 Ga0496109_0000221_54294_54572 92
251 3300048918 Ga0496115_0000016 Ga0496115_0000016_40464_40751 92
252 3300048927 Ga0496124_0251952 Ga0496124_0251952_884_1162 92
253 3300053078 Ga0495612_0003068 Ga0495612_0003068_4525_4812 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

31

99

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8635 1 89
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8128 1 89
3phd-assembly1.cif.gz_D crystal structure of human hdac6 in complex with ubiquitin 0.7996 4 88
5g0f-assembly1.cif.gz_A crystal structure of danio rerio hdac6 znf-ubp domain 0.7751 4 86
3phd-assembly1.cif.gz_B crystal structure of human hdac6 in complex with ubiquitin 0.7667 4 86
ID Description Score Start End Superfamily
af_Q4DD96_272_345_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9253 35 86 3.30.40.10
af_A4HRG6_422_490_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9068 35 86 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8672 1 89 3.30.40.10
af_Q55EJ1_913_1015_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8505 21 89 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8495 1 89 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A1H3IX77-F1-model_v4 Ubiquitin-hydrolase Zn-finger-containing protein 0.9957 35 86 GO:0008270
GO:0016787
AF-A0A841NYZ2-F1-model_v4 deleted 0.9865 38 86
AF-A0A7W0S772-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9832 35 91 GO:0008270
AF-A0A829QKN3-F1-model_v4 Zn-finger in ubiquitin-hydrolases and other family protein 0.978 33 86 GO:0008270
GO:0016787
AF-A0A4V2SXT5-F1-model_v4 Ubiquitin-hydrolase Zn-finger-containing protein 0.9758 35 90 GO:0008270
GO:0016787

Feature Viewer

pLDDT pTM Quality
85.22 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map