F364354
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 253 | 191 | 253 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0073983|Ga0495672_0073983_1118_1429 |
| Length | 103 |
| Sequence | MNRRYRRVTAMECTHLDSVHVLVLPDEVEGCEECLATGMRWVHLRMCQTCGHIGCCDNSIGKHATAHHQATGHPIIRSAEPGEDWSWCYPDELMFRLEDGDTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 5 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 97 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 98 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 99 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 101 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 102 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 105 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 106 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 108 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 110 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 112 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 114 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 115 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 120 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 121 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 122 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 123 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 124 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 125 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 126 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 127 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 128 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 129 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 130 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 131 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 132 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 133 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 134 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 135 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 136 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 167 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 168 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 169 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 170 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 173 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 174 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 175 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 176 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 177 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 178 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 191 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.95 |
| Nodule | 0 |
| Rhizoplane | 7.91 |
| Rhizosphere | 85.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1006238 | 3300000546 | Bacteria | 1293 |
| 2 | JGI25159J45721_1000211 | 3300002987 | Bacteria | 27426 |
| 3 | JGI25160J50197_1000418 | 3300003354 | Bacteria | 26966 |
| 4 | JGI25161J50226_1000265 | 3300003374 | Bacteria | 30827 |
| 5 | Ga0055543_1000356 | 3300004625 | Bacteria | 30865 |
| 6 | Ga0065165_1001587 | 3300005262 | Bacteria | 23359 |
| 7 | Ga0070658_10780624 | 3300005327 | Bacteria | 830 |
| 8 | Ga0070683_100095868 | 3300005329 | Bacteria | 2790 |
| 9 | Ga0068868_100007828 | 3300005338 | Bacteria | 7627 |
| 10 | Ga0070660_100765532 | 3300005339 | Bacteria | 811 |
| 11 | Ga0070689_100153157 | 3300005340 | Bacteria | 1860 |
| 12 | Ga0070691_10000004 | 3300005341 | Bacteria | 80156 |
| 13 | Ga0070691_10129182 | 3300005341 | Bacteria | 1279 |
| 14 | Ga0070692_10009302 | 3300005345 | Bacteria | 4428 |
| 15 | Ga0070692_10046838 | 3300005345 | Bacteria | 2236 |
| 16 | Ga0070669_100174792 | 3300005353 | Bacteria | 1676 |
| 17 | Ga0070675_100000050 | 3300005354 | Bacteria | 72016 |
| 18 | Ga0070674_100061966 | 3300005356 | Bacteria | 2612 |
| 19 | Ga0070673_100360981 | 3300005364 | Bacteria | 1291 |
| 20 | Ga0070688_100000010 | 3300005365 | Bacteria | 84103 |
| 21 | Ga0070688_100076412 | 3300005365 | Bacteria | 2155 |
| 22 | Ga0070659_100003678 | 3300005366 | Bacteria | 10933 |
| 23 | Ga0070667_100582783 | 3300005367 | Bacteria | 1030 |
| 24 | Ga0070713_100119207 | 3300005436 | Bacteria | 2312 |
| 25 | Ga0070711_100226482 | 3300005439 | Bacteria | 1456 |
| 26 | Ga0070708_100000355 | 3300005445 | Bacteria | 34767 |
| 27 | Ga0070678_100257420 | 3300005456 | Bacteria | 1466 |
| 28 | Ga0070662_100009977 | 3300005457 | Bacteria | 6219 |
| 29 | Ga0068867_100041277 | 3300005459 | Bacteria | 3371 |
| 30 | Ga0068867_100584559 | 3300005459 | Bacteria | 972 |
| 31 | Ga0070685_10000010 | 3300005466 | Bacteria | 146946 |
| 32 | Ga0070685_10151067 | 3300005466 | Bacteria | 1472 |
| 33 | Ga0070707_100001422 | 3300005468 | Bacteria | 23458 |
| 34 | Ga0070699_100229613 | 3300005518 | Unclassified | 1655 |
| 35 | Ga0070684_100048700 | 3300005535 | Bacteria | 3676 |
| 36 | Ga0070684_100770237 | 3300005535 | Bacteria | 899 |
| 37 | Ga0070672_100000031 | 3300005543 | Bacteria | 62241 |
| 38 | Ga0070686_100048395 | 3300005544 | Bacteria | 2693 |
| 39 | Ga0070665_100753114 | 3300005548 | Bacteria | 987 |
| 40 | Ga0070665_100819829 | 3300005548 | Bacteria | 943 |
| 41 | Ga0068854_100016877 | 3300005578 | Bacteria | 4876 |
| 42 | Ga0068866_10004817 | 3300005718 | Bacteria | 5540 |
| 43 | Ga0068866_10021172 | 3300005718 | Bacteria | 2992 |
| 44 | Ga0068861_100202018 | 3300005719 | Bacteria | 1669 |
| 45 | Ga0068861_101020441 | 3300005719 | Bacteria | 791 |
| 46 | Ga0068870_10044920 | 3300005840 | Bacteria | 2310 |
| 47 | Ga0068863_100008832 | 3300005841 | Bacteria | 9842 |
| 48 | Ga0081455_10000575 | 3300005937 | Bacteria | 47885 |
| 49 | Ga0075430_100026320 | 3300006846 | Bacteria | 4950 |
| 50 | Ga0068865_100007642 | 3300006881 | Bacteria | 6657 |
| 51 | Ga0068865_100054085 | 3300006881 | Bacteria | 2788 |
| 52 | Ga0068865_100916251 | 3300006881 | Bacteria | 763 |
| 53 | Ga0105245_10006841 | 3300009098 | Bacteria | 10002 |
| 54 | Ga0105247_10162441 | 3300009101 | Bacteria | 1480 |
| 55 | Ga0105243_10010381 | 3300009148 | Bacteria | 7071 |
| 56 | Ga0105242_10000063 | 3300009176 | Bacteria | 74721 |
| 57 | Ga0105242_10100717 | 3300009176 | Bacteria | 2447 |
| 58 | Ga0105248_10000037 | 3300009177 | Bacteria | 180751 |
| 59 | Ga0105248_10192317 | 3300009177 | Bacteria | 2299 |
| 60 | Ga0105238_12907659 | 3300009551 | Bacteria | 515 |
| 61 | Ga0105249_12314222 | 3300009553 | Bacteria | 610 |
| 62 | Ga0105239_10210502 | 3300010375 | Bacteria | 2179 |
| 63 | Ga0105239_13199685 | 3300010375 | Bacteria | 533 |
| 64 | Ga0157371_10040382 | 3300013102 | Bacteria | 3333 |
| 65 | Ga0157370_10356119 | 3300013104 | Bacteria | 1349 |
| 66 | Ga0157374_11093033 | 3300013296 | Bacteria | 818 |
| 67 | Ga0157378_10008596 | 3300013297 | Bacteria | 8884 |
| 68 | Ga0157378_10023605 | 3300013297 | Bacteria | 5409 |
| 69 | Ga0163162_10404613 | 3300013306 | Bacteria | 1497 |
| 70 | Ga0157372_10000146 | 3300013307 | Bacteria | 77952 |
| 71 | Ga0157375_10030090 | 3300013308 | Bacteria | 5115 |
| 72 | Ga0157375_10993158 | 3300013308 | Bacteria | 979 |
| 73 | Ga0157380_10396816 | 3300014326 | Bacteria | 1307 |
| 74 | Ga0157376_11812392 | 3300014969 | Bacteria | 646 |
| 75 | Ga0163161_10088739 | 3300017792 | Bacteria | 2286 |
| 76 | Ga0224712_10022571 | 3300022467 | Bacteria | 2171 |
| 77 | Ga0209436_123662 | 3300025208 | Bacteria | 766 |
| 78 | Ga0209130_1000048 | 3300025284 | Bacteria | 233357 |
| 79 | Ga0207426_1000075 | 3300025302 | Bacteria | 321337 |
| 80 | Ga0207642_10003444 | 3300025899 | Bacteria | 4997 |
| 81 | Ga0207642_10149265 | 3300025899 | Unclassified | 1242 |
| 82 | Ga0207705_10533741 | 3300025909 | Bacteria | 912 |
| 83 | Ga0207654_11079856 | 3300025911 | Unclassified | 584 |
| 84 | Ga0207663_10433224 | 3300025916 | Bacteria | 1011 |
| 85 | Ga0207662_10006451 | 3300025918 | Bacteria | 6333 |
| 86 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 87 | Ga0207646_10001932 | 3300025922 | Bacteria | 24884 |
| 88 | Ga0207681_10009296 | 3300025923 | Bacteria | 6003 |
| 89 | Ga0207659_10000055 | 3300025926 | Bacteria | 74252 |
| 90 | Ga0207687_10006279 | 3300025927 | Bacteria | 7862 |
| 91 | Ga0207687_10013237 | 3300025927 | Bacteria | 5386 |
| 92 | Ga0207700_10328358 | 3300025928 | Bacteria | 1327 |
| 93 | Ga0207690_10002537 | 3300025932 | Bacteria | 11031 |
| 94 | Ga0207706_10001190 | 3300025933 | Bacteria | 26240 |
| 95 | Ga0207686_10000124 | 3300025934 | Bacteria | 62335 |
| 96 | Ga0207709_10017116 | 3300025935 | Bacteria | 4040 |
| 97 | Ga0207670_10106106 | 3300025936 | Bacteria | 2015 |
| 98 | Ga0207669_10152843 | 3300025937 | Bacteria | 1619 |
| 99 | Ga0207704_10000104 | 3300025938 | Bacteria | 46614 |
| 100 | Ga0207704_10782971 | 3300025938 | Bacteria | 795 |
| 101 | Ga0207691_10000178 | 3300025940 | Bacteria | 60110 |
| 102 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 103 | Ga0207661_10028812 | 3300025944 | Bacteria | 4257 |
| 104 | Ga0207661_10082507 | 3300025944 | Bacteria | 2658 |
| 105 | Ga0207679_10241163 | 3300025945 | Bacteria | 1532 |
| 106 | Ga0207668_10519511 | 3300025972 | Bacteria | 1027 |
| 107 | Ga0207640_10166718 | 3300025981 | Bacteria | 1636 |
| 108 | Ga0207658_10094669 | 3300025986 | Bacteria | 2325 |
| 109 | Ga0207658_10509629 | 3300025986 | Bacteria | 1073 |
| 110 | Ga0207677_10157657 | 3300026023 | Bacteria | 1760 |
| 111 | Ga0207708_10039547 | 3300026075 | Bacteria | 3594 |
| 112 | Ga0207641_10006453 | 3300026088 | Bacteria | 9884 |
| 113 | Ga0207648_10022395 | 3300026089 | Bacteria | 5674 |
| 114 | Ga0207648_10097253 | 3300026089 | Bacteria | 2576 |
| 115 | Ga0207675_100184736 | 3300026118 | Bacteria | 1998 |
| 116 | Ga0207683_10083558 | 3300026121 | Bacteria | 2838 |
| 117 | Ga0268266_10495219 | 3300028379 | Bacteria | 1166 |
| 118 | Ga0265337_1001256 | 3300028556 | Bacteria | 12773 |
| 119 | Ga0265337_1159001 | 3300028556 | Bacteria | 612 |
| 120 | Ga0265326_10000127 | 3300028558 | Bacteria | 39017 |
| 121 | Ga0265326_10022712 | 3300028558 | Bacteria | 1796 |
| 122 | Ga0265319_1000010 | 3300028563 | Bacteria | 188773 |
| 123 | Ga0265319_1009263 | 3300028563 | Bacteria | 4214 |
| 124 | Ga0265334_10021700 | 3300028573 | Bacteria | 2621 |
| 125 | Ga0265334_10319318 | 3300028573 | Bacteria | 531 |
| 126 | Ga0265318_10004682 | 3300028577 | Bacteria | 6570 |
| 127 | Ga0265318_10153466 | 3300028577 | Bacteria | 844 |
| 128 | Ga0265322_10000005 | 3300028654 | Bacteria | 246112 |
| 129 | Ga0265322_10006271 | 3300028654 | Bacteria | 3499 |
| 130 | Ga0265336_10087556 | 3300028666 | Bacteria | 928 |
| 131 | Ga0265338_10000287 | 3300028800 | Bacteria | 90818 |
| 132 | Ga0265338_10159944 | 3300028800 | Bacteria | 1740 |
| 133 | Ga0265338_10508222 | 3300028800 | Bacteria | 847 |
| 134 | Ga0265324_10000264 | 3300029957 | Bacteria | 39067 |
| 135 | Ga0265324_10052760 | 3300029957 | Bacteria | 1397 |
| 136 | Ga0265324_10060204 | 3300029957 | Bacteria | 1298 |
| 137 | Ga0265330_10112902 | 3300031235 | Bacteria | 1159 |
| 138 | Ga0265332_10081570 | 3300031238 | Bacteria | 1371 |
| 139 | Ga0265332_10300559 | 3300031238 | Bacteria | 663 |
| 140 | Ga0265328_10005664 | 3300031239 | Bacteria | 5337 |
| 141 | Ga0265320_10000010 | 3300031240 | Bacteria | 250501 |
| 142 | Ga0265320_10277916 | 3300031240 | Bacteria | 741 |
| 143 | Ga0265325_10020453 | 3300031241 | Bacteria | 3647 |
| 144 | Ga0265325_10051053 | 3300031241 | Bacteria | 2127 |
| 145 | Ga0265329_10001050 | 3300031242 | Bacteria | 13701 |
| 146 | Ga0265329_10088616 | 3300031242 | Bacteria | 981 |
| 147 | Ga0265340_10009216 | 3300031247 | Bacteria | 5302 |
| 148 | Ga0265339_10028796 | 3300031249 | Bacteria | 3156 |
| 149 | Ga0265339_10079078 | 3300031249 | Bacteria | 1740 |
| 150 | Ga0265339_10255085 | 3300031249 | Bacteria | 847 |
| 151 | Ga0265331_10000217 | 3300031250 | Bacteria | 69142 |
| 152 | Ga0265331_10135725 | 3300031250 | Bacteria | 1120 |
| 153 | Ga0265331_10174540 | 3300031250 | Bacteria | 971 |
| 154 | Ga0265327_10000040 | 3300031251 | Bacteria | 291052 |
| 155 | Ga0265327_10040580 | 3300031251 | Bacteria | 2515 |
| 156 | Ga0265316_10003729 | 3300031344 | Bacteria | 15319 |
| 157 | Ga0265313_10022748 | 3300031595 | Bacteria | 3392 |
| 158 | Ga0265313_10071947 | 3300031595 | Bacteria | 1590 |
| 159 | Ga0265314_10000491 | 3300031711 | Bacteria | 51373 |
| 160 | Ga0265314_10077552 | 3300031711 | Bacteria | 2203 |
| 161 | Ga0265314_10129876 | 3300031711 | Bacteria | 1573 |
| 162 | Ga0265342_10245738 | 3300031712 | Bacteria | 956 |
| 163 | Ga0316584_0780072 | 3300036712 | Bacteria | 650 |
| 164 | Ga0395899_0088976 | 3300037312 | Bacteria | 2240 |
| 165 | Ga0395900_0062167 | 3300037418 | Bacteria | 3838 |
| 166 | Ga0395898_0032384 | 3300037466 | Bacteria | 5218 |
| 167 | Ga0395901_0038794 | 3300038443 | Bacteria | 4927 |
| 168 | Ga0451804_0057938 | 3300041463 | Bacteria | 650 |
| 169 | Ga0451807_2713979 | 3300041486 | Bacteria | 1307 |
| 170 | Ga0451835_0327608 | 3300041492 | Bacteria | 626 |
| 171 | Ga0451837_0718245 | 3300041494 | Unclassified | 535 |
| 172 | Ga0451839_1388815 | 3300041496 | Bacteria | 1096 |
| 173 | Ga0451849_0423017 | 3300041505 | Bacteria | 1664 |
| 174 | Ga0451853_1171343 | 3300041512 | Bacteria | 1589 |
| 175 | Ga0466963_0126438 | 3300044694 | Bacteria | 1762 |
| 176 | Ga0466957_0240880 | 3300044842 | Bacteria | 1200 |
| 177 | Ga0466960_0177436 | 3300044901 | Bacteria | 1153 |
| 178 | Ga0466958_0413531 | 3300045836 | Bacteria | 871 |
| 179 | Ga0466967_0512658 | 3300045976 | Bacteria | 1178 |
| 180 | Ga0495590_0077752 | 3300046457 | Bacteria | 1168 |
| 181 | Ga0495629_0051041 | 3300046459 | Bacteria | 2895 |
| 182 | Ga0495641_0016090 | 3300046461 | Bacteria | 3953 |
| 183 | Ga0495664_0902815 | 3300046477 | Bacteria | 517 |
| 184 | Ga0495606_0000017 | 3300046507 | Bacteria | 284549 |
| 185 | Ga0495608_0000013 | 3300046511 | Bacteria | 228481 |
| 186 | Ga0495610_0027064 | 3300046512 | Bacteria | 3054 |
| 187 | Ga0495630_0000032 | 3300046517 | Bacteria | 134425 |
| 188 | Ga0495587_0000272 | 3300046536 | Bacteria | 36939 |
| 189 | Ga0495587_0107045 | 3300046536 | Bacteria | 1608 |
| 190 | Ga0495587_0588783 | 3300046536 | Unclassified | 613 |
| 191 | Ga0495645_0289655 | 3300046543 | Bacteria | 1074 |
| 192 | Ga0495645_0338399 | 3300046543 | Bacteria | 972 |
| 193 | Ga0495667_0000038 | 3300046559 | Bacteria | 131349 |
| 194 | Ga0495588_0000073 | 3300046674 | Bacteria | 219005 |
| 195 | Ga0495657_0000003 | 3300046675 | Bacteria | 279680 |
| 196 | Ga0495657_0260183 | 3300046675 | Bacteria | 1043 |
| 197 | Ga0495599_0332610 | 3300046678 | Bacteria | 913 |
| 198 | Ga0495647_0001114 | 3300046681 | Bacteria | 8208 |
| 199 | Ga0495613_0000027 | 3300046689 | Bacteria | 146674 |
| 200 | Ga0495624_0000691 | 3300046690 | Bacteria | 26457 |
| 201 | Ga0495600_0032852 | 3300046809 | Bacteria | 3367 |
| 202 | Ga0495604_0000723 | 3300047317 | Bacteria | 27948 |
| 203 | Ga0495604_0032236 | 3300047317 | Bacteria | 4155 |
| 204 | Ga0495672_0073983 | 3300047320 | Bacteria | 1920 |
| 205 | Ga0495676_0007903 | 3300047321 | Bacteria | 9752 |
| 206 | Ga0495676_0028720 | 3300047321 | Bacteria | 4746 |
| 207 | Ga0495680_0001001 | 3300047322 | Bacteria | 31451 |
| 208 | Ga0495680_0137650 | 3300047322 | Bacteria | 1789 |
| 209 | Ga0495675_0000002 | 3300047444 | Bacteria | 216469 |
| 210 | Ga0495673_0127882 | 3300047469 | Bacteria | 1001 |
| 211 | Ga0495686_0599585 | 3300047472 | Bacteria | 570 |
| 212 | Ga0495593_0130474 | 3300047673 | Bacteria | 1276 |
| 213 | Ga0495602_0000034 | 3300048088 | Bacteria | 140722 |
| 214 | Ga0495602_0303169 | 3300048088 | Bacteria | 1168 |
| 215 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 216 | Ga0496101_0000028 | 3300048904 | Bacteria | 198664 |
| 217 | Ga0496102_0000749 | 3300048905 | Bacteria | 31723 |
| 218 | Ga0496103_0000481 | 3300048906 | Bacteria | 33518 |
| 219 | Ga0496104_0113142 | 3300048907 | Bacteria | 2603 |
| 220 | Ga0496106_0000218 | 3300048909 | Bacteria | 40075 |
| 221 | Ga0496107_0000002 | 3300048910 | Bacteria | 320871 |
| 222 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 223 | Ga0496108_0086767 | 3300048911 | Bacteria | 2657 |
| 224 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 225 | Ga0496109_0000221 | 3300048912 | Bacteria | 56054 |
| 226 | Ga0496111_0000121 | 3300048914 | Bacteria | 33902 |
| 227 | Ga0496112_0012664 | 3300048915 | Bacteria | 7755 |
| 228 | Ga0496113_0000005 | 3300048916 | Bacteria | 105956 |
| 229 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 230 | Ga0496114_1282550 | 3300048917 | Unclassified | 619 |
| 231 | Ga0496115_0000016 | 3300048918 | Bacteria | 187067 |
| 232 | Ga0496115_0001530 | 3300048918 | Bacteria | 16611 |
| 233 | Ga0496124_0251952 | 3300048927 | Bacteria | 1305 |
| 234 | Ga0501046_0444956 | 3300049580 | Bacteria | 932 |
| 235 | Ga0501047_0331979 | 3300049581 | Bacteria | 1359 |
| 236 | Ga0501069_0200318 | 3300049585 | Bacteria | 1157 |
| 237 | Ga0501069_0722399 | 3300049585 | Bacteria | 601 |
| 238 | Ga0501070_0329853 | 3300049586 | Bacteria | 1240 |
| 239 | Ga0501070_0420473 | 3300049586 | Bacteria | 1079 |
| 240 | Ga0501074_0098180 | 3300049590 | Bacteria | 2096 |
| 241 | Ga0501080_0084566 | 3300049742 | Bacteria | 2948 |
| 242 | Ga0501080_0436171 | 3300049742 | Bacteria | 1176 |
| 243 | Ga0501035_1189188 | 3300049822 | Bacteria | 592 |
| 244 | Ga0495601_0000017 | 3300053077 | Bacteria | 204209 |
| 245 | Ga0495601_0400610 | 3300053077 | Bacteria | 890 |
| 246 | Ga0495612_0003068 | 3300053078 | Bacteria | 6928 |
| 247 | Ga0495655_0000005 | 3300053083 | Bacteria | 257472 |
| 248 | Ga0495655_0064095 | 3300053083 | Bacteria | 1011 |
| 249 | Ga0495595_0000007 | 3300053084 | Bacteria | 228504 |
| 250 | Ga0495595_0036298 | 3300053084 | Bacteria | 2236 |
| 251 | Ga0495619_0000026 | 3300053085 | Bacteria | 167387 |
| 252 | Ga0500566_0001830 | 3300053094 | Bacteria | 12505 |
| 253 | Ga0500628_000013 | 3300053129 | Bacteria | 106419 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028577 | Ga0265318_10153466 | Ga0265318_101534662 | 75 |
| 2 | 3300028654 | Ga0265322_10006271 | Ga0265322_100062713 | 75 |
| 3 | 3300028800 | Ga0265338_10159944 | Ga0265338_101599443 | 75 |
| 4 | 3300031249 | Ga0265339_10079078 | Ga0265339_100790783 | 75 |
| 5 | 3300031595 | Ga0265313_10071947 | Ga0265313_100719471 | 75 |
| 6 | 3300031711 | Ga0265314_10077552 | Ga0265314_100775523 | 75 |
| 7 | 3300028573 | Ga0265334_10319318 | Ga0265334_103193182 | 76 |
| 8 | 3300028556 | Ga0265337_1159001 | Ga0265337_11590012 | 79 |
| 9 | 3300028558 | Ga0265326_10022712 | Ga0265326_100227121 | 79 |
| 10 | 3300028563 | Ga0265319_1009263 | Ga0265319_10092632 | 79 |
| 11 | 3300028573 | Ga0265334_10021700 | Ga0265334_100217004 | 79 |
| 12 | 3300028577 | Ga0265318_10004682 | Ga0265318_100046827 | 79 |
| 13 | 3300028800 | Ga0265338_10508222 | Ga0265338_105082222 | 79 |
| 14 | 3300029957 | Ga0265324_10060204 | Ga0265324_100602042 | 79 |
| 15 | 3300031235 | Ga0265330_10112902 | Ga0265330_101129022 | 79 |
| 16 | 3300031238 | Ga0265332_10081570 | Ga0265332_100815702 | 79 |
| 17 | 3300031239 | Ga0265328_10005664 | Ga0265328_100056646 | 79 |
| 18 | 3300031240 | Ga0265320_10277916 | Ga0265320_102779162 | 79 |
| 19 | 3300031241 | Ga0265325_10020453 | Ga0265325_100204532 | 79 |
| 20 | 3300031242 | Ga0265329_10088616 | Ga0265329_100886162 | 79 |
| 21 | 3300031247 | Ga0265340_10009216 | Ga0265340_100092166 | 79 |
| 22 | 3300031249 | Ga0265339_10255085 | Ga0265339_102550852 | 79 |
| 23 | 3300031250 | Ga0265331_10174540 | Ga0265331_101745402 | 79 |
| 24 | 3300031251 | Ga0265327_10040580 | Ga0265327_100405803 | 79 |
| 25 | 3300031344 | Ga0265316_10003729 | Ga0265316_100037299 | 79 |
| 26 | 3300031595 | Ga0265313_10022748 | Ga0265313_100227484 | 79 |
| 27 | 3300031711 | Ga0265314_10129876 | Ga0265314_101298762 | 79 |
| 28 | 3300031712 | Ga0265342_10245738 | Ga0265342_102457382 | 79 |
| 29 | 3300002987 | JGI25159J45721_1000211 | JGI25159J45721_100021115 | 82 |
| 30 | 3300003354 | JGI25160J50197_1000418 | JGI25160J50197_100041815 | 82 |
| 31 | 3300014326 | Ga0157380_10396816 | Ga0157380_103968162 | 82 |
| 32 | 3300005937 | Ga0081455_10000575 | Ga0081455_100005755 | 85 |
| 33 | 3300036712 | Ga0316584_0780072 | Ga0316584_0780072_119_427 | 85 |
| 34 | 3300044901 | Ga0466960_0177436 | Ga0466960_0177436_96_353 | 85 |
| 35 | 3300005338 | Ga0068868_100007828 | Ga0068868_1000078287 | 86 |
| 36 | 3300005345 | Ga0070692_10009302 | Ga0070692_100093023 | 86 |
| 37 | 3300005353 | Ga0070669_100174792 | Ga0070669_1001747923 | 86 |
| 38 | 3300005356 | Ga0070674_100061966 | Ga0070674_1000619663 | 86 |
| 39 | 3300005364 | Ga0070673_100360981 | Ga0070673_1003609812 | 86 |
| 40 | 3300005367 | Ga0070667_100582783 | Ga0070667_1005827832 | 86 |
| 41 | 3300005457 | Ga0070662_100009977 | Ga0070662_1000099775 | 86 |
| 42 | 3300005459 | Ga0068867_100041277 | Ga0068867_1000412773 | 86 |
| 43 | 3300005459 | Ga0068867_100584559 | Ga0068867_1005845592 | 86 |
| 44 | 3300005544 | Ga0070686_100048395 | Ga0070686_1000483954 | 86 |
| 45 | 3300005578 | Ga0068854_100016877 | Ga0068854_1000168774 | 86 |
| 46 | 3300005718 | Ga0068866_10021172 | Ga0068866_100211724 | 86 |
| 47 | 3300005719 | Ga0068861_100202018 | Ga0068861_1002020182 | 86 |
| 48 | 3300006881 | Ga0068865_100007642 | Ga0068865_1000076424 | 86 |
| 49 | 3300009176 | Ga0105242_10100717 | Ga0105242_101007172 | 86 |
| 50 | 3300013297 | Ga0157378_10008596 | Ga0157378_100085967 | 86 |
| 51 | 3300025899 | Ga0207642_10149265 | Ga0207642_101492653 | 86 |
| 52 | 3300025918 | Ga0207662_10006451 | Ga0207662_100064513 | 86 |
| 53 | 3300025923 | Ga0207681_10009296 | Ga0207681_100092962 | 86 |
| 54 | 3300025927 | Ga0207687_10013237 | Ga0207687_100132376 | 86 |
| 55 | 3300025933 | Ga0207706_10001190 | Ga0207706_1000119023 | 86 |
| 56 | 3300025937 | Ga0207669_10152843 | Ga0207669_101528433 | 86 |
| 57 | 3300025981 | Ga0207640_10166718 | Ga0207640_101667183 | 86 |
| 58 | 3300025986 | Ga0207658_10509629 | Ga0207658_105096292 | 86 |
| 59 | 3300026075 | Ga0207708_10039547 | Ga0207708_100395475 | 86 |
| 60 | 3300026089 | Ga0207648_10022395 | Ga0207648_100223956 | 86 |
| 61 | 3300026089 | Ga0207648_10097253 | Ga0207648_100972533 | 86 |
| 62 | 3300026118 | Ga0207675_100184736 | Ga0207675_1001847364 | 86 |
| 63 | 3300046457 | Ga0495590_0077752 | Ga0495590_0077752_514_774 | 86 |
| 64 | 3300005445 | Ga0070708_100000355 | Ga0070708_10000035517 | 87 |
| 65 | 3300005468 | Ga0070707_100001422 | Ga0070707_10000142221 | 87 |
| 66 | 3300025922 | Ga0207646_10001932 | Ga0207646_100019323 | 87 |
| 67 | 3300005719 | Ga0068861_101020441 | Ga0068861_1010204411 | 88 |
| 68 | 3300003374 | JGI25161J50226_1000265 | JGI25161J50226_100026517 | 89 |
| 69 | 3300004625 | Ga0055543_1000356 | Ga0055543_100035617 | 89 |
| 70 | 3300005262 | Ga0065165_1001587 | Ga0065165_100158711 | 89 |
| 71 | 3300025208 | Ga0209436_123662 | Ga0209436_1236622 | 89 |
| 72 | 3300025284 | Ga0209130_1000048 | Ga0209130_1000048212 | 89 |
| 73 | 3300025302 | Ga0207426_1000075 | Ga0207426_1000075229 | 89 |
| 74 | 3300045976 | Ga0466967_0512658 | Ga0466967_0512658_841_1116 | 89 |
| 75 | 3300046477 | Ga0495664_0902815 | Ga0495664_0902815_96_365 | 89 |
| 76 | 3300046543 | Ga0495645_0338399 | Ga0495645_0338399_555_824 | 89 |
| 77 | 3300053077 | Ga0495601_0400610 | Ga0495601_0400610_16_285 | 89 |
| 78 | 3300005518 | Ga0070699_100229613 | Ga0070699_1002296132 | 90 |
| 79 | 3300006881 | Ga0068865_100054085 | Ga0068865_1000540854 | 90 |
| 80 | 3300009177 | Ga0105248_10000037 | Ga0105248_10000037148 | 90 |
| 81 | 3300025938 | Ga0207704_10000104 | Ga0207704_1000010429 | 90 |
| 82 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011395 | 90 |
| 83 | 3300028556 | Ga0265337_1001256 | Ga0265337_100125615 | 90 |
| 84 | 3300028558 | Ga0265326_10000127 | Ga0265326_100001279 | 90 |
| 85 | 3300028654 | Ga0265322_10000005 | Ga0265322_10000005174 | 90 |
| 86 | 3300029957 | Ga0265324_10000264 | Ga0265324_1000026446 | 90 |
| 87 | 3300031240 | Ga0265320_10000010 | Ga0265320_10000010220 | 90 |
| 88 | 3300031242 | Ga0265329_10001050 | Ga0265329_1000105013 | 90 |
| 89 | 3300031249 | Ga0265339_10028796 | Ga0265339_100287964 | 90 |
| 90 | 3300031250 | Ga0265331_10000217 | Ga0265331_1000021724 | 90 |
| 91 | 3300031251 | Ga0265327_10000040 | Ga0265327_1000004086 | 90 |
| 92 | 3300031711 | Ga0265314_10000491 | Ga0265314_1000049149 | 90 |
| 93 | 3300037312 | Ga0395899_0088976 | Ga0395899_0088976_1356_1640 | 90 |
| 94 | 3300037418 | Ga0395900_0062167 | Ga0395900_0062167_2753_3037 | 90 |
| 95 | 3300037466 | Ga0395898_0032384 | Ga0395898_0032384_2857_3141 | 90 |
| 96 | 3300038443 | Ga0395901_0038794 | Ga0395901_0038794_1508_1792 | 90 |
| 97 | 3300044694 | Ga0466963_0126438 | Ga0466963_0126438_819_1091 | 90 |
| 98 | 3300046536 | Ga0495587_0588783 | Ga0495587_0588783_66_338 | 90 |
| 99 | 3300047321 | Ga0495676_0007903 | Ga0495676_0007903_9363_9635 | 90 |
| 100 | 3300047469 | Ga0495673_0127882 | Ga0495673_0127882_329_601 | 90 |
| 101 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_87391_87663 | 90 |
| 102 | 3300048904 | Ga0496101_0000028 | Ga0496101_0000028_87380_87652 | 90 |
| 103 | 3300048909 | Ga0496106_0000218 | Ga0496106_0000218_20394_20666 | 90 |
| 104 | 3300048910 | Ga0496107_0000002 | Ga0496107_0000002_160825_161097 | 90 |
| 105 | 3300049585 | Ga0501069_0200318 | Ga0501069_0200318_61_333 | 90 |
| 106 | 3300049586 | Ga0501070_0329853 | Ga0501070_0329853_873_1145 | 90 |
| 107 | 3300005339 | Ga0070660_100765532 | Ga0070660_1007655322 | 91 |
| 108 | 3300005340 | Ga0070689_100153157 | Ga0070689_1001531572 | 91 |
| 109 | 3300005341 | Ga0070691_10129182 | Ga0070691_101291822 | 91 |
| 110 | 3300005345 | Ga0070692_10046838 | Ga0070692_100468382 | 91 |
| 111 | 3300005354 | Ga0070675_100000050 | Ga0070675_10000005027 | 91 |
| 112 | 3300005365 | Ga0070688_100076412 | Ga0070688_1000764122 | 91 |
| 113 | 3300005366 | Ga0070659_100003678 | Ga0070659_10000367813 | 91 |
| 114 | 3300005436 | Ga0070713_100119207 | Ga0070713_1001192073 | 91 |
| 115 | 3300005439 | Ga0070711_100226482 | Ga0070711_1002264822 | 91 |
| 116 | 3300005466 | Ga0070685_10151067 | Ga0070685_101510672 | 91 |
| 117 | 3300005535 | Ga0070684_100048700 | Ga0070684_1000487004 | 91 |
| 118 | 3300005548 | Ga0070665_100753114 | Ga0070665_1007531142 | 91 |
| 119 | 3300005718 | Ga0068866_10004817 | Ga0068866_100048176 | 91 |
| 120 | 3300005841 | Ga0068863_100008832 | Ga0068863_1000088326 | 91 |
| 121 | 3300006881 | Ga0068865_100916251 | Ga0068865_1009162512 | 91 |
| 122 | 3300009098 | Ga0105245_10006841 | Ga0105245_100068416 | 91 |
| 123 | 3300009176 | Ga0105242_10000063 | Ga0105242_1000006356 | 91 |
| 124 | 3300009551 | Ga0105238_12907659 | Ga0105238_129076591 | 91 |
| 125 | 3300013102 | Ga0157371_10040382 | Ga0157371_100403823 | 91 |
| 126 | 3300013104 | Ga0157370_10356119 | Ga0157370_103561194 | 91 |
| 127 | 3300013296 | Ga0157374_11093033 | Ga0157374_110930332 | 91 |
| 128 | 3300013297 | Ga0157378_10023605 | Ga0157378_100236053 | 91 |
| 129 | 3300013306 | Ga0163162_10404613 | Ga0163162_104046132 | 91 |
| 130 | 3300013307 | Ga0157372_10000146 | Ga0157372_1000014619 | 91 |
| 131 | 3300017792 | Ga0163161_10088739 | Ga0163161_100887392 | 91 |
| 132 | 3300022467 | Ga0224712_10022571 | Ga0224712_100225712 | 91 |
| 133 | 3300025899 | Ga0207642_10003444 | Ga0207642_100034443 | 91 |
| 134 | 3300025916 | Ga0207663_10433224 | Ga0207663_104332242 | 91 |
| 135 | 3300025926 | Ga0207659_10000055 | Ga0207659_1000005528 | 91 |
| 136 | 3300025927 | Ga0207687_10006279 | Ga0207687_100062793 | 91 |
| 137 | 3300025928 | Ga0207700_10328358 | Ga0207700_103283582 | 91 |
| 138 | 3300025932 | Ga0207690_10002537 | Ga0207690_100025372 | 91 |
| 139 | 3300025934 | Ga0207686_10000124 | Ga0207686_100001247 | 91 |
| 140 | 3300025936 | Ga0207670_10106106 | Ga0207670_101061062 | 91 |
| 141 | 3300025938 | Ga0207704_10782971 | Ga0207704_107829712 | 91 |
| 142 | 3300025944 | Ga0207661_10028812 | Ga0207661_100288125 | 91 |
| 143 | 3300025986 | Ga0207658_10094669 | Ga0207658_100946694 | 91 |
| 144 | 3300026088 | Ga0207641_10006453 | Ga0207641_100064537 | 91 |
| 145 | 3300041463 | Ga0451804_0057938 | Ga0451804_0057938_119_403 | 91 |
| 146 | 3300041486 | Ga0451807_2713979 | Ga0451807_2713979_678_962 | 91 |
| 147 | 3300041492 | Ga0451835_0327608 | Ga0451835_0327608_207_491 | 91 |
| 148 | 3300041496 | Ga0451839_1388815 | Ga0451839_1388815_321_596 | 91 |
| 149 | 3300041505 | Ga0451849_0423017 | Ga0451849_0423017_44_319 | 91 |
| 150 | 3300041512 | Ga0451853_1171343 | Ga0451853_1171343_1264_1548 | 91 |
| 151 | 3300044842 | Ga0466957_0240880 | Ga0466957_0240880_275_550 | 91 |
| 152 | 3300045836 | Ga0466958_0413531 | Ga0466958_0413531_35_310 | 91 |
| 153 | 3300046459 | Ga0495629_0051041 | Ga0495629_0051041_1715_1999 | 91 |
| 154 | 3300046511 | Ga0495608_0000013 | Ga0495608_0000013_85476_85751 | 91 |
| 155 | 3300046536 | Ga0495587_0107045 | Ga0495587_0107045_507_782 | 91 |
| 156 | 3300046543 | Ga0495645_0289655 | Ga0495645_0289655_465_740 | 91 |
| 157 | 3300046559 | Ga0495667_0000038 | Ga0495667_0000038_50911_51186 | 91 |
| 158 | 3300046675 | Ga0495657_0000003 | Ga0495657_0000003_136675_136950 | 91 |
| 159 | 3300046689 | Ga0495613_0000027 | Ga0495613_0000027_128733_129008 | 91 |
| 160 | 3300046809 | Ga0495600_0032852 | Ga0495600_0032852_1059_1334 | 91 |
| 161 | 3300047317 | Ga0495604_0000723 | Ga0495604_0000723_14330_14605 | 91 |
| 162 | 3300047317 | Ga0495604_0032236 | Ga0495604_0032236_3074_3349 | 91 |
| 163 | 3300047321 | Ga0495676_0028720 | Ga0495676_0028720_4275_4550 | 91 |
| 164 | 3300047322 | Ga0495680_0001001 | Ga0495680_0001001_25484_25759 | 91 |
| 165 | 3300047322 | Ga0495680_0137650 | Ga0495680_0137650_776_1060 | 91 |
| 166 | 3300047444 | Ga0495675_0000002 | Ga0495675_0000002_136675_136950 | 91 |
| 167 | 3300047472 | Ga0495686_0599585 | Ga0495686_0599585_234_509 | 91 |
| 168 | 3300048088 | Ga0495602_0000034 | Ga0495602_0000034_88353_88628 | 91 |
| 169 | 3300048088 | Ga0495602_0303169 | Ga0495602_0303169_370_645 | 91 |
| 170 | 3300048905 | Ga0496102_0000749 | Ga0496102_0000749_14202_14486 | 91 |
| 171 | 3300048906 | Ga0496103_0000481 | Ga0496103_0000481_26173_26457 | 91 |
| 172 | 3300048907 | Ga0496104_0113142 | Ga0496104_0113142_695_970 | 91 |
| 173 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_425462_425737 | 91 |
| 174 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_109355_109630 | 91 |
| 175 | 3300048914 | Ga0496111_0000121 | Ga0496111_0000121_6402_6677 | 91 |
| 176 | 3300048915 | Ga0496112_0012664 | Ga0496112_0012664_3823_4098 | 91 |
| 177 | 3300048916 | Ga0496113_0000005 | Ga0496113_0000005_81833_82108 | 91 |
| 178 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_497596_497871 | 91 |
| 179 | 3300048917 | Ga0496114_1282550 | Ga0496114_1282550_306_590 | 91 |
| 180 | 3300048918 | Ga0496115_0001530 | Ga0496115_0001530_15368_15643 | 91 |
| 181 | 3300049580 | Ga0501046_0444956 | Ga0501046_0444956_100_375 | 91 |
| 182 | 3300049581 | Ga0501047_0331979 | Ga0501047_0331979_909_1184 | 91 |
| 183 | 3300049585 | Ga0501069_0722399 | Ga0501069_0722399_258_533 | 91 |
| 184 | 3300049586 | Ga0501070_0420473 | Ga0501070_0420473_542_826 | 91 |
| 185 | 3300049590 | Ga0501074_0098180 | Ga0501074_0098180_484_768 | 91 |
| 186 | 3300049742 | Ga0501080_0084566 | Ga0501080_0084566_839_1123 | 91 |
| 187 | 3300049742 | Ga0501080_0436171 | Ga0501080_0436171_566_841 | 91 |
| 188 | 3300049822 | Ga0501035_1189188 | Ga0501035_1189188_24_299 | 91 |
| 189 | 3300053077 | Ga0495601_0000017 | Ga0495601_0000017_17996_18271 | 91 |
| 190 | 3300053083 | Ga0495655_0000005 | Ga0495655_0000005_250298_250582 | 91 |
| 191 | 3300053083 | Ga0495655_0064095 | Ga0495655_0064095_482_757 | 91 |
| 192 | 3300053084 | Ga0495595_0000007 | Ga0495595_0000007_85499_85774 | 91 |
| 193 | 3300053084 | Ga0495595_0036298 | Ga0495595_0036298_894_1169 | 91 |
| 194 | 3300053085 | Ga0495619_0000026 | Ga0495619_0000026_86790_87065 | 91 |
| 195 | 3300053094 | Ga0500566_0001830 | Ga0500566_0001830_6808_7092 | 91 |
| 196 | 3300053129 | Ga0500628_000013 | Ga0500628_000013_7066_7350 | 91 |
| 197 | 3300000546 | LJNas_1006238 | LJNas_10062382 | 92 |
| 198 | 3300005327 | Ga0070658_10780624 | Ga0070658_107806242 | 92 |
| 199 | 3300005329 | Ga0070683_100095868 | Ga0070683_1000958681 | 92 |
| 200 | 3300005341 | Ga0070691_10000004 | Ga0070691_1000000413 | 92 |
| 201 | 3300005365 | Ga0070688_100000010 | Ga0070688_10000001021 | 92 |
| 202 | 3300005456 | Ga0070678_100257420 | Ga0070678_1002574202 | 92 |
| 203 | 3300005466 | Ga0070685_10000010 | Ga0070685_10000010106 | 92 |
| 204 | 3300005535 | Ga0070684_100770237 | Ga0070684_1007702372 | 92 |
| 205 | 3300005543 | Ga0070672_100000031 | Ga0070672_10000003149 | 92 |
| 206 | 3300005548 | Ga0070665_100819829 | Ga0070665_1008198291 | 92 |
| 207 | 3300005840 | Ga0068870_10044920 | Ga0068870_100449202 | 92 |
| 208 | 3300006846 | Ga0075430_100026320 | Ga0075430_1000263204 | 92 |
| 209 | 3300009101 | Ga0105247_10162441 | Ga0105247_101624412 | 92 |
| 210 | 3300009148 | Ga0105243_10010381 | Ga0105243_100103815 | 92 |
| 211 | 3300009177 | Ga0105248_10192317 | Ga0105248_101923172 | 92 |
| 212 | 3300009553 | Ga0105249_12314222 | Ga0105249_123142222 | 92 |
| 213 | 3300010375 | Ga0105239_10210502 | Ga0105239_102105022 | 92 |
| 214 | 3300010375 | Ga0105239_13199685 | Ga0105239_131996851 | 92 |
| 215 | 3300013308 | Ga0157375_10030090 | Ga0157375_100300905 | 92 |
| 216 | 3300013308 | Ga0157375_10993158 | Ga0157375_109931582 | 92 |
| 217 | 3300014969 | Ga0157376_11812392 | Ga0157376_118123922 | 92 |
| 218 | 3300025909 | Ga0207705_10533741 | Ga0207705_105337412 | 92 |
| 219 | 3300025911 | Ga0207654_11079856 | Ga0207654_110798561 | 92 |
| 220 | 3300025920 | Ga0207649_10000003 | Ga0207649_1000000335 | 92 |
| 221 | 3300025935 | Ga0207709_10017116 | Ga0207709_100171163 | 92 |
| 222 | 3300025940 | Ga0207691_10000178 | Ga0207691_1000017837 | 92 |
| 223 | 3300025944 | Ga0207661_10082507 | Ga0207661_100825073 | 92 |
| 224 | 3300025945 | Ga0207679_10241163 | Ga0207679_102411633 | 92 |
| 225 | 3300025972 | Ga0207668_10519511 | Ga0207668_105195112 | 92 |
| 226 | 3300026023 | Ga0207677_10157657 | Ga0207677_101576572 | 92 |
| 227 | 3300026121 | Ga0207683_10083558 | Ga0207683_100835583 | 92 |
| 228 | 3300028379 | Ga0268266_10495219 | Ga0268266_104952192 | 92 |
| 229 | 3300028563 | Ga0265319_1000010 | Ga0265319_100001036 | 92 |
| 230 | 3300028666 | Ga0265336_10087556 | Ga0265336_100875562 | 92 |
| 231 | 3300028800 | Ga0265338_10000287 | Ga0265338_1000028773 | 92 |
| 232 | 3300029957 | Ga0265324_10052760 | Ga0265324_100527601 | 92 |
| 233 | 3300031238 | Ga0265332_10300559 | Ga0265332_103005592 | 92 |
| 234 | 3300031241 | Ga0265325_10051053 | Ga0265325_100510533 | 92 |
| 235 | 3300031250 | Ga0265331_10135725 | Ga0265331_101357252 | 92 |
| 236 | 3300041494 | Ga0451837_0718245 | Ga0451837_0718245_185_463 | 92 |
| 237 | 3300046461 | Ga0495641_0016090 | Ga0495641_0016090_3136_3423 | 92 |
| 238 | 3300046507 | Ga0495606_0000017 | Ga0495606_0000017_63821_64108 | 92 |
| 239 | 3300046512 | Ga0495610_0027064 | Ga0495610_0027064_2071_2358 | 92 |
| 240 | 3300046517 | Ga0495630_0000032 | Ga0495630_0000032_81377_81664 | 92 |
| 241 | 3300046536 | Ga0495587_0000272 | Ga0495587_0000272_27398_27691 | 92 |
| 242 | 3300046674 | Ga0495588_0000073 | Ga0495588_0000073_165945_166229 | 92 |
| 243 | 3300046675 | Ga0495657_0260183 | Ga0495657_0260183_657_935 | 92 |
| 244 | 3300046678 | Ga0495599_0332610 | Ga0495599_0332610_470_748 | 92 |
| 245 | 3300046681 | Ga0495647_0001114 | Ga0495647_0001114_628_915 | 92 |
| 246 | 3300046690 | Ga0495624_0000691 | Ga0495624_0000691_10131_10412 | 92 |
| 247 | 3300047320 | Ga0495672_0073983 | Ga0495672_0073983_1118_1429 | 92 |
| 248 | 3300047673 | Ga0495593_0130474 | Ga0495593_0130474_509_787 | 92 |
| 249 | 3300048911 | Ga0496108_0086767 | Ga0496108_0086767_901_1179 | 92 |
| 250 | 3300048912 | Ga0496109_0000221 | Ga0496109_0000221_54294_54572 | 92 |
| 251 | 3300048918 | Ga0496115_0000016 | Ga0496115_0000016_40464_40751 | 92 |
| 252 | 3300048927 | Ga0496124_0251952 | Ga0496124_0251952_884_1162 | 92 |
| 253 | 3300053078 | Ga0495612_0003068 | Ga0495612_0003068_4525_4812 | 92 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ida-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8635 | 1 | 89 |
| 2ida-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8128 | 1 | 89 |
| 3phd-assembly1.cif.gz_D | crystal structure of human hdac6 in complex with ubiquitin | 0.7996 | 4 | 88 |
| 5g0f-assembly1.cif.gz_A | crystal structure of danio rerio hdac6 znf-ubp domain | 0.7751 | 4 | 86 |
| 3phd-assembly1.cif.gz_B | crystal structure of human hdac6 in complex with ubiquitin | 0.7667 | 4 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DD96_272_345_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.9253 | 35 | 86 | 3.30.40.10 |
| af_A4HRG6_422_490_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.9068 | 35 | 86 | 3.30.40.10 |
| 2idaA01 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.8672 | 1 | 89 | 3.30.40.10 |
| af_Q55EJ1_913_1015_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.8505 | 21 | 89 | 3.30.40.10 |
| 2idaA01 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.8495 | 1 | 89 | 3.30.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H3IX77-F1-model_v4 | Ubiquitin-hydrolase Zn-finger-containing protein | 0.9957 | 35 | 86 |
GO:0008270
GO:0016787 |
| AF-A0A841NYZ2-F1-model_v4 | deleted | 0.9865 | 38 | 86 |
|
| AF-A0A7W0S772-F1-model_v4 | UBP-type zinc finger domain-containing protein | 0.9832 | 35 | 91 |
GO:0008270
|
| AF-A0A829QKN3-F1-model_v4 | Zn-finger in ubiquitin-hydrolases and other family protein | 0.978 | 33 | 86 |
GO:0008270
GO:0016787 |
| AF-A0A4V2SXT5-F1-model_v4 | Ubiquitin-hydrolase Zn-finger-containing protein | 0.9758 | 35 | 90 |
GO:0008270
GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar