F364247

General Info

Members Datasets Scaffolds Average Seq Length
253 160 506 92

Family's Representative Sequence

Representative Sequence 3300038735|Ga0400485_03705|Ga0400485_03705_615_917
Length 88
Sequence MSHKANLALAGAVAAALGLAAQLPTTTSAVAEGAKEKCYGIALAGKNDCKVDYDKAAWKYVTKGTCESTTVTLKDGTTRNGSLTAIKG

Samples

Sample ID Description Type Environment
1 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
50 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
154 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
155 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
157 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
158 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
159 2643221719 Rhizobium sp. Root274 Isolate Unclassified
160 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 0.4
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0.79
Rhizoplane 1.98
Rhizosphere 89.72
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400485_03705 3300038735 Bacteria 2319
2 JGI24735J21928_10051883 3300002067 Bacteria 1183
3 JGI24738J21930_10018260 3300002075 Bacteria 1467
4 rootH1_10020445 3300003323 Bacteria 2599
5 rootH1_10216300 3300003323 Bacteria 4226
6 Ga0055529_1039205 3300003763 Bacteria 575
7 Ga0070658_10488348 3300005327 Bacteria 1063
8 Ga0070658_10606873 3300005327 Bacteria 948
9 Ga0070658_11391438 3300005327 Bacteria 609
10 Ga0070670_100508314 3300005331 Bacteria 1072
11 Ga0070670_100948523 3300005331 Bacteria 781
12 Ga0068869_100169612 3300005334 Bacteria 1704
13 Ga0070666_10014760 3300005335 Bacteria 4977
14 Ga0070682_101963045 3300005337 Bacteria 514
15 Ga0068868_100071951 3300005338 Bacteria 2758
16 Ga0068868_100780622 3300005338 Bacteria 860
17 Ga0070689_100314605 3300005340 Bacteria 1306
18 Ga0070687_100124784 3300005343 Bacteria 1478
19 Ga0070661_100231258 3300005344 Bacteria 1421
20 Ga0070669_100056574 3300005353 Bacteria 2876
21 Ga0070669_100093958 3300005353 Bacteria 2253
22 Ga0070669_100237540 3300005353 Bacteria 1447
23 Ga0070674_100136413 3300005356 Bacteria 1836
24 Ga0070673_100237271 3300005364 Bacteria 1584
25 Ga0070659_100156402 3300005366 Bacteria 1862
26 Ga0070659_100610366 3300005366 Bacteria 938
27 Ga0070659_101019438 3300005366 Bacteria 727
28 Ga0070667_100164598 3300005367 Bacteria 1955
29 Ga0070667_100612783 3300005367 Bacteria 1003
30 Ga0070667_101238599 3300005367 Bacteria 699
31 Ga0070663_100131988 3300005455 Bacteria 1898
32 Ga0070678_100143859 3300005456 Bacteria 1912
33 Ga0070662_100002285 3300005457 Bacteria 11762
34 Ga0070662_100021818 3300005457 Bacteria 4377
35 Ga0068867_100084970 3300005459 Bacteria 2392
36 Ga0068867_100153112 3300005459 Bacteria 1813
37 Ga0068867_100429440 3300005459 Bacteria 1121
38 Ga0068867_100749049 3300005459 Bacteria 867
39 Ga0070685_10793985 3300005466 Bacteria 697
40 Ga0068853_100100607 3300005539 Bacteria 2556
41 Ga0070686_100466915 3300005544 Bacteria 973
42 Ga0070686_100706211 3300005544 Bacteria 805
43 Ga0070665_100008625 3300005548 Bacteria 10317
44 Ga0070665_100110664 3300005548 Bacteria 2749
45 Ga0070664_100147650 3300005564 Bacteria 2074
46 Ga0068852_100243115 3300005616 Bacteria 1721
47 Ga0068852_100812476 3300005616 Bacteria 949
48 Ga0068859_100000153 3300005617 Bacteria 65765
49 Ga0068859_103160157 3300005617 Bacteria 502
50 Ga0068864_101064854 3300005618 Unclassified 804
51 Ga0068863_101117550 3300005841 Bacteria 793
52 Ga0068863_101751495 3300005841 Bacteria 631
53 Ga0068858_100000310 3300005842 Bacteria 51909
54 Ga0068860_101939590 3300005843 Bacteria 610
55 Ga0068862_100885993 3300005844 Bacteria 876
56 Ga0081539_10010955 3300005985 Bacteria 7271
57 Ga0097621_100425903 3300006237 Bacteria 1192
58 Ga0068871_100317922 3300006358 Bacteria 1370
59 Ga0068865_100155844 3300006881 Bacteria 1737
60 Ga0068865_100164862 3300006881 Bacteria 1694
61 Ga0097620_100000153 3300006931 Bacteria 65765
62 Ga0097620_103160256 3300006931 Bacteria 502
63 Ga0111539_10361282 3300009094 Bacteria 1690
64 Ga0105245_10002745 3300009098 Bacteria 15829
65 Ga0105247_11839587 3300009101 Bacteria 505
66 Ga0105241_10483952 3300009174 Bacteria 1100
67 Ga0105248_10002210 3300009177 Bacteria 21556
68 Ga0105248_10012383 3300009177 Bacteria 9411
69 Ga0105248_10023369 3300009177 Bacteria 6867
70 Ga0105248_11676223 3300009177 Bacteria 721
71 Ga0105237_10007108 3300009545 Bacteria 12300
72 Ga0105238_10028909 3300009551 Bacteria 5647
73 Ga0105238_10278506 3300009551 Bacteria 1654
74 Ga0105238_10972090 3300009551 Bacteria 869
75 Ga0105239_11012057 3300010375 Bacteria 955
76 Ga0157347_1014018 3300012502 Bacteria 880
77 Ga0157327_1015191 3300012512 Bacteria 798
78 Ga0157373_10480100 3300013100 Bacteria 897
79 Ga0157369_10229679 3300013105 Bacteria 1940
80 Ga0157369_12196134 3300013105 Bacteria 560
81 Ga0157374_11622346 3300013296 Bacteria 671
82 Ga0157378_10676811 3300013297 Bacteria 1049
83 Ga0163162_10893196 3300013306 Bacteria 1002
84 Ga0163162_12452467 3300013306 Bacteria 600
85 Ga0157375_10580039 3300013308 Bacteria 1282
86 Ga0157375_11451585 3300013308 Bacteria 809
87 Ga0163163_12008056 3300014325 Bacteria 638
88 Ga0157380_10032290 3300014326 Bacteria 4026
89 Ga0157380_11099412 3300014326 Bacteria 834
90 Ga0157377_10195340 3300014745 Bacteria 1281
91 Ga0157379_10033058 3300014968 Bacteria 4612
92 Ga0157379_11001089 3300014968 Bacteria 797
93 Ga0163161_11199770 3300017792 Bacteria 656
94 Ga0213876_10224984 3300021384 Bacteria 997
95 Ga0209455_1011175 3300025272 Bacteria 2228
96 Ga0207697_10192566 3300025315 Bacteria 895
97 Ga0207642_10150513 3300025899 Bacteria 1238
98 Ga0207680_10015900 3300025903 Bacteria 3938
99 Ga0207647_10000447 3300025904 Bacteria 33519
100 Ga0207647_10001674 3300025904 Bacteria 17073
101 Ga0207647_10002697 3300025904 Bacteria 13405
102 Ga0207645_10089875 3300025907 Bacteria 1975
103 Ga0207645_10170429 3300025907 Bacteria 1427
104 Ga0207705_10275738 3300025909 Bacteria 1286
105 Ga0207662_10809082 3300025918 Bacteria 661
106 Ga0207681_10301557 3300025923 Bacteria 1268
107 Ga0207681_10326170 3300025923 Bacteria 1222
108 Ga0207681_10342322 3300025923 Bacteria 1195
109 Ga0207694_10044480 3300025924 Bacteria 3428
110 Ga0207694_10124281 3300025924 Bacteria 2062
111 Ga0207650_10369348 3300025925 Unclassified 1183
112 Ga0207650_10652936 3300025925 Bacteria 887
113 Ga0207650_11843267 3300025925 Bacteria 511
114 Ga0207687_10000633 3300025927 Bacteria 23726
115 Ga0207687_11138323 3300025927 Bacteria 670
116 Ga0207644_10401008 3300025931 Bacteria 1121
117 Ga0207644_10579058 3300025931 Bacteria 931
118 Ga0207644_10980162 3300025931 Bacteria 709
119 Ga0207690_10794238 3300025932 Bacteria 782
120 Ga0207690_10964060 3300025932 Bacteria 709
121 Ga0207706_10009976 3300025933 Bacteria 8706
122 Ga0207706_10015188 3300025933 Bacteria 6969
123 Ga0207706_10041532 3300025933 Bacteria 4077
124 Ga0207670_10684035 3300025936 Bacteria 848
125 Ga0207704_10121635 3300025938 Bacteria 1788
126 Ga0207711_10014495 3300025941 Bacteria 6551
127 Ga0207711_10024376 3300025941 Bacteria 5067
128 Ga0207711_10179823 3300025941 Bacteria 1923
129 Ga0207689_10119389 3300025942 Bacteria 2169
130 Ga0207679_10495521 3300025945 Bacteria 1089
131 Ga0207667_10442662 3300025949 Bacteria 1321
132 Ga0207651_10128107 3300025960 Bacteria 1938
133 Ga0207651_10507635 3300025960 Bacteria 1043
134 Ga0207668_10000239 3300025972 Bacteria 36850
135 Ga0207640_10169243 3300025981 Bacteria 1626
136 Ga0207658_10252124 3300025986 Bacteria 1500
137 Ga0207658_10313743 3300025986 Bacteria 1355
138 Ga0207658_11012262 3300025986 Bacteria 758
139 Ga0207658_11019986 3300025986 Bacteria 755
140 Ga0207677_10202468 3300026023 Bacteria 1579
141 Ga0207677_11107690 3300026023 Bacteria 722
142 Ga0207703_10000917 3300026035 Bacteria 28709
143 Ga0207639_10063168 3300026041 Bacteria 2866
144 Ga0207639_10712114 3300026041 Bacteria 932
145 Ga0207678_10008424 3300026067 Bacteria 9096
146 Ga0207678_10134889 3300026067 Bacteria 2106
147 Ga0207708_10590147 3300026075 Bacteria 940
148 Ga0207702_10807396 3300026078 Bacteria 927
149 Ga0207641_11170386 3300026088 Bacteria 768
150 Ga0207641_11458653 3300026088 Bacteria 686
151 Ga0207648_10027204 3300026089 Bacteria 5079
152 Ga0207648_10038047 3300026089 Bacteria 4235
153 Ga0207648_12208644 3300026089 Bacteria 511
154 Ga0207676_11017668 3300026095 Unclassified 817
155 Ga0207675_101990224 3300026118 Bacteria 599
156 Ga0207683_10096905 3300026121 Bacteria 2630
157 Ga0207698_10234625 3300026142 Bacteria 1668
158 Ga0207698_10433716 3300026142 Bacteria 1264
159 Ga0207698_11998784 3300026142 Bacteria 594
160 Ga0268266_10010819 3300028379 Bacteria 7948
161 Ga0268266_10022849 3300028379 Bacteria 5323
162 Ga0268265_10077424 3300028380 Bacteria 2612
163 Ga0268265_10173165 3300028380 Bacteria 1847
164 Ga0307513_10163595 3300031456 Bacteria 2113
165 Ga0307408_100223949 3300031548 Bacteria 1536
166 Ga0307408_100567224 3300031548 Bacteria 1004
167 Ga0307405_10019806 3300031731 Bacteria 3747
168 Ga0307405_10224621 3300031731 Bacteria 1380
169 Ga0307413_11606595 3300031824 Bacteria 577
170 Ga0307410_10051461 3300031852 Bacteria 2776
171 Ga0307410_10161359 3300031852 Bacteria 1680
172 Ga0307406_10601133 3300031901 Bacteria 907
173 Ga0307406_11646825 3300031901 Bacteria 568
174 Ga0307412_10017746 3300031911 Bacteria 4265
175 Ga0307412_10085577 3300031911 Bacteria 2191
176 Ga0307412_10137814 3300031911 Bacteria 1783
177 Ga0307409_100048215 3300031995 Bacteria 3239
178 Ga0307409_100079210 3300031995 Bacteria 2647
179 Ga0307409_100080119 3300031995 Bacteria 2634
180 Ga0307409_100457235 3300031995 Bacteria 1233
181 Ga0307409_100811595 3300031995 Bacteria 944
182 Ga0307416_100099542 3300032002 Bacteria 2525
183 Ga0307416_100589317 3300032002 Bacteria 1190
184 Ga0307416_102449129 3300032002 Bacteria 621
185 Ga0307414_10139851 3300032004 Bacteria 1893
186 Ga0307414_10668807 3300032004 Bacteria 937
187 Ga0307411_10013297 3300032005 Bacteria 4535
188 Ga0307411_10290364 3300032005 Bacteria 1306
189 Ga0307411_10382590 3300032005 Bacteria 1158
190 Ga0307411_10464648 3300032005 Bacteria 1062
191 Ga0307415_100118696 3300032126 Bacteria 1978
192 Ga0307415_102052574 3300032126 Bacteria 557
193 Ga0307415_102512457 3300032126 Bacteria 507
194 Ga0395899_0174962 3300037312 Bacteria 1510
195 Ga0395900_0116112 3300037418 Bacteria 2746
196 Ga0395900_1391916 3300037418 Bacteria 614
197 Ga0395898_0159792 3300037466 Bacteria 2155
198 Ga0395898_0525986 3300037466 Bacteria 1124
199 Ga0395905_0055058 3300037471 Bacteria 3723
200 Ga0395905_0056128 3300037471 Bacteria 3686
201 Ga0395905_0644073 3300037471 Bacteria 962
202 Ga0395905_0705201 3300037471 Bacteria 911
203 Ga0395905_1017836 3300037471 Bacteria 731
204 Ga0395905_1790232 3300037471 Bacteria 520
205 Ga0395901_0049660 3300038443 Bacteria 4359
206 Ga0395901_0940198 3300038443 Bacteria 844
207 Ga0436365_0931891 3300039437 Bacteria 3624
208 Ga0436363_0035718 3300039450 Bacteria 652
209 Ga0439448_0024909 3300042005 Bacteria 1874
210 Ga0450894_081364 3300042131 Bacteria 505
211 Ga0466964_0250067 3300044706 Bacteria 874
212 Ga0495650_0218217 3300046471 Bacteria 658
213 Ga0495605_0296701 3300046474 Bacteria 684
214 Ga0495643_0209079 3300046522 Bacteria 932
215 Ga0495648_0000088 3300046524 Bacteria 115109
216 Ga0495663_0044229 3300046525 Bacteria 1363
217 Ga0495663_0213273 3300046525 Bacteria 677
218 Ga0495666_0054330 3300046526 Bacteria 1921
219 Ga0495668_0008559 3300046616 Bacteria 6369
220 Ga0495669_0000269 3300046684 Bacteria 29811
221 Ga0495669_0000314 3300046684 Bacteria 26728
222 Ga0495669_0077935 3300046684 Bacteria 1518
223 Ga0495669_0317139 3300046684 Bacteria 752
224 Ga0495670_0245273 3300046691 Bacteria 954
225 Ga0495677_0043825 3300047445 Bacteria 1641
226 Ga0495677_0309133 3300047445 Bacteria 622
227 Ga0495685_123196 3300047447 Bacteria 850
228 Ga0496106_0416216 3300048909 Bacteria 1080
229 Ga0496107_0706706 3300048910 Bacteria 741
230 Ga0496111_0100847 3300048914 Bacteria 2121
231 Ga0496112_1452727 3300048915 Bacteria 600
232 Ga0496115_0382093 3300048918 Bacteria 1145
233 Ga0496118_0005641 3300048921 Bacteria 14116
234 Ga0496121_0686045 3300048924 Bacteria 619
235 Ga0496122_0290062 3300048925 Bacteria 889
236 Ga0496125_0016849 3300048928 Bacteria 7000
237 Ga0496126_0403819 3300048929 Bacteria 1108
238 Ga0501309_030307 3300049129 Bacteria 796
239 Ga0501047_0274712 3300049581 Bacteria 1531
240 Ga0501070_1044648 3300049586 Bacteria 632
241 Ga0501073_0397110 3300049589 Bacteria 953
242 Ga0501080_0244201 3300049742 Bacteria 1638
243 Ga0501268_088624 3300049765 Bacteria 649
244 nmdc:mga07m45_864966_c1 3300050496 Bacteria 517
245 nmdc:mga08y16_586766_c1 3300050511 Bacteria 1124
246 Ga0495655_0183054 3300053083 Bacteria 676
247 Ga0500658_0000051 3300053134 Bacteria 62135
248 Ga0500627_0178684 3300053158 Bacteria 955
249 Ga0466962_0383032 3300061719 Bacteria 703
250 2514049367 2513237166 Bacteria 10373764
251 2644299216 2643221653 Bacteria 4569637
252 2644657444 2643221719 Bacteria 4568197
253 2921649221 2921643360 Bacteria 11448031
254 Ga0400485_03705
255 JGI24735J21928_10051883
256 JGI24738J21930_10018260
257 rootH1_10020445
258 rootH1_10216300
259 Ga0055529_1039205
260 Ga0070658_10488348
261 Ga0070658_10606873
262 Ga0070658_11391438
263 Ga0070670_100508314
264 Ga0070670_100948523
265 Ga0068869_100169612
266 Ga0070666_10014760
267 Ga0070682_101963045
268 Ga0068868_100071951
269 Ga0068868_100780622
270 Ga0070689_100314605
271 Ga0070687_100124784
272 Ga0070661_100231258
273 Ga0070669_100056574
274 Ga0070669_100093958
275 Ga0070669_100237540
276 Ga0070674_100136413
277 Ga0070673_100237271
278 Ga0070659_100156402
279 Ga0070659_100610366
280 Ga0070659_101019438
281 Ga0070667_100164598
282 Ga0070667_100612783
283 Ga0070667_101238599
284 Ga0070663_100131988
285 Ga0070678_100143859
286 Ga0070662_100002285
287 Ga0070662_100021818
288 Ga0068867_100084970
289 Ga0068867_100153112
290 Ga0068867_100429440
291 Ga0068867_100749049
292 Ga0070685_10793985
293 Ga0068853_100100607
294 Ga0070686_100466915
295 Ga0070686_100706211
296 Ga0070665_100008625
297 Ga0070665_100110664
298 Ga0070664_100147650
299 Ga0068852_100243115
300 Ga0068852_100812476
301 Ga0068859_100000153
302 Ga0068859_103160157
303 Ga0068864_101064854
304 Ga0068863_101117550
305 Ga0068863_101751495
306 Ga0068858_100000310
307 Ga0068860_101939590
308 Ga0068862_100885993
309 Ga0081539_10010955
310 Ga0097621_100425903
311 Ga0068871_100317922
312 Ga0068865_100155844
313 Ga0068865_100164862
314 Ga0097620_100000153
315 Ga0097620_103160256
316 Ga0111539_10361282
317 Ga0105245_10002745
318 Ga0105247_11839587
319 Ga0105241_10483952
320 Ga0105248_10002210
321 Ga0105248_10012383
322 Ga0105248_10023369
323 Ga0105248_11676223
324 Ga0105237_10007108
325 Ga0105238_10028909
326 Ga0105238_10278506
327 Ga0105238_10972090
328 Ga0105239_11012057
329 Ga0157347_1014018
330 Ga0157327_1015191
331 Ga0157373_10480100
332 Ga0157369_10229679
333 Ga0157369_12196134
334 Ga0157374_11622346
335 Ga0157378_10676811
336 Ga0163162_10893196
337 Ga0163162_12452467
338 Ga0157375_10580039
339 Ga0157375_11451585
340 Ga0163163_12008056
341 Ga0157380_10032290
342 Ga0157380_11099412
343 Ga0157377_10195340
344 Ga0157379_10033058
345 Ga0157379_11001089
346 Ga0163161_11199770
347 Ga0213876_10224984
348 Ga0209455_1011175
349 Ga0207697_10192566
350 Ga0207642_10150513
351 Ga0207680_10015900
352 Ga0207647_10000447
353 Ga0207647_10001674
354 Ga0207647_10002697
355 Ga0207645_10089875
356 Ga0207645_10170429
357 Ga0207705_10275738
358 Ga0207662_10809082
359 Ga0207681_10301557
360 Ga0207681_10326170
361 Ga0207681_10342322
362 Ga0207694_10044480
363 Ga0207694_10124281
364 Ga0207650_10369348
365 Ga0207650_10652936
366 Ga0207650_11843267
367 Ga0207687_10000633
368 Ga0207687_11138323
369 Ga0207644_10401008
370 Ga0207644_10579058
371 Ga0207644_10980162
372 Ga0207690_10794238
373 Ga0207690_10964060
374 Ga0207706_10009976
375 Ga0207706_10015188
376 Ga0207706_10041532
377 Ga0207670_10684035
378 Ga0207704_10121635
379 Ga0207711_10014495
380 Ga0207711_10024376
381 Ga0207711_10179823
382 Ga0207689_10119389
383 Ga0207679_10495521
384 Ga0207667_10442662
385 Ga0207651_10128107
386 Ga0207651_10507635
387 Ga0207668_10000239
388 Ga0207640_10169243
389 Ga0207658_10252124
390 Ga0207658_10313743
391 Ga0207658_11012262
392 Ga0207658_11019986
393 Ga0207677_10202468
394 Ga0207677_11107690
395 Ga0207703_10000917
396 Ga0207639_10063168
397 Ga0207639_10712114
398 Ga0207678_10008424
399 Ga0207678_10134889
400 Ga0207708_10590147
401 Ga0207702_10807396
402 Ga0207641_11170386
403 Ga0207641_11458653
404 Ga0207648_10027204
405 Ga0207648_10038047
406 Ga0207648_12208644
407 Ga0207676_11017668
408 Ga0207675_101990224
409 Ga0207683_10096905
410 Ga0207698_10234625
411 Ga0207698_10433716
412 Ga0207698_11998784
413 Ga0268266_10010819
414 Ga0268266_10022849
415 Ga0268265_10077424
416 Ga0268265_10173165
417 Ga0307513_10163595
418 Ga0307408_100223949
419 Ga0307408_100567224
420 Ga0307405_10019806
421 Ga0307405_10224621
422 Ga0307413_11606595
423 Ga0307410_10051461
424 Ga0307410_10161359
425 Ga0307406_10601133
426 Ga0307406_11646825
427 Ga0307412_10017746
428 Ga0307412_10085577
429 Ga0307412_10137814
430 Ga0307409_100048215
431 Ga0307409_100079210
432 Ga0307409_100080119
433 Ga0307409_100457235
434 Ga0307409_100811595
435 Ga0307416_100099542
436 Ga0307416_100589317
437 Ga0307416_102449129
438 Ga0307414_10139851
439 Ga0307414_10668807
440 Ga0307411_10013297
441 Ga0307411_10290364
442 Ga0307411_10382590
443 Ga0307411_10464648
444 Ga0307415_100118696
445 Ga0307415_102052574
446 Ga0307415_102512457
447 Ga0395899_0174962
448 Ga0395900_0116112
449 Ga0395900_1391916
450 Ga0395898_0159792
451 Ga0395898_0525986
452 Ga0395905_0055058
453 Ga0395905_0056128
454 Ga0395905_0644073
455 Ga0395905_0705201
456 Ga0395905_1017836
457 Ga0395905_1790232
458 Ga0395901_0049660
459 Ga0395901_0940198
460 Ga0436365_0931891
461 Ga0436363_0035718
462 Ga0439448_0024909
463 Ga0450894_081364
464 Ga0466964_0250067
465 Ga0495650_0218217
466 Ga0495605_0296701
467 Ga0495643_0209079
468 Ga0495648_0000088
469 Ga0495663_0044229
470 Ga0495663_0213273
471 Ga0495666_0054330
472 Ga0495668_0008559
473 Ga0495669_0000269
474 Ga0495669_0000314
475 Ga0495669_0077935
476 Ga0495669_0317139
477 Ga0495670_0245273
478 Ga0495677_0043825
479 Ga0495677_0309133
480 Ga0495685_123196
481 Ga0496106_0416216
482 Ga0496107_0706706
483 Ga0496111_0100847
484 Ga0496112_1452727
485 Ga0496115_0382093
486 Ga0496118_0005641
487 Ga0496121_0686045
488 Ga0496122_0290062
489 Ga0496125_0016849
490 Ga0496126_0403819
491 Ga0501309_030307
492 Ga0501047_0274712
493 Ga0501070_1044648
494 Ga0501073_0397110
495 Ga0501080_0244201
496 Ga0501268_088624
497 nmdc:mga07m45_864966_c1
498 nmdc:mga08y16_586766_c1
499 Ga0495655_0183054
500 Ga0500658_0000051
501 Ga0500627_0178684
502 Ga0466962_0383032
503 2514049367
504 2644299216
505 2644657444
506 2921649221

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10048

DUF2282

Predicted integral membrane protein (DUF2282)

35

83

0.9

Map