F364312

General Info

Members Datasets Scaffolds Average Seq Length
253 176 506 290

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0143396|Ga0495629_0143396_209_1165
Length 318
Sequence MIDIVPTGKILGATVNGLDLSQALADAVFDQILRALGRYGVLRFPHQALKPAAQKAFASRFGSLEVHVAGMHQDAEHPEIMFLSNIVEDGKPIGLADAGQDWHTDMSYSQVIALANVLHAVKVPRDGSGRPLGNTHFADMHAAYDDLPAEMTAQLKDATAVHDFNKFWEMMRRDRGSERPPLTPQQRAAKPPVSHPVFLTHPITGRKVLYADPGYTVRINDMAVEESDEILSFLFAHQLQPKYCYEQQWSEGDLMMWDNIGTLHNAIADYGPHQPRLMQRCQVMADWIFQHPVEGVARNLCMSDWLSPGITRASRPRT

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
172 2855730933 Achromobacter sp. HZ28 Isolate Nodule
173 2855767633 Achromobacter sp. HZ34 Isolate Nodule
174 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
175 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
176 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 0
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0.79
Rhizoplane 6.72
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0143396 3300046459 Bacteria 1662
2 Ga0065704_10103751 3300005289 Bacteria 2163
3 Ga0065707_10087312 3300005295 Bacteria 5069
4 Ga0070658_10259358 3300005327 Bacteria 1476
5 Ga0070690_100002963 3300005330 Bacteria 9182
6 Ga0070680_100000089 3300005336 Bacteria 51222
7 Ga0070680_100066368 3300005336 Bacteria 2958
8 Ga0070680_100090431 3300005336 Bacteria 2534
9 Ga0070682_100007516 3300005337 Bacteria 6143
10 Ga0068868_100003541 3300005338 Bacteria 10883
11 Ga0070689_100057265 3300005340 Bacteria 3025
12 Ga0070689_100385968 3300005340 Bacteria 1181
13 Ga0070691_10009666 3300005341 Bacteria 4401
14 Ga0070691_10069438 3300005341 Bacteria 1708
15 Ga0070687_100002470 3300005343 Bacteria 6949
16 Ga0070714_100071685 3300005435 Bacteria 2996
17 Ga0070701_10000224 3300005438 Bacteria 17823
18 Ga0070701_10085015 3300005438 Bacteria 1722
19 Ga0070705_100002532 3300005440 Bacteria 9182
20 Ga0070705_100026812 3300005440 Bacteria 3139
21 Ga0070700_100001299 3300005441 Bacteria 12426
22 Ga0070694_100001971 3300005444 Bacteria 12174
23 Ga0070694_100017580 3300005444 Bacteria 4522
24 Ga0070694_100019199 3300005444 Bacteria 4346
25 Ga0070694_100070001 3300005444 Bacteria 2414
26 Ga0070694_100184618 3300005444 Bacteria 1545
27 Ga0070694_100204561 3300005444 Bacteria 1473
28 Ga0070694_100282544 3300005444 Bacteria 1266
29 Ga0070681_10008392 3300005458 Bacteria 10115
30 Ga0070681_10047645 3300005458 Bacteria 4285
31 Ga0068867_100005200 3300005459 Bacteria 9182
32 Ga0070707_100227325 3300005468 Bacteria 1817
33 Ga0070699_100083966 3300005518 Bacteria 2779
34 Ga0070679_100039589 3300005530 Bacteria 4685
35 Ga0070697_100213076 3300005536 Bacteria 1645
36 Ga0068853_100174547 3300005539 Bacteria 1946
37 Ga0070686_100002771 3300005544 Bacteria 9649
38 Ga0070695_100000207 3300005545 Bacteria 28678
39 Ga0070695_100025430 3300005545 Bacteria 3655
40 Ga0070695_100042948 3300005545 Bacteria 2873
41 Ga0070695_100049169 3300005545 Bacteria 2699
42 Ga0070695_100456813 3300005545 Bacteria 980
43 Ga0070696_100000958 3300005546 Bacteria 18702
44 Ga0070696_100099646 3300005546 Bacteria 2080
45 Ga0070693_100001070 3300005547 Bacteria 12237
46 Ga0070693_100074105 3300005547 Bacteria 2013
47 Ga0070693_100241694 3300005547 Bacteria 1193
48 Ga0070704_100031413 3300005549 Bacteria 3572
49 Ga0068855_100014749 3300005563 Bacteria 9416
50 Ga0068854_100082680 3300005578 Bacteria 2374
51 Ga0068856_100040214 3300005614 Bacteria 4592
52 Ga0070702_100000051 3300005615 Bacteria 32802
53 Ga0070702_100075107 3300005615 Bacteria 2007
54 Ga0070702_100093440 3300005615 Bacteria 1829
55 Ga0068859_100008140 3300005617 Bacteria 10631
56 Ga0068859_100016847 3300005617 Bacteria 7337
57 Ga0068859_100408515 3300005617 Bacteria 1454
58 Ga0068866_10000950 3300005718 Bacteria 12744
59 Ga0068861_100333078 3300005719 Bacteria 1326
60 Ga0068870_10299507 3300005840 Bacteria 1015
61 Ga0068858_100009709 3300005842 Bacteria 9166
62 Ga0068860_100007869 3300005843 Bacteria 10641
63 Ga0068862_100007285 3300005844 Bacteria 9182
64 Ga0081539_10000668 3300005985 Bacteria 68754
65 Ga0081539_10035279 3300005985 Bacteria 3009
66 Ga0070712_100373497 3300006175 Bacteria 1172
67 Ga0097621_100002764 3300006237 Bacteria 12002
68 Ga0097621_100216526 3300006237 Bacteria 1667
69 Ga0068871_100003878 3300006358 Bacteria 10311
70 Ga0068871_100007784 3300006358 Bacteria 7671
71 Ga0068871_100361271 3300006358 Bacteria 1286
72 Ga0075428_100189352 3300006844 Bacteria 2225
73 Ga0075431_100488870 3300006847 Bacteria 1223
74 Ga0075433_10440537 3300006852 Bacteria 1149
75 Ga0075434_100000078 3300006871 Bacteria 52232
76 Ga0068865_100000447 3300006881 Bacteria 22945
77 Ga0075436_100002990 3300006914 Bacteria 11576
78 Ga0075436_100028258 3300006914 Bacteria 3858
79 Ga0075436_100056163 3300006914 Bacteria 2720
80 Ga0075436_100093769 3300006914 Bacteria 2088
81 Ga0075436_100111266 3300006914 Bacteria 1912
82 Ga0097620_100008140 3300006931 Bacteria 10631
83 Ga0097620_100016847 3300006931 Bacteria 7337
84 Ga0097620_100408564 3300006931 Bacteria 1454
85 Ga0075435_100033247 3300007076 Bacteria 4076
86 Ga0099794_10034361 3300007265 Bacteria 2388
87 Ga0099795_10086937 3300007788 Unclassified 1206
88 Ga0111539_10258370 3300009094 Bacteria 2028
89 Ga0105245_10004425 3300009098 Bacteria 12431
90 Ga0105245_10020635 3300009098 Bacteria 5777
91 Ga0114129_10663851 3300009147 Bacteria 1344
92 Ga0105243_10003720 3300009148 Bacteria 12240
93 Ga0105243_10346325 3300009148 Bacteria 1363
94 Ga0105241_10013741 3300009174 Bacteria 5931
95 Ga0105242_10003302 3300009176 Bacteria 12562
96 Ga0105242_10271117 3300009176 Bacteria 1537
97 Ga0105248_10047663 3300009177 Bacteria 4806
98 Ga0105249_10000917 3300009553 Bacteria 26070
99 Ga0105239_10008582 3300010375 Bacteria 11592
100 Ga0105246_10214101 3300011119 Bacteria 1506
101 Ga0157371_10178670 3300013102 Bacteria 1518
102 Ga0157378_10004581 3300013297 Bacteria 12120
103 Ga0163162_10184892 3300013306 Bacteria 2211
104 Ga0157376_10004392 3300014969 Bacteria 9818
105 Ga0157376_10400384 3300014969 Bacteria 1327
106 Ga0207642_10001134 3300025899 Bacteria 8234
107 Ga0207688_10083080 3300025901 Bacteria 1831
108 Ga0207654_10013963 3300025911 Bacteria 4140
109 Ga0207707_10016010 3300025912 Bacteria 6540
110 Ga0207707_10066055 3300025912 Bacteria 3150
111 Ga0207660_10008341 3300025917 Bacteria 6699
112 Ga0207662_10000215 3300025918 Bacteria 26901
113 Ga0207659_10240465 3300025926 Bacteria 1464
114 Ga0207687_10001049 3300025927 Bacteria 18747
115 Ga0207686_10002720 3300025934 Bacteria 9588
116 Ga0207686_10245979 3300025934 Bacteria 1304
117 Ga0207670_10002408 3300025936 Bacteria 9804
118 Ga0207704_10001044 3300025938 Bacteria 12293
119 Ga0207665_10115950 3300025939 Bacteria 1887
120 Ga0207689_10000007 3300025942 Bacteria 132362
121 Ga0207661_10039920 3300025944 Bacteria 3687
122 Ga0207667_10012993 3300025949 Bacteria 9558
123 Ga0207640_10010129 3300025981 Bacteria 5301
124 Ga0207677_10002194 3300026023 Bacteria 10259
125 Ga0207703_10004921 3300026035 Bacteria 10839
126 Ga0207639_10029407 3300026041 Bacteria 4022
127 Ga0207708_10001220 3300026075 Bacteria 19421
128 Ga0207708_10204511 3300026075 Bacteria 1576
129 Ga0207702_10442255 3300026078 Bacteria 1260
130 Ga0207648_10000135 3300026089 Bacteria 73544
131 Ga0207675_100000825 3300026118 Bacteria 30861
132 Ga0209996_1007433 3300027395 Bacteria 1425
133 Ga0209999_1022343 3300027543 Bacteria 1163
134 Ga0268265_10003652 3300028380 Bacteria 10970
135 Ga0268264_10001495 3300028381 Bacteria 21802
136 Ga0373926_0029879 3300035083 Bacteria 1916
137 Ga0373934_0019385 3300035086 Bacteria 2610
138 Ga0373923_0002741 3300035111 Bacteria 5498
139 Ga0373932_0019906 3300035112 Bacteria 1754
140 Ga0373936_0039734 3300035113 Bacteria 1883
141 Ga0373954_0000012 3300035118 Bacteria 73616
142 Ga0373954_0000582 3300035118 Bacteria 13847
143 Ga0373954_0007523 3300035118 Bacteria 4767
144 Ga0373956_0004515 3300035119 Bacteria 5558
145 Ga0373956_0019198 3300035119 Bacteria 2899
146 Ga0373960_0018651 3300035121 Bacteria 1813
147 Ga0373960_0030324 3300035121 Bacteria 1506
148 Ga0373943_0078293 3300035170 Bacteria 1690
149 Ga0373946_0007524 3300035171 Bacteria 3983
150 Ga0373955_0010226 3300035172 Bacteria 4424
151 Ga0373955_0193688 3300035172 Bacteria 1209
152 Ga0373924_0001386 3300035410 Bacteria 7846
153 Ga0373924_0012721 3300035410 Bacteria 3148
154 Ga0373924_0085728 3300035410 Bacteria 1343
155 Ga0373931_0018443 3300035691 Bacteria 3472
156 Ga0373931_0026800 3300035691 Bacteria 2937
157 Ga0373935_0051562 3300035692 Bacteria 2613
158 Ga0373935_0068150 3300035692 Bacteria 2289
159 Ga0373933_0001549 3300035724 Bacteria 13464
160 Ga0373947_0101274 3300035725 Bacteria 1810
161 Ga0373937_0002420 3300036401 Bacteria 15516
162 Ga0373937_0049863 3300036401 Bacteria 3833
163 Ga0373937_0075153 3300036401 Bacteria 3119
164 Ga0373937_0140851 3300036401 Bacteria 2256
165 Ga0373937_0176453 3300036401 Bacteria 2006
166 Ga0373925_0066831 3300037068 Bacteria 2710
167 Ga0395899_0004208 3300037312 Bacteria 11286
168 Ga0395899_0005971 3300037312 Bacteria 9459
169 Ga0395900_0004671 3300037418 Bacteria 14441
170 Ga0395900_0011275 3300037418 Bacteria 9141
171 Ga0395898_0005686 3300037466 Bacteria 13435
172 Ga0395898_0009140 3300037466 Bacteria 10441
173 Ga0395905_0009690 3300037471 Bacteria 9402
174 Ga0436364_0243294 3300037853 Bacteria 1970
175 Ga0436364_0632975 3300037853 Unclassified 2130
176 Ga0395901_0010794 3300038443 Bacteria 9257
177 Ga0395901_0046498 3300038443 Bacteria 4508
178 Ga0451576_0077397 3300045051 Bacteria 3462
179 Ga0451576_0085488 3300045051 Bacteria 3281
180 Ga0495592_0184369 3300046454 Bacteria 1419
181 Ga0495641_0020013 3300046461 Bacteria 3407
182 Ga0495651_0025955 3300046462 Bacteria 4561
183 Ga0495651_0062032 3300046462 Bacteria 2861
184 Ga0495650_0002145 3300046471 Bacteria 16764
185 Ga0495664_0034175 3300046477 Bacteria 2990
186 Ga0495666_0051049 3300046526 Bacteria 1987
187 Ga0495642_0087442 3300046528 Bacteria 1317
188 Ga0495640_0038692 3300046533 Bacteria 3353
189 Ga0495667_0028248 3300046559 Bacteria 3776
190 Ga0495667_0090932 3300046559 Bacteria 1977
191 Ga0495667_0092610 3300046559 Bacteria 1957
192 Ga0495635_0075363 3300046663 Bacteria 2311
193 Ga0495657_0060760 3300046675 Bacteria 2502
194 Ga0495657_0133949 3300046675 Bacteria 1550
195 Ga0495669_0057589 3300046684 Bacteria 1753
196 Ga0495613_0079575 3300046689 Bacteria 2383
197 Ga0495636_0012539 3300047318 Bacteria 3356
198 Ga0495680_0202122 3300047322 Bacteria 1425
199 Ga0495675_0059922 3300047444 Bacteria 2413
200 Ga0495675_0356239 3300047444 Bacteria 860
201 Ga0496100_0026751 3300048903 Bacteria 3540
202 Ga0496100_0254189 3300048903 Bacteria 1301
203 Ga0496102_0561979 3300048905 Bacteria 1063
204 Ga0496104_0165077 3300048907 Bacteria 2123
205 Ga0496105_0050701 3300048908 Bacteria 3429
206 Ga0496105_0113809 3300048908 Bacteria 2232
207 Ga0496107_0130061 3300048910 Bacteria 1858
208 Ga0496109_0007839 3300048912 Bacteria 9043
209 Ga0496109_0019021 3300048912 Bacteria 6050
210 Ga0496110_0001694 3300048913 Bacteria 16198
211 Ga0496110_0018433 3300048913 Bacteria 5853
212 Ga0496110_0023847 3300048913 Bacteria 5208
213 Ga0496111_0114691 3300048914 Bacteria 1986
214 Ga0496112_0265525 3300048915 Bacteria 1665
215 Ga0496113_0005393 3300048916 Bacteria 7973
216 Ga0496113_0016773 3300048916 Bacteria 5067
217 Ga0496115_0104734 3300048918 Bacteria 2322
218 Ga0501031_0111351 3300049568 Bacteria 1788
219 Ga0501042_0041547 3300049578 Bacteria 3271
220 Ga0501046_0109034 3300049580 Bacteria 2117
221 Ga0501048_0093068 3300049582 Bacteria 2126
222 Ga0501067_0081650 3300049583 Bacteria 1792
223 Ga0501069_0043185 3300049585 Bacteria 2495
224 Ga0501071_0105260 3300049587 Bacteria 2083
225 Ga0501071_0178678 3300049587 Bacteria 1590
226 Ga0501076_0100872 3300049592 Bacteria 2326
227 Ga0501077_0077392 3300049593 Bacteria 2107
228 Ga0501081_0197508 3300049743 Bacteria 1458
229 Ga0501035_0013969 3300049822 Bacteria 7408
230 Ga0501045_0028707 3300049824 Bacteria 4015
231 nmdc:mga0qj67_97400_c1 3300050509 Bacteria 2369
232 nmdc:mga06r32_172704_c1 3300050510 Bacteria 2146
233 nmdc:mga08y16_141826_c1 3300050511 Bacteria 2498
234 nmdc:mga08y16_66966_c1 3300050511 Bacteria 3747
235 nmdc:mga0n895_152910_c1 3300050512 Bacteria 2338
236 nmdc:mga0n895_90_c1 3300050512 Bacteria 52593
237 nmdc:mga0rr50_2923_c1 3300050513 Bacteria 9755
238 nmdc:mga0rr50_551148_c1 3300050513 Bacteria 982
239 nmdc:mga08x19_29179_c1 3300050514 Bacteria 3459
240 nmdc:mga08x19_4374_c1 3300050514 Bacteria 8380
241 nmdc:mga08x19_67930_c1 3300050514 Bacteria 2319
242 nmdc:mga0a205_639907_c1 3300050515 Bacteria 915
243 Ga0495601_0008342 3300053077 Bacteria 6119
244 Ga0495595_0005513 3300053084 Bacteria 5125
245 Ga0495619_0031632 3300053085 Bacteria 3429
246 Ga0500590_020280 3300053148 Bacteria 3448
247 Ga0501084_0464427 3300054114 Bacteria 1070
248 Ga0530510_0098735 3300061734 Bacteria 2135
249 2855736743 2855730933 Bacteria 7047938
250 2855773680 2855767633 Bacteria 7049357
251 2881101355 2881101125 Bacteria 4590519
252 2881417522 2881412998 Bacteria 6492157
253 2887376173 2887375801 Bacteria 5334027
254 Ga0495629_0143396
255 Ga0065704_10103751
256 Ga0065707_10087312
257 Ga0070658_10259358
258 Ga0070690_100002963
259 Ga0070680_100000089
260 Ga0070680_100066368
261 Ga0070680_100090431
262 Ga0070682_100007516
263 Ga0068868_100003541
264 Ga0070689_100057265
265 Ga0070689_100385968
266 Ga0070691_10009666
267 Ga0070691_10069438
268 Ga0070687_100002470
269 Ga0070714_100071685
270 Ga0070701_10000224
271 Ga0070701_10085015
272 Ga0070705_100002532
273 Ga0070705_100026812
274 Ga0070700_100001299
275 Ga0070694_100001971
276 Ga0070694_100017580
277 Ga0070694_100019199
278 Ga0070694_100070001
279 Ga0070694_100184618
280 Ga0070694_100204561
281 Ga0070694_100282544
282 Ga0070681_10008392
283 Ga0070681_10047645
284 Ga0068867_100005200
285 Ga0070707_100227325
286 Ga0070699_100083966
287 Ga0070679_100039589
288 Ga0070697_100213076
289 Ga0068853_100174547
290 Ga0070686_100002771
291 Ga0070695_100000207
292 Ga0070695_100025430
293 Ga0070695_100042948
294 Ga0070695_100049169
295 Ga0070695_100456813
296 Ga0070696_100000958
297 Ga0070696_100099646
298 Ga0070693_100001070
299 Ga0070693_100074105
300 Ga0070693_100241694
301 Ga0070704_100031413
302 Ga0068855_100014749
303 Ga0068854_100082680
304 Ga0068856_100040214
305 Ga0070702_100000051
306 Ga0070702_100075107
307 Ga0070702_100093440
308 Ga0068859_100008140
309 Ga0068859_100016847
310 Ga0068859_100408515
311 Ga0068866_10000950
312 Ga0068861_100333078
313 Ga0068870_10299507
314 Ga0068858_100009709
315 Ga0068860_100007869
316 Ga0068862_100007285
317 Ga0081539_10000668
318 Ga0081539_10035279
319 Ga0070712_100373497
320 Ga0097621_100002764
321 Ga0097621_100216526
322 Ga0068871_100003878
323 Ga0068871_100007784
324 Ga0068871_100361271
325 Ga0075428_100189352
326 Ga0075431_100488870
327 Ga0075433_10440537
328 Ga0075434_100000078
329 Ga0068865_100000447
330 Ga0075436_100002990
331 Ga0075436_100028258
332 Ga0075436_100056163
333 Ga0075436_100093769
334 Ga0075436_100111266
335 Ga0097620_100008140
336 Ga0097620_100016847
337 Ga0097620_100408564
338 Ga0075435_100033247
339 Ga0099794_10034361
340 Ga0099795_10086937
341 Ga0111539_10258370
342 Ga0105245_10004425
343 Ga0105245_10020635
344 Ga0114129_10663851
345 Ga0105243_10003720
346 Ga0105243_10346325
347 Ga0105241_10013741
348 Ga0105242_10003302
349 Ga0105242_10271117
350 Ga0105248_10047663
351 Ga0105249_10000917
352 Ga0105239_10008582
353 Ga0105246_10214101
354 Ga0157371_10178670
355 Ga0157378_10004581
356 Ga0163162_10184892
357 Ga0157376_10004392
358 Ga0157376_10400384
359 Ga0207642_10001134
360 Ga0207688_10083080
361 Ga0207654_10013963
362 Ga0207707_10016010
363 Ga0207707_10066055
364 Ga0207660_10008341
365 Ga0207662_10000215
366 Ga0207659_10240465
367 Ga0207687_10001049
368 Ga0207686_10002720
369 Ga0207686_10245979
370 Ga0207670_10002408
371 Ga0207704_10001044
372 Ga0207665_10115950
373 Ga0207689_10000007
374 Ga0207661_10039920
375 Ga0207667_10012993
376 Ga0207640_10010129
377 Ga0207677_10002194
378 Ga0207703_10004921
379 Ga0207639_10029407
380 Ga0207708_10001220
381 Ga0207708_10204511
382 Ga0207702_10442255
383 Ga0207648_10000135
384 Ga0207675_100000825
385 Ga0209996_1007433
386 Ga0209999_1022343
387 Ga0268265_10003652
388 Ga0268264_10001495
389 Ga0373926_0029879
390 Ga0373934_0019385
391 Ga0373923_0002741
392 Ga0373932_0019906
393 Ga0373936_0039734
394 Ga0373954_0000012
395 Ga0373954_0000582
396 Ga0373954_0007523
397 Ga0373956_0004515
398 Ga0373956_0019198
399 Ga0373960_0018651
400 Ga0373960_0030324
401 Ga0373943_0078293
402 Ga0373946_0007524
403 Ga0373955_0010226
404 Ga0373955_0193688
405 Ga0373924_0001386
406 Ga0373924_0012721
407 Ga0373924_0085728
408 Ga0373931_0018443
409 Ga0373931_0026800
410 Ga0373935_0051562
411 Ga0373935_0068150
412 Ga0373933_0001549
413 Ga0373947_0101274
414 Ga0373937_0002420
415 Ga0373937_0049863
416 Ga0373937_0075153
417 Ga0373937_0140851
418 Ga0373937_0176453
419 Ga0373925_0066831
420 Ga0395899_0004208
421 Ga0395899_0005971
422 Ga0395900_0004671
423 Ga0395900_0011275
424 Ga0395898_0005686
425 Ga0395898_0009140
426 Ga0395905_0009690
427 Ga0436364_0243294
428 Ga0436364_0632975
429 Ga0395901_0010794
430 Ga0395901_0046498
431 Ga0451576_0077397
432 Ga0451576_0085488
433 Ga0495592_0184369
434 Ga0495641_0020013
435 Ga0495651_0025955
436 Ga0495651_0062032
437 Ga0495650_0002145
438 Ga0495664_0034175
439 Ga0495666_0051049
440 Ga0495642_0087442
441 Ga0495640_0038692
442 Ga0495667_0028248
443 Ga0495667_0090932
444 Ga0495667_0092610
445 Ga0495635_0075363
446 Ga0495657_0060760
447 Ga0495657_0133949
448 Ga0495669_0057589
449 Ga0495613_0079575
450 Ga0495636_0012539
451 Ga0495680_0202122
452 Ga0495675_0059922
453 Ga0495675_0356239
454 Ga0496100_0026751
455 Ga0496100_0254189
456 Ga0496102_0561979
457 Ga0496104_0165077
458 Ga0496105_0050701
459 Ga0496105_0113809
460 Ga0496107_0130061
461 Ga0496109_0007839
462 Ga0496109_0019021
463 Ga0496110_0001694
464 Ga0496110_0018433
465 Ga0496110_0023847
466 Ga0496111_0114691
467 Ga0496112_0265525
468 Ga0496113_0005393
469 Ga0496113_0016773
470 Ga0496115_0104734
471 Ga0501031_0111351
472 Ga0501042_0041547
473 Ga0501046_0109034
474 Ga0501048_0093068
475 Ga0501067_0081650
476 Ga0501069_0043185
477 Ga0501071_0105260
478 Ga0501071_0178678
479 Ga0501076_0100872
480 Ga0501077_0077392
481 Ga0501081_0197508
482 Ga0501035_0013969
483 Ga0501045_0028707
484 nmdc:mga0qj67_97400_c1
485 nmdc:mga06r32_172704_c1
486 nmdc:mga08y16_141826_c1
487 nmdc:mga08y16_66966_c1
488 nmdc:mga0n895_152910_c1
489 nmdc:mga0n895_90_c1
490 nmdc:mga0rr50_2923_c1
491 nmdc:mga0rr50_551148_c1
492 nmdc:mga08x19_29179_c1
493 nmdc:mga08x19_4374_c1
494 nmdc:mga08x19_67930_c1
495 nmdc:mga0a205_639907_c1
496 Ga0495601_0008342
497 Ga0495595_0005513
498 Ga0495619_0031632
499 Ga0500590_020280
500 Ga0501084_0464427
501 Ga0530510_0098735
502 2855736743
503 2855773680
504 2881101355
505 2881417522
506 2887376173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02668

TauD

Taurine catabolism dioxygenase TauD, TfdA family

3

282

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d3j-assembly1.cif.gz_A ft_t dioxygenase holoenzyme 0.9414 2 283
1vz5-assembly1.cif.gz_C succinate complex of atsk 0.9376 3 283
1oij-assembly4.cif.gz_D crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate 0.9351 1 283
1oii-assembly4.cif.gz_D crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with iron and alphaketoglutarate 0.9347 1 283
1oik-assembly1.cif.gz_A-2 crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with fe, alphaketoglutarate and 2-ethyl-1-hexanesulfuric acid 0.9345 3 283
ID Description Score Start End Superfamily
1gqwB00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9123 2 283 3.60.130.10
1vz4D00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9109 3 283 3.60.130.10
5hsxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9102 2 283 3.60.130.10
5j92B00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9063 3 286 3.60.130.10
5j92B00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8757 3 286 3.60.130.10
ID Description Score Start End GO Terms
AF-A0A7C2M650-F1-model_v4 TauD/TfdA family dioxygenase 0.9796 1 286 GO:0000908
GO:0005737
GO:0006790
AF-D3JH11-F1-model_v4 TfdA-like protein 0.9752 135 258 GO:0000908
GO:0005737
GO:0006790
AF-A0A7X1P8K9-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9654 131 270 GO:0000908
GO:0005737
GO:0006790
AF-A0A3P4B6R9-F1-model_v4 Pentalenolactone F synthase (EC 1.14.11.36) 0.9642 2 283 GO:0000908
GO:0005737
GO:0006790
AF-A0A537V0A2-F1-model_v4 TauD/TfdA family dioxygenase 0.9635 2 283 GO:0000908
GO:0005737
GO:0006790

Map