F364234

General Info

Members Datasets Scaffolds Average Seq Length
253 174 240 396

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0124865|Ga0395900_0124865_1236_2573
Length 445
Sequence MTCPGLAGEHWTISPPAVSSALPTAEAEAEGARMLFVGDDWAEDHHDIEVQDEGGRRLARARLPEGIAGLSRLHELLAEHLTDDDVDPETGFVAQNVIIGIETDRGTWVSALVAAGYQVFPLNPVQVARYRERHGASGAKSDRGDAHVLAEIVRLDRAHHRAIAGDSPQVEGLKLVARAHQAFIWDRTRHFQRLRSALREFFPAALEAFPNLLAPEALELLERAPEPARAARLSRSKITAALTRAHRRDPDTKAAAIQAVLRAPALRQDPAIEAAYAVIVASAVRLIAQLNMQIGELQAVVAEGFGRHPDAEILTSQPGLGPVLGARVLAEFGDDPTRYADAKARKNYAGTSPITRASGTRRIVLARYARNKHLADATHQWAFCALTASPGARAYYDSIRARGAGHHAALRQLGNRLVGILHGCLKSRTLYRENTAWPQPNATAA

Samples

Sample ID Description Type Environment
1 2527291627 Frankia casuarinae Thr Isolate Nodule
2 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
3 2626541554 Frankia sp. AvcI.1 Isolate Nodule
4 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
5 2710264753 Frankia sp. KB5 Isolate Nodule
6 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
7 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
91 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
92 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
102 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
103 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
104 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
105 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
106 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
107 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
108 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 637000116 Frankia casuarinae CcI3 Isolate Nodule
173 8002775197 Frankia nepalensis CN7 Isolate Nodule
174 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.86
Metatranscriptomes 0
Isolates 5.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 3.95
Rhizoplane 5.93
Rhizosphere 86.96
Stem 0
Stem Tuber 0
Unclassified 3.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10016079 3300002077 Bacteria 1491
2 JGI25406J46586_10037894 3300003203 Bacteria 1733
3 JGI25406J46586_10043878 3300003203 Bacteria 1552
4 JGI25407J50210_10011509 3300003373 Bacteria 2261
5 JGI25407J50210_10021547 3300003373 Bacteria 1675
6 Ga0070683_100108545 3300005329 Bacteria 2617
7 Ga0070683_100208504 3300005329 Bacteria 1856
8 Ga0070682_100090884 3300005337 Bacteria 1997
9 Ga0070687_100071362 3300005343 Bacteria 1866
10 Ga0070687_100142306 3300005343 Bacteria 1398
11 Ga0070661_100150343 3300005344 Bacteria 1760
12 Ga0070674_100189858 3300005356 Bacteria 1580
13 Ga0070659_100024774 3300005366 Bacteria 4602
14 Ga0070659_100111690 3300005366 Bacteria 2207
15 Ga0070699_100080119 3300005518 Bacteria 2846
16 Ga0070684_100094841 3300005535 Bacteria 2658
17 Ga0070684_100161387 3300005535 Bacteria 2033
18 Ga0068853_100230040 3300005539 Bacteria 1696
19 Ga0070686_100177467 3300005544 Bacteria 1511
20 Ga0070664_100146471 3300005564 Bacteria 2083
21 Ga0068857_100354448 3300005577 Bacteria 1359
22 Ga0068852_100270704 3300005616 Bacteria 1634
23 Ga0068859_100005933 3300005617 Bacteria 12397
24 Ga0068864_100166691 3300005618 Bacteria 2006
25 Ga0068863_100002463 3300005841 Bacteria 18392
26 Ga0068863_100323002 3300005841 Bacteria 1499
27 Ga0068858_100008280 3300005842 Bacteria 9997
28 Ga0081538_10002500 3300005981 Bacteria 17909
29 Ga0081539_10011126 3300005985 Bacteria 7182
30 Ga0081539_10033894 3300005985 Bacteria 3100
31 Ga0097621_100199958 3300006237 Bacteria 1734
32 Ga0075428_100010380 3300006844 Bacteria 10342
33 Ga0075428_100086391 3300006844 Bacteria 3421
34 Ga0075428_100118850 3300006844 Bacteria 2878
35 Ga0075428_100222440 3300006844 Bacteria 2038
36 Ga0075428_100340532 3300006844 Bacteria 1610
37 Ga0075430_100131586 3300006846 Bacteria 2085
38 Ga0075430_100131969 3300006846 Bacteria 2082
39 Ga0075430_100136429 3300006846 Unclassified 2044
40 Ga0075430_100239863 3300006846 Bacteria 1502
41 Ga0075431_100204259 3300006847 Bacteria 2020
42 Ga0075431_100273738 3300006847 Bacteria 1710
43 Ga0075431_100299128 3300006847 Bacteria 1626
44 Ga0075431_100349337 3300006847 Bacteria 1487
45 Ga0075433_10141586 3300006852 Bacteria 2137
46 Ga0075434_100010329 3300006871 Bacteria 8751
47 Ga0075429_100204900 3300006880 Bacteria 1728
48 Ga0075436_100083274 3300006914 Bacteria 2219
49 Ga0097620_100005933 3300006931 Bacteria 12397
50 Ga0075435_100042124 3300007076 Bacteria 3651
51 Ga0105245_10141737 3300009098 Bacteria 2264
52 Ga0105247_10000667 3300009101 Bacteria 27076
53 Ga0114129_10004050 3300009147 Bacteria 20684
54 Ga0114129_10151433 3300009147 Bacteria 3174
55 Ga0114129_10340036 3300009147 Bacteria 1991
56 Ga0105243_10302631 3300009148 Bacteria 1450
57 Ga0105242_10118594 3300009176 Bacteria 2267
58 Ga0105248_10020853 3300009177 Bacteria 7261
59 Ga0105237_10233667 3300009545 Bacteria 1839
60 Ga0105238_10226599 3300009551 Bacteria 1846
61 Ga0105249_10400456 3300009553 Bacteria 1403
62 Ga0105239_10144948 3300010375 Bacteria 2648
63 Ga0105239_10314802 3300010375 Bacteria 1764
64 Ga0157369_10226598 3300013105 Bacteria 1955
65 Ga0157369_10308856 3300013105 Bacteria 1645
66 Ga0163162_10097063 3300013306 Bacteria 3035
67 Ga0163162_10432571 3300013306 Unclassified 1448
68 Ga0157372_10457381 3300013307 Bacteria 1488
69 Ga0157379_10077907 3300014968 Bacteria 2968
70 Ga0157379_10204702 3300014968 Bacteria 1785
71 Ga0207642_10073266 3300025899 Bacteria 1637
72 Ga0207710_10001611 3300025900 Bacteria 11044
73 Ga0207688_10041972 3300025901 Bacteria 2546
74 Ga0207688_10092577 3300025901 Bacteria 1737
75 Ga0207647_10057520 3300025904 Bacteria 2384
76 Ga0207685_10047733 3300025905 Bacteria 1636
77 Ga0207643_10031642 3300025908 Bacteria 2951
78 Ga0207662_10089241 3300025918 Bacteria 1894
79 Ga0207662_10093449 3300025918 Bacteria 1853
80 Ga0207649_10130406 3300025920 Bacteria 1707
81 Ga0207690_10035745 3300025932 Bacteria 3212
82 Ga0207690_10083705 3300025932 Bacteria 2234
83 Ga0207686_10085456 3300025934 Bacteria 2070
84 Ga0207709_10126168 3300025935 Bacteria 1736
85 Ga0207709_10170398 3300025935 Bacteria 1527
86 Ga0207669_10082060 3300025937 Bacteria 2068
87 Ga0207691_10170719 3300025940 Bacteria 1904
88 Ga0207691_10195923 3300025940 Bacteria 1760
89 Ga0207711_10000079 3300025941 Bacteria 104006
90 Ga0207711_10007677 3300025941 Bacteria 9018
91 Ga0207711_10035420 3300025941 Bacteria 4230
92 Ga0207661_10106064 3300025944 Bacteria 2368
93 Ga0207679_10202090 3300025945 Bacteria 1660
94 Ga0207712_10283471 3300025961 Unclassified 1353
95 Ga0207678_10084595 3300026067 Bacteria 2712
96 Ga0207702_10098807 3300026078 Bacteria 2572
97 Ga0207641_10003334 3300026088 Bacteria 14277
98 Ga0207641_10038836 3300026088 Bacteria 3980
99 Ga0207641_10248717 3300026088 Bacteria 1659
100 Ga0207676_10262036 3300026095 Bacteria 1561
101 Ga0207676_10315026 3300026095 Bacteria 1434
102 Ga0207675_100224369 3300026118 Bacteria 1811
103 Ga0207698_10166912 3300026142 Bacteria 1933
104 Ga0307513_10062798 3300031456 Bacteria 3924
105 Ga0307408_100080131 3300031548 Bacteria 2438
106 Ga0307405_10099369 3300031731 Bacteria 1947
107 Ga0307413_10063832 3300031824 Bacteria 2285
108 Ga0307413_10113099 3300031824 Bacteria 1821
109 Ga0307413_10148564 3300031824 Bacteria 1630
110 Ga0307410_10031831 3300031852 Bacteria 3389
111 Ga0307410_10155892 3300031852 Bacteria 1705
112 Ga0326468_10002052 3300031889 Bacteria 1681
113 Ga0307406_10117238 3300031901 Bacteria 1844
114 Ga0307406_10140320 3300031901 Bacteria 1709
115 Ga0307406_10162378 3300031901 Bacteria 1607
116 Ga0307406_10175141 3300031901 Bacteria 1556
117 Ga0307407_10091056 3300031903 Bacteria 1869
118 Ga0307409_100025202 3300031995 Bacteria 4166
119 Ga0307409_100051453 3300031995 Bacteria 3152
120 Ga0307409_100056774 3300031995 Bacteria 3029
121 Ga0307409_100282404 3300031995 Bacteria 1535
122 Ga0307409_100302206 3300031995 Bacteria 1489
123 Ga0307416_100047355 3300032002 Bacteria 3402
124 Ga0307416_100348008 3300032002 Bacteria 1498
125 Ga0307416_100449435 3300032002 Bacteria 1341
126 Ga0307414_10136910 3300032004 Bacteria 1911
127 Ga0307411_10114387 3300032005 Bacteria 1938
128 Ga0307411_10159758 3300032005 Bacteria 1686
129 Ga0307415_100080958 3300032126 Bacteria 2318
130 Ga0307415_100105248 3300032126 Bacteria 2080
131 Ga0373930_0003053 3300034816 Bacteria 2635
132 Ga0373950_0014664 3300034818 Bacteria 1321
133 Ga0373961_0020927 3300035241 Bacteria 1735
134 Ga0373931_0085170 3300035691 Bacteria 1751
135 Ga0373925_0006238 3300037068 Bacteria 8794
136 Ga0395900_0124865 3300037418 Bacteria 2639
137 Ga0395900_0128364 3300037418 Bacteria 2599
138 Ga0395900_0241670 3300037418 Bacteria 1811
139 Ga0395898_0087652 3300037466 Bacteria 2998
140 Ga0395898_0251559 3300037466 Bacteria 1685
141 Ga0395905_0232887 3300037471 Bacteria 1722
142 Ga0395901_0060774 3300038443 Bacteria 3932
143 Ga0395901_0120121 3300038443 Bacteria 2762
144 Ga0395901_0151196 3300038443 Bacteria 2439
145 Ga0395901_0319974 3300038443 Bacteria 1605
146 Ga0395901_0410250 3300038443 Bacteria 1391
147 Ga0439448_0066387 3300042005 Bacteria 1197
148 Ga0439449_0041502 3300042007 Bacteria 1710
149 Ga0439450_000897 3300042008 Bacteria 4129
150 Ga0439450_013533 3300042008 Bacteria 1641
151 Ga0439450_013782 3300042008 Bacteria 1629
152 Ga0450902_009773 3300042137 Bacteria 1514
153 Ga0450905_004429 3300042142 Bacteria 1864
154 Ga0439444_0000168 3300042437 Bacteria 5950
155 Ga0439459_0012866 3300042438 Bacteria 1497
156 Ga0439464_0006112 3300042439 Bacteria 3129
157 Ga0450916_001925 3300042530 Bacteria 2136
158 Ga0439440_0000864 3300042993 Bacteria 5290
159 Ga0466966_0053637 3300044684 Bacteria 2557
160 Ga0466966_0081617 3300044684 Bacteria 2013
161 Ga0466961_0117709 3300044693 Bacteria 1669
162 Ga0466963_0094040 3300044694 Bacteria 2044
163 Ga0466964_0012025 3300044706 Bacteria 3273
164 Ga0466971_0068678 3300044719 Bacteria 1607
165 Ga0466957_0047196 3300044842 Bacteria 2616
166 Ga0466957_0071744 3300044842 Bacteria 2142
167 Ga0466957_0103233 3300044842 Bacteria 1800
168 Ga0466959_0084127 3300045049 Bacteria 2290
169 Ga0466967_0011238 3300045976 Bacteria 6766
170 Ga0466967_0033060 3300045976 Bacteria 4376
171 Ga0466967_0061174 3300045976 Bacteria 3340
172 Ga0466967_0086898 3300045976 Bacteria 2834
173 Ga0466967_0149572 3300045976 Bacteria 2181
174 Ga0495627_043313 3300046453 Bacteria 1377
175 Ga0495592_0166117 3300046454 Bacteria 1514
176 Ga0495603_0120277 3300046455 Bacteria 1530
177 Ga0495651_0138459 3300046462 Bacteria 1768
178 Ga0495580_0163418 3300046472 Bacteria 1540
179 Ga0495582_0079572 3300046473 Bacteria 1819
180 Ga0495639_0042485 3300046475 Bacteria 2050
181 Ga0495584_0075809 3300046491 Bacteria 1691
182 Ga0495594_0087533 3300046499 Bacteria 1743
183 Ga0495596_0050305 3300046500 Bacteria 1633
184 Ga0495608_0089342 3300046511 Bacteria 1994
185 Ga0495631_0074159 3300046518 Bacteria 1469
186 Ga0495644_0036751 3300046523 Bacteria 1847
187 Ga0495663_0021384 3300046525 Bacteria 1863
188 Ga0495640_0080301 3300046533 Bacteria 2169
189 Ga0495587_0009950 3300046536 Bacteria 6070
190 Ga0495598_0013551 3300046537 Bacteria 2023
191 Ga0495609_0067092 3300046538 Bacteria 1580
192 Ga0495633_0074269 3300046558 Bacteria 1584
193 Ga0495667_0085492 3300046559 Bacteria 2047
194 Ga0495656_0036405 3300046615 Bacteria 2027
195 Ga0495656_0047502 3300046615 Bacteria 1820
196 Ga0495668_0085460 3300046616 Bacteria 1730
197 Ga0495611_0073177 3300046648 Bacteria 1568
198 Ga0495635_0105745 3300046663 Bacteria 1923
199 Ga0495659_0041538 3300046664 Bacteria 1643
200 Ga0495661_0106543 3300046665 Bacteria 1568
201 Ga0495588_0089792 3300046674 Bacteria 1609
202 Ga0495657_0107182 3300046675 Bacteria 1773
203 Ga0495658_0080329 3300046683 Bacteria 1912
204 Ga0495670_0072161 3300046691 Bacteria 1748
205 Ga0495636_0058074 3300047318 Bacteria 1631
206 Ga0495676_0135643 3300047321 Bacteria 1770
207 Ga0495677_0047666 3300047445 Bacteria 1573
208 Ga0495684_0179455 3300047471 Bacteria 1570
209 Ga0495602_0177514 3300048088 Bacteria 1646
210 Ga0495615_0026455 3300048090 Bacteria 1355
211 Ga0496102_0174741 3300048905 Bacteria 2022
212 Ga0496103_0211222 3300048906 Bacteria 1248
213 Ga0496104_0249135 3300048907 Bacteria 1689
214 Ga0496104_0268758 3300048907 Bacteria 1618
215 Ga0496108_0022931 3300048911 Bacteria 5137
216 Ga0496109_0048178 3300048912 Bacteria 3877
217 Ga0496110_0209227 3300048913 Bacteria 1773
218 Ga0496110_0236966 3300048913 Bacteria 1660
219 Ga0496111_0108926 3300048914 Bacteria 2039
220 Ga0496111_0193678 3300048914 Bacteria 1511
221 Ga0496112_0157806 3300048915 Bacteria 2235
222 Ga0496112_0263079 3300048915 Bacteria 1674
223 Ga0496113_0099673 3300048916 Bacteria 2250
224 Ga0496114_0270116 3300048917 Bacteria 1498
225 Ga0496116_0082802 3300048919 Bacteria 1983
226 Ga0496117_0051343 3300048920 Bacteria 2916
227 Ga0496117_0092305 3300048920 Bacteria 1945
228 Ga0496118_0008483 3300048921 Bacteria 10611
229 Ga0496118_0019610 3300048921 Bacteria 6038
230 Ga0501040_0136467 3300049576 Bacteria 1727
231 nmdc:mga05p37_5536_c2 3300050507 Bacteria 13840
232 nmdc:mga05p37_89241_c1 3300050507 Bacteria 3799
233 nmdc:mga0qj67_107307_c1 3300050509 Bacteria 2252
234 nmdc:mga0qj67_111798_c1 3300050509 Unclassified 2206
235 nmdc:mga0qj67_3111_c1 3300050509 Bacteria 11936
236 nmdc:mga06r32_226759_c1 3300050510 Bacteria 1857
237 nmdc:mga06r32_295287_c1 3300050510 Bacteria 1607
238 nmdc:mga0n895_100075_c1 3300050512 Bacteria 2908
239 Ga0495619_0112522 3300053085 Bacteria 1861
240 Ga0495619_0145726 3300053085 Bacteria 1632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10004050 Ga0114129_100040503 327
2 3300042008 Ga0439450_013533 Ga0439450_013533_372_1592 327
3 3300042137 Ga0450902_009773 Ga0450902_009773_83_1303 327
4 3300042142 Ga0450905_004429 Ga0450905_004429_157_1377 327
5 3300042439 Ga0439464_0006112 Ga0439464_0006112_1215_2435 327
6 3300042530 Ga0450916_001925 Ga0450916_001925_852_2072 327
7 3300003373 JGI25407J50210_10011509 JGI25407J50210_100115091 341
8 3300003373 JGI25407J50210_10021547 JGI25407J50210_100215471 341
9 3300005981 Ga0081538_10002500 Ga0081538_100025009 341
10 3300048090 Ga0495615_0026455 Ga0495615_0026455_270_1334 354
11 3300046536 Ga0495587_0009950 Ga0495587_0009950_3236_4408 356
12 3300047471 Ga0495684_0179455 Ga0495684_0179455_210_1466 356
13 3300050507 nmdc:mga05p37_5536_c2 nmdc:mga05p37_5536_c2_4451_5527 357
14 3300048913 Ga0496110_0209227 Ga0496110_0209227_536_1648 359
15 3300048914 Ga0496111_0108926 Ga0496111_0108926_352_1464 359
16 3300005841 Ga0068863_100002463 Ga0068863_1000024632 360
17 3300026088 Ga0207641_10003334 Ga0207641_1000333414 360
18 3300048907 Ga0496104_0268758 Ga0496104_0268758_125_1345 361
19 3300048912 Ga0496109_0048178 Ga0496109_0048178_577_1797 361
20 3300048913 Ga0496110_0236966 Ga0496110_0236966_163_1383 361
21 3300048914 Ga0496111_0193678 Ga0496111_0193678_254_1474 361
22 3300048915 Ga0496112_0263079 Ga0496112_0263079_93_1313 361
23 3300048916 Ga0496113_0099673 Ga0496113_0099673_477_1697 361
24 iso_pu_bacteria 8002775197 8002780887 361
25 3300025905 Ga0207685_10047733 Ga0207685_100477331 362
26 3300038443 Ga0395901_0410250 Ga0395901_0410250_266_1378 362
27 3300048907 Ga0496104_0249135 Ga0496104_0249135_282_1508 363
28 3300048911 Ga0496108_0022931 Ga0496108_0022931_2440_3654 363
29 3300048917 Ga0496114_0270116 Ga0496114_0270116_21_1247 363
30 3300044693 Ga0466961_0117709 Ga0466961_0117709_424_1623 364
31 3300046558 Ga0495633_0074269 Ga0495633_0074269_402_1520 364
32 3300006847 Ga0075431_100349337 Ga0075431_1003493371 370
33 3300026067 Ga0207678_10084595 Ga0207678_100845952 370
34 3300042005 Ga0439448_0066387 Ga0439448_0066387_30_1142 370
35 3300044842 Ga0466957_0103233 Ga0466957_0103233_328_1554 370
36 3300046615 Ga0495656_0036405 Ga0495656_0036405_209_1546 370
37 3300048906 Ga0496103_0211222 Ga0496103_0211222_10_1191 370
38 3300050510 nmdc:mga06r32_295287_c1 nmdc:mga06r32_295287_c1_162_1400 370
39 3300006844 Ga0075428_100118850 Ga0075428_1001188502 372
40 3300006846 Ga0075430_100239863 Ga0075430_1002398631 372
41 3300006847 Ga0075431_100273738 Ga0075431_1002737382 372
42 3300006880 Ga0075429_100204900 Ga0075429_1002049002 372
43 3300009177 Ga0105248_10020853 Ga0105248_100208539 372
44 3300025941 Ga0207711_10007677 Ga0207711_100076771 372
45 3300047318 Ga0495636_0058074 Ga0495636_0058074_126_1463 372
46 3300050509 nmdc:mga0qj67_3111_c1 nmdc:mga0qj67_3111_c1_10679_11908 372
47 3300050510 nmdc:mga06r32_226759_c1 nmdc:mga06r32_226759_c1_508_1737 372
48 3300046455 Ga0495603_0120277 Ga0495603_0120277_44_1282 375
49 3300046472 Ga0495580_0163418 Ga0495580_0163418_39_1277 375
50 3300046499 Ga0495594_0087533 Ga0495594_0087533_396_1634 375
51 3300047321 Ga0495676_0135643 Ga0495676_0135643_484_1722 375
52 3300044684 Ga0466966_0053637 Ga0466966_0053637_563_1801 376
53 3300031901 Ga0307406_10117238 Ga0307406_101172381 377
54 3300032002 Ga0307416_100449435 Ga0307416_1004494351 377
55 3300044719 Ga0466971_0068678 Ga0466971_0068678_288_1526 377
56 3300044842 Ga0466957_0071744 Ga0466957_0071744_208_1446 377
57 3300005518 Ga0070699_100080119 Ga0070699_1000801191 378
58 3300005535 Ga0070684_100161387 Ga0070684_1001613872 378
59 3300037418 Ga0395900_0128364 Ga0395900_0128364_1121_2350 378
60 3300038443 Ga0395901_0060774 Ga0395901_0060774_1188_2417 378
61 3300044842 Ga0466957_0047196 Ga0466957_0047196_1076_2299 378
62 3300045976 Ga0466967_0149572 Ga0466967_0149572_779_2002 378
63 3300053085 Ga0495619_0145726 Ga0495619_0145726_81_1310 379
64 3300042008 Ga0439450_013782 Ga0439450_013782_109_1338 380
65 3300042993 Ga0439440_0000864 Ga0439440_0000864_977_2206 380
66 3300049576 Ga0501040_0136467 Ga0501040_0136467_323_1552 380
67 3300031548 Ga0307408_100080131 Ga0307408_1000801312 382
68 3300031731 Ga0307405_10099369 Ga0307405_100993691 382
69 3300031824 Ga0307413_10063832 Ga0307413_100638323 382
70 3300031901 Ga0307406_10175141 Ga0307406_101751411 382
71 3300031995 Ga0307409_100025202 Ga0307409_1000252024 382
72 3300032002 Ga0307416_100047355 Ga0307416_1000473553 382
73 3300032004 Ga0307414_10136910 Ga0307414_101369102 382
74 3300032005 Ga0307411_10114387 Ga0307411_101143872 382
75 3300032126 Ga0307415_100105248 Ga0307415_1001052481 382
76 3300045976 Ga0466967_0061174 Ga0466967_0061174_1016_2254 382
77 3300031889 Ga0326468_10002052 Ga0326468_100020521 383
78 iso_pu_bacteria 2687453743 2689996587 383
79 3300048905 Ga0496102_0174741 Ga0496102_0174741_384_1607 384
80 3300048919 Ga0496116_0082802 Ga0496116_0082802_353_1576 384
81 3300048920 Ga0496117_0092305 Ga0496117_0092305_304_1527 384
82 3300048921 Ga0496118_0019610 Ga0496118_0019610_4565_5788 384
83 3300032002 Ga0307416_100348008 Ga0307416_1003480081 385
84 3300046462 Ga0495651_0138459 Ga0495651_0138459_68_1291 386
85 3300046511 Ga0495608_0089342 Ga0495608_0089342_507_1730 386
86 3300046533 Ga0495640_0080301 Ga0495640_0080301_492_1715 386
87 3300046559 Ga0495667_0085492 Ga0495667_0085492_471_1694 386
88 3300046663 Ga0495635_0105745 Ga0495635_0105745_472_1695 386
89 3300046675 Ga0495657_0107182 Ga0495657_0107182_50_1273 386
90 3300046683 Ga0495658_0080329 Ga0495658_0080329_466_1689 386
91 3300048088 Ga0495602_0177514 Ga0495602_0177514_381_1604 386
92 3300053085 Ga0495619_0112522 Ga0495619_0112522_415_1638 386
93 3300003203 JGI25406J46586_10037894 JGI25406J46586_100378942 387
94 3300005985 Ga0081539_10033894 Ga0081539_100338942 387
95 3300005618 Ga0068864_100166691 Ga0068864_1001666912 388
96 3300006237 Ga0097621_100199958 Ga0097621_1001999581 388
97 3300026088 Ga0207641_10248717 Ga0207641_102487171 388
98 3300026095 Ga0207676_10262036 Ga0207676_102620361 388
99 3300025900 Ga0207710_10001611 Ga0207710_100016118 389
100 3300025941 Ga0207711_10035420 Ga0207711_100354202 389
101 3300013306 Ga0163162_10097063 Ga0163162_100970634 390
102 3300044684 Ga0466966_0081617 Ga0466966_0081617_424_1743 390
103 3300046537 Ga0495598_0013551 Ga0495598_0013551_453_1679 390
104 3300005617 Ga0068859_100005933 Ga0068859_1000059333 393
105 3300005841 Ga0068863_100323002 Ga0068863_1003230021 393
106 3300006931 Ga0097620_100005933 Ga0097620_10000593310 393
107 3300014968 Ga0157379_10077907 Ga0157379_100779072 393
108 3300025961 Ga0207712_10283471 Ga0207712_102834711 393
109 3300026088 Ga0207641_10038836 Ga0207641_100388363 393
110 3300005842 Ga0068858_100008280 Ga0068858_1000082807 395
111 3300042437 Ga0439444_0000168 Ga0439444_0000168_843_2141 395
112 3300025941 Ga0207711_10000079 Ga0207711_100000799 396
113 3300048920 Ga0496117_0051343 Ga0496117_0051343_1147_2379 396
114 3300048921 Ga0496118_0008483 Ga0496118_0008483_5308_6540 396
115 iso_pu_bacteria 2996221748 2996226995 399
116 3300031995 Ga0307409_100302206 Ga0307409_1003022061 400
117 3300046491 Ga0495584_0075809 Ga0495584_0075809_396_1622 400
118 3300046500 Ga0495596_0050305 Ga0495596_0050305_47_1273 400
119 3300046518 Ga0495631_0074159 Ga0495631_0074159_81_1307 400
120 3300046523 Ga0495644_0036751 Ga0495644_0036751_201_1427 400
121 3300046525 Ga0495663_0021384 Ga0495663_0021384_284_1510 400
122 3300046538 Ga0495609_0067092 Ga0495609_0067092_302_1528 400
123 3300046615 Ga0495656_0047502 Ga0495656_0047502_309_1535 400
124 3300046648 Ga0495611_0073177 Ga0495611_0073177_51_1277 400
125 3300046664 Ga0495659_0041538 Ga0495659_0041538_134_1360 400
126 3300046665 Ga0495661_0106543 Ga0495661_0106543_113_1339 400
127 3300046691 Ga0495670_0072161 Ga0495670_0072161_465_1691 400
128 3300047445 Ga0495677_0047666 Ga0495677_0047666_262_1488 400
129 3300013307 Ga0157372_10457381 Ga0157372_104573811 402
130 3300006844 Ga0075428_100010380 Ga0075428_1000103804 403
131 3300031995 Ga0307409_100282404 Ga0307409_1002824041 403
132 3300042008 Ga0439450_000897 Ga0439450_000897_2360_3571 403
133 3300046473 Ga0495582_0079572 Ga0495582_0079572_524_1750 403
134 3300046475 Ga0495639_0042485 Ga0495639_0042485_605_1831 403
135 3300046674 Ga0495588_0089792 Ga0495588_0089792_83_1309 403
136 iso_pu_bacteria 2527291627 2528206994 403
137 iso_pu_bacteria 2546825537 2546951773 403
138 iso_pu_bacteria 2710264753 2710606490 403
139 iso_pu_bacteria 2895880812 2895889519 403
140 iso_pu_bacteria 637000116 637878349 403
141 iso_pu_bacteria 8002775197 8002780724 403
142 iso_pu_bacteria 8002784119 8002788045 403
143 3300005329 Ga0070683_100108545 Ga0070683_1001085452 404
144 3300005337 Ga0070682_100090884 Ga0070682_1000908841 404
145 3300005343 Ga0070687_100071362 Ga0070687_1000713621 404
146 3300005344 Ga0070661_100150343 Ga0070661_1001503432 404
147 3300005356 Ga0070674_100189858 Ga0070674_1001898581 404
148 3300005366 Ga0070659_100024774 Ga0070659_1000247743 404
149 3300005366 Ga0070659_100111690 Ga0070659_1001116902 404
150 3300005535 Ga0070684_100094841 Ga0070684_1000948413 404
151 3300005539 Ga0068853_100230040 Ga0068853_1002300401 404
152 3300005544 Ga0070686_100177467 Ga0070686_1001774671 404
153 3300005564 Ga0070664_100146471 Ga0070664_1001464712 404
154 3300005616 Ga0068852_100270704 Ga0068852_1002707041 404
155 3300006852 Ga0075433_10141586 Ga0075433_101415863 404
156 3300006871 Ga0075434_100010329 Ga0075434_1000103292 404
157 3300006914 Ga0075436_100083274 Ga0075436_1000832742 404
158 3300007076 Ga0075435_100042124 Ga0075435_1000421242 404
159 3300009176 Ga0105242_10118594 Ga0105242_101185943 404
160 3300009545 Ga0105237_10233667 Ga0105237_102336672 404
161 3300009551 Ga0105238_10226599 Ga0105238_102265991 404
162 3300009553 Ga0105249_10400456 Ga0105249_104004561 404
163 3300010375 Ga0105239_10314802 Ga0105239_103148022 404
164 3300013306 Ga0163162_10432571 Ga0163162_104325712 404
165 3300014968 Ga0157379_10204702 Ga0157379_102047022 404
166 3300025899 Ga0207642_10073266 Ga0207642_100732661 404
167 3300025901 Ga0207688_10041972 Ga0207688_100419721 404
168 3300025904 Ga0207647_10057520 Ga0207647_100575201 404
169 3300025918 Ga0207662_10089241 Ga0207662_100892411 404
170 3300025920 Ga0207649_10130406 Ga0207649_101304062 404
171 3300025932 Ga0207690_10035745 Ga0207690_100357454 404
172 3300025932 Ga0207690_10083705 Ga0207690_100837052 404
173 3300025934 Ga0207686_10085456 Ga0207686_100854561 404
174 3300025935 Ga0207709_10126168 Ga0207709_101261681 404
175 3300025940 Ga0207691_10195923 Ga0207691_101959232 404
176 3300025944 Ga0207661_10106064 Ga0207661_101060641 404
177 3300025945 Ga0207679_10202090 Ga0207679_102020901 404
178 3300026095 Ga0207676_10315026 Ga0207676_103150261 404
179 3300026118 Ga0207675_100224369 Ga0207675_1002243692 404
180 3300026142 Ga0207698_10166912 Ga0207698_101669121 404
181 3300031824 Ga0307413_10113099 Ga0307413_101130991 404
182 3300031852 Ga0307410_10031831 Ga0307410_100318311 404
183 3300031852 Ga0307410_10155892 Ga0307410_101558921 404
184 3300031901 Ga0307406_10140320 Ga0307406_101403201 404
185 3300031901 Ga0307406_10162378 Ga0307406_101623781 404
186 3300031903 Ga0307407_10091056 Ga0307407_100910561 404
187 3300031995 Ga0307409_100051453 Ga0307409_1000514534 404
188 3300031995 Ga0307409_100056774 Ga0307409_1000567741 404
189 3300032005 Ga0307411_10159758 Ga0307411_101597581 404
190 3300032126 Ga0307415_100080958 Ga0307415_1000809582 404
191 3300034816 Ga0373930_0003053 Ga0373930_0003053_311_1534 404
192 3300034818 Ga0373950_0014664 Ga0373950_0014664_77_1300 404
193 3300035241 Ga0373961_0020927 Ga0373961_0020927_116_1339 404
194 3300035691 Ga0373931_0085170 Ga0373931_0085170_413_1636 404
195 3300037068 Ga0373925_0006238 Ga0373925_0006238_6376_7614 404
196 3300037418 Ga0395900_0124865 Ga0395900_0124865_1236_2573 404
197 3300037466 Ga0395898_0087652 Ga0395898_0087652_1170_2507 404
198 3300038443 Ga0395901_0120121 Ga0395901_0120121_1388_2668 404
199 3300038443 Ga0395901_0151196 Ga0395901_0151196_1001_2338 404
200 3300042007 Ga0439449_0041502 Ga0439449_0041502_383_1621 404
201 3300042438 Ga0439459_0012866 Ga0439459_0012866_54_1292 404
202 3300044706 Ga0466964_0012025 Ga0466964_0012025_500_1738 404
203 3300045049 Ga0466959_0084127 Ga0466959_0084127_742_1980 404
204 3300045976 Ga0466967_0011238 Ga0466967_0011238_5498_6736 404
205 3300045976 Ga0466967_0086898 Ga0466967_0086898_92_1330 404
206 3300048915 Ga0496112_0157806 Ga0496112_0157806_852_2090 404
207 3300050512 nmdc:mga0n895_100075_c1 nmdc:mga0n895_100075_c1_246_1469 404
208 3300009098 Ga0105245_10141737 Ga0105245_101417371 405
209 3300010375 Ga0105239_10144948 Ga0105239_101449482 405
210 3300013105 Ga0157369_10226598 Ga0157369_102265982 405
211 3300026078 Ga0207702_10098807 Ga0207702_100988072 405
212 3300046453 Ga0495627_043313 Ga0495627_043313_124_1350 405
213 3300037418 Ga0395900_0241670 Ga0395900_0241670_68_1288 406
214 3300037466 Ga0395898_0251559 Ga0395898_0251559_280_1500 406
215 3300037471 Ga0395905_0232887 Ga0395905_0232887_408_1628 406
216 3300038443 Ga0395901_0319974 Ga0395901_0319974_354_1574 406
217 3300044694 Ga0466963_0094040 Ga0466963_0094040_362_1582 406
218 3300045976 Ga0466967_0033060 Ga0466967_0033060_254_1474 406
219 3300006844 Ga0075428_100086391 Ga0075428_1000863913 407
220 3300006844 Ga0075428_100222440 Ga0075428_1002224402 407
221 3300009101 Ga0105247_10000667 Ga0105247_1000066721 407
222 3300031824 Ga0307413_10148564 Ga0307413_101485641 407
223 3300046454 Ga0495592_0166117 Ga0495592_0166117_238_1491 407
224 iso_pu_bacteria 2626541554 2626636719 407
225 iso_pu_bacteria 637000116 637880565 407
226 iso_pu_bacteria 637000116 637881543 407
227 3300005577 Ga0068857_100354448 Ga0068857_1003544481 408
228 3300006844 Ga0075428_100340532 Ga0075428_1003405322 408
229 3300006846 Ga0075430_100131586 Ga0075430_1001315862 408
230 3300006846 Ga0075430_100131969 Ga0075430_1001319692 408
231 3300006846 Ga0075430_100136429 Ga0075430_1001364292 408
232 3300006847 Ga0075431_100204259 Ga0075431_1002042593 408
233 3300006847 Ga0075431_100299128 Ga0075431_1002991281 408
234 3300009147 Ga0114129_10151433 Ga0114129_101514331 408
235 3300009147 Ga0114129_10340036 Ga0114129_103400361 408
236 3300013105 Ga0157369_10308856 Ga0157369_103088561 408
237 3300031456 Ga0307513_10062798 Ga0307513_100627982 408
238 3300050507 nmdc:mga05p37_89241_c1 nmdc:mga05p37_89241_c1_1468_2694 408
239 3300050509 nmdc:mga0qj67_107307_c1 nmdc:mga0qj67_107307_c1_539_1765 408
240 3300050509 nmdc:mga0qj67_111798_c1 nmdc:mga0qj67_111798_c1_603_1829 408
241 3300002077 JGI24744J21845_10016079 JGI24744J21845_100160791 410
242 3300003203 JGI25406J46586_10043878 JGI25406J46586_100438781 410
243 3300005329 Ga0070683_100208504 Ga0070683_1002085042 410
244 3300005343 Ga0070687_100142306 Ga0070687_1001423061 410
245 3300005985 Ga0081539_10011126 Ga0081539_100111264 410
246 3300009148 Ga0105243_10302631 Ga0105243_103026311 410
247 3300025901 Ga0207688_10092577 Ga0207688_100925771 410
248 3300025908 Ga0207643_10031642 Ga0207643_100316424 410
249 3300025918 Ga0207662_10093449 Ga0207662_100934492 410
250 3300025935 Ga0207709_10170398 Ga0207709_101703981 410
251 3300025937 Ga0207669_10082060 Ga0207669_100820601 410
252 3300025940 Ga0207691_10170719 Ga0207691_101707191 410
253 3300046616 Ga0495668_0085460 Ga0495668_0085460_434_1666 410

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02371

Transposase_20

Transposase IS116/IS110/IS902 family

311

397

0.96

PF01548

DEDD_Tnp_IS110

Transposase

37

203

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j9e-assembly1.cif.gz_J cryo-em structure of xanthomonos oryzae transcription elongation complex with nusa and the bacteriophage protein p7 0.7602 3 48
6uj5-assembly1.cif.gz_B crystal structure of cab1 pantothenate kinase from saccharomyces cerevisiae 0.7312 2 96
7t1h-assembly1.cif.gz_A crystal structure of cab1 pantothenate kinase from saccharomyces cerevisiae in complex with compound yu281445 0.7241 2 98
1bu6-assembly1.cif.gz_Z crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation 0.6471 2 61
3ezw-assembly2.cif.gz_D crystal structure of a hyperactive escherichia coli glycerol kinase mutant gly230 --> asp obtained using microfluidic crystallization devices 0.6407 2 61
ID Description Score Start End Superfamily
af_O07182_4_158_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.814 5 160 3.30.420.10
3plaA02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8062 133 270 1.10.287.4070
af_O07182_4_158_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7909 5 160 3.30.420.10
5gipB02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7812 133 270 1.10.287.4070
3plaA02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.773 133 270 1.10.287.4070
ID Description Score Start End GO Terms
AF-A0A7K0A9V9-F1-model_v4 Transposase 0.9441 120 291
AF-A0A6N4WCH1-F1-model_v4 Transposase IS110-like N-terminal domain-containing protein 0.9384 109 305 GO:0003677
GO:0004803
GO:0006313
AF-A0A7K0A9V9-F1-model_v4 Transposase 0.9334 120 291
AF-A0A5B1AWU5-F1-model_v4 IS110 family transposase 0.9291 7 158 GO:0003677
GO:0004803
GO:0006313
AF-X8C803-F1-model_v4 deleted 0.9268 2 128

Feature Viewer

pLDDT pTM Quality
87.67 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map