F364077

General Info

Members Datasets Scaffolds Average Seq Length
253 164 506 139

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_11245517|Ga0157376_112455171
Length 164
Sequence VYFTLPSVSGRAFAGTRRVQKEEQMSLRDKYSAAIQTAKQLRMQGAAEERDGKLHFTGVVTSEDEKNQIWNALKTVPDWQKDVVADIKVQPGARAAQSASTGSSAGAASSYTVQAGDTLSGIAKKLYGNANEYMEIFNANRDQLSDPDKIQPGQVLKIPQHAKH

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
114 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
115 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
121 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
126 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
127 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
128 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
129 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
139 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
140 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
141 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
142 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
143 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
144 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
145 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
146 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
149 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
150 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
161 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 3.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 17.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_11245517 3300014969 Bacteria 773
2 JGI25406J46586_10000179 3300003203 Bacteria 28485
3 Ga0058862_12251586 3300004803 Unclassified 653
4 Ga0065714_10286127 3300005288 Bacteria 699
5 Ga0065712_10072002 3300005290 Bacteria 4946
6 Ga0065712_10344012 3300005290 Unclassified 796
7 Ga0065712_10506586 3300005290 Unclassified 635
8 Ga0065715_10210569 3300005293 Bacteria 1316
9 Ga0065707_10045979 3300005295 Bacteria 1027
10 Ga0065707_10265961 3300005295 Bacteria 1084
11 Ga0070676_10531406 3300005328 Bacteria 839
12 Ga0070690_100025470 3300005330 Bacteria 3645
13 Ga0070670_100000742 3300005331 Bacteria 25344
14 Ga0070666_10513831 3300005335 Bacteria 869
15 Ga0070680_100532461 3300005336 Bacteria 1006
16 Ga0070660_100998299 3300005339 Bacteria 707
17 Ga0070689_100178457 3300005340 Bacteria 1724
18 Ga0070687_100031681 3300005343 Bacteria 2596
19 Ga0070692_10581893 3300005345 Bacteria 738
20 Ga0070668_100306534 3300005347 Bacteria 1333
21 Ga0070668_100399477 3300005347 Bacteria 1173
22 Ga0070669_100146513 3300005353 Bacteria 1825
23 Ga0070675_100082427 3300005354 Bacteria 2683
24 Ga0070671_100533039 3300005355 Bacteria 1012
25 Ga0070671_101167467 3300005355 Bacteria 677
26 Ga0070673_100032170 3300005364 Bacteria 3945
27 Ga0070673_100612621 3300005364 Bacteria 994
28 Ga0070688_100194004 3300005365 Bacteria 1417
29 Ga0070688_100347422 3300005365 Bacteria 1085
30 Ga0070659_100318911 3300005366 Bacteria 1299
31 Ga0070667_100903571 3300005367 Bacteria 822
32 Ga0070713_100451777 3300005436 Bacteria 1207
33 Ga0070701_10042540 3300005438 Bacteria 2320
34 Ga0070701_10073485 3300005438 Unclassified 1834
35 Ga0070701_10812261 3300005438 Bacteria 639
36 Ga0070705_100479105 3300005440 Bacteria 940
37 Ga0070700_100662229 3300005441 Bacteria 826
38 Ga0070694_100958411 3300005444 Bacteria 709
39 Ga0070662_100097421 3300005457 Bacteria 2220
40 Ga0070685_10032449 3300005466 Bacteria 2924
41 Ga0070706_100605311 3300005467 Unclassified 1018
42 Ga0070707_100477533 3300005468 Bacteria 1208
43 Ga0070707_100961580 3300005468 Unclassified 819
44 Ga0070707_101459543 3300005468 Bacteria 651
45 Ga0070698_101025525 3300005471 Unclassified 773
46 Ga0070699_100244788 3300005518 Bacteria 1601
47 Ga0070699_100329481 3300005518 Bacteria 1373
48 Ga0070699_101103510 3300005518 Bacteria 728
49 Ga0070672_100019804 3300005543 Bacteria 4893
50 Ga0070686_100164199 3300005544 Bacteria 1566
51 Ga0070696_100649862 3300005546 Bacteria 855
52 Ga0070696_100674624 3300005546 Bacteria 840
53 Ga0070665_100660090 3300005548 Unclassified 1059
54 Ga0070704_100069426 3300005549 Unclassified 2553
55 Ga0070704_100278251 3300005549 Bacteria 1385
56 Ga0070704_100463977 3300005549 Bacteria 1093
57 Ga0070704_100539137 3300005549 Bacteria 1018
58 Ga0070664_100009982 3300005564 Bacteria 7696
59 Ga0070664_100576137 3300005564 Bacteria 1042
60 Ga0068857_100047131 3300005577 Bacteria 3826
61 Ga0070702_101348771 3300005615 Unclassified 581
62 Ga0068859_100015057 3300005617 Bacteria 7765
63 Ga0068864_100256550 3300005618 Bacteria 1625
64 Ga0068864_100515080 3300005618 Bacteria 1152
65 Ga0068863_100458277 3300005841 Bacteria 1252
66 Ga0068858_100330085 3300005842 Bacteria 1459
67 Ga0068860_100118446 3300005843 Bacteria 2535
68 Ga0081538_10102145 3300005981 Unclassified 1440
69 Ga0081539_10000535 3300005985 Bacteria 78890
70 Ga0081539_10002612 3300005985 Bacteria 24691
71 Ga0097621_101344779 3300006237 Bacteria 675
72 Ga0075428_100036512 3300006844 Bacteria 5411
73 Ga0075428_100766503 3300006844 Bacteria 1026
74 Ga0075430_100395904 3300006846 Unclassified 1140
75 Ga0075430_100630644 3300006846 Bacteria 884
76 Ga0075431_100027319 3300006847 Bacteria 5855
77 Ga0075433_10054913 3300006852 Bacteria 3476
78 Ga0075433_10249921 3300006852 Bacteria 1574
79 Ga0075434_100323179 3300006871 Unclassified 1563
80 Ga0075429_100038603 3300006880 Bacteria 4157
81 Ga0075429_100181129 3300006880 Bacteria 1846
82 Ga0075429_100612334 3300006880 Bacteria 954
83 Ga0068865_101216629 3300006881 Bacteria 667
84 Ga0097620_100015057 3300006931 Bacteria 7765
85 Ga0111539_10023246 3300009094 Bacteria 7614
86 Ga0111539_10154634 3300009094 Bacteria 2684
87 Ga0111539_10175612 3300009094 Bacteria 2502
88 Ga0111539_10413065 3300009094 Bacteria 1572
89 Ga0111539_10458856 3300009094 Bacteria 1484
90 Ga0114129_10173790 3300009147 Bacteria 2935
91 Ga0114129_11058103 3300009147 Bacteria 1018
92 Ga0105248_11119364 3300009177 Bacteria 890
93 Ga0105249_10123504 3300009553 Bacteria 2463
94 Ga0105249_11310771 3300009553 Unclassified 796
95 Ga0105246_11163216 3300011119 Bacteria 708
96 Ga0157378_11309603 3300013297 Unclassified 766
97 Ga0157378_11588112 3300013297 Bacteria 700
98 Ga0163163_10183505 3300014325 Bacteria 2140
99 Ga0157380_11507800 3300014326 Unclassified 726
100 Ga0157377_10245577 3300014745 Bacteria 1158
101 Ga0182005_1082252 3300015265 Unclassified 890
102 Ga0206350_10846886 3300020080 Unclassified 835
103 Ga0224712_10680890 3300022467 Bacteria 505
104 Ga0207697_10203750 3300025315 Bacteria 871
105 Ga0207680_10356158 3300025903 Bacteria 1028
106 Ga0207645_10411595 3300025907 Bacteria 910
107 Ga0207663_10542051 3300025916 Bacteria 909
108 Ga0207660_10270209 3300025917 Bacteria 1347
109 Ga0207660_10947281 3300025917 Bacteria 702
110 Ga0207657_10955485 3300025919 Bacteria 659
111 Ga0207681_10185833 3300025923 Bacteria 1586
112 Ga0207681_10489529 3300025923 Bacteria 1006
113 Ga0207650_10022669 3300025925 Bacteria 4447
114 Ga0207659_10132727 3300025926 Bacteria 1924
115 Ga0207644_10300285 3300025931 Bacteria 1294
116 Ga0207670_10252964 3300025936 Bacteria 1362
117 Ga0207669_11063182 3300025937 Unclassified 682
118 Ga0207691_10025858 3300025940 Bacteria 5509
119 Ga0207679_10075489 3300025945 Bacteria 2558
120 Ga0207712_11602317 3300025961 Bacteria 583
121 Ga0207668_10340385 3300025972 Bacteria 1251
122 Ga0207703_10398562 3300026035 Bacteria 1276
123 Ga0207708_10208926 3300026075 Bacteria 1560
124 Ga0207708_10290902 3300026075 Bacteria 1326
125 Ga0207641_11786663 3300026088 Bacteria 617
126 Ga0207641_11860879 3300026088 Bacteria 603
127 Ga0207676_10065819 3300026095 Bacteria 2887
128 Ga0207676_10557961 3300026095 Bacteria 1095
129 Ga0207674_10057174 3300026116 Bacteria 3955
130 Ga0209966_1053282 3300027695 Bacteria 864
131 Ga0207428_10313259 3300027907 Bacteria 1160
132 Ga0268266_10469674 3300028379 Bacteria 1198
133 Ga0268265_11329392 3300028380 Unclassified 719
134 Ga0268264_10136908 3300028381 Bacteria 2178
135 Ga0307408_100185119 3300031548 Bacteria 1673
136 Ga0307408_101536264 3300031548 Unclassified 630
137 Ga0307405_10001671 3300031731 Bacteria 9457
138 Ga0307405_10183293 3300031731 Unclassified 1505
139 Ga0307405_10749619 3300031731 Unclassified 813
140 Ga0307413_10003365 3300031824 Bacteria 6720
141 Ga0307413_10003594 3300031824 Bacteria 6568
142 Ga0307413_10306763 3300031824 Bacteria 1206
143 Ga0307413_11063965 3300031824 Bacteria 697
144 Ga0307413_11311338 3300031824 Unclassified 634
145 Ga0307410_10103116 3300031852 Bacteria 2048
146 Ga0307410_10364274 3300031852 Bacteria 1158
147 Ga0307406_10073016 3300031901 Bacteria 2254
148 Ga0307406_10206492 3300031901 Bacteria 1450
149 Ga0307407_10002187 3300031903 Bacteria 7536
150 Ga0307407_10027119 3300031903 Bacteria 3043
151 Ga0307407_10122409 3300031903 Bacteria 1651
152 Ga0307412_10004544 3300031911 Bacteria 7730
153 Ga0307412_10040908 3300031911 Bacteria 3001
154 Ga0307412_10261997 3300031911 Bacteria 1348
155 Ga0307412_10417033 3300031911 Bacteria 1097
156 Ga0307412_10661800 3300031911 Bacteria 892
157 Ga0307409_100005975 3300031995 Bacteria 7093
158 Ga0307409_100018798 3300031995 Bacteria 4659
159 Ga0307409_100021287 3300031995 Bacteria 4442
160 Ga0307409_100349440 3300031995 Bacteria 1395
161 Ga0307409_100425269 3300031995 Bacteria 1275
162 Ga0307409_102411340 3300031995 Bacteria 555
163 Ga0307416_100008660 3300032002 Bacteria 6587
164 Ga0307416_100109800 3300032002 Bacteria 2427
165 Ga0307416_100249116 3300032002 Bacteria 1727
166 Ga0307416_100352374 3300032002 Bacteria 1490
167 Ga0307416_100792993 3300032002 Bacteria 1042
168 Ga0307416_100948831 3300032002 Bacteria 962
169 Ga0307414_10210665 3300032004 Bacteria 1588
170 Ga0307414_10311256 3300032004 Bacteria 1337
171 Ga0307414_10373020 3300032004 Bacteria 1231
172 Ga0307411_10008856 3300032005 Bacteria 5245
173 Ga0307411_10009524 3300032005 Bacteria 5114
174 Ga0307411_10033494 3300032005 Bacteria 3187
175 Ga0307411_10333258 3300032005 Bacteria 1230
176 Ga0307411_10353114 3300032005 Bacteria 1199
177 Ga0307411_12019076 3300032005 Unclassified 538
178 Ga0307415_100033165 3300032126 Bacteria 3350
179 Ga0307415_100077761 3300032126 Unclassified 2357
180 Ga0307415_100106366 3300032126 Bacteria 2071
181 Ga0373953_0066851 3300035117 Bacteria 1478
182 Ga0373924_0396826 3300035410 Bacteria 616
183 Ga0373937_0020670 3300036401 Bacteria 5903
184 Ga0439436_0180223 3300041404 Unclassified 601
185 Ga0439433_0091255 3300041999 Unclassified 749
186 Ga0439457_008571 3300042014 Bacteria 2407
187 Ga0439446_0084150 3300042156 Unclassified 989
188 Ga0439446_0272735 3300042156 Unclassified 588
189 Ga0466957_0640387 3300044842 Bacteria 747
190 Ga0495603_0169824 3300046455 Bacteria 1263
191 Ga0495594_0158713 3300046499 Unclassified 1285
192 Ga0495598_0058264 3300046537 Bacteria 1184
193 Ga0495598_0134344 3300046537 Bacteria 851
194 Ga0495621_0260384 3300046539 Unclassified 710
195 Ga0495621_0265890 3300046539 Bacteria 704
196 Ga0495633_0051350 3300046558 Bacteria 1943
197 Ga0495588_0062967 3300046674 Bacteria 1923
198 Ga0501308_080631 3300049128 Bacteria 518
199 Ga0501291_167738 3300049514 Unclassified 505
200 Ga0501292_039177 3300049515 Bacteria 815
201 Ga0501298_057166 3300049521 Bacteria 820
202 Ga0501299_128368 3300049522 Unclassified 618
203 Ga0501313_032005 3300049529 Bacteria 685
204 Ga0501313_070173 3300049529 Bacteria 507
205 Ga0501315_089411 3300049531 Unclassified 532
206 Ga0501317_073212 3300049533 Unclassified 581
207 Ga0501040_0568430 3300049576 Bacteria 819
208 Ga0501042_1105445 3300049578 Bacteria 578
209 Ga0501042_1272243 3300049578 Unclassified 536
210 Ga0501068_0757706 3300049584 Bacteria 636
211 Ga0501075_0477879 3300049591 Bacteria 951
212 Ga0501076_0126321 3300049592 Bacteria 2073
213 Ga0501077_0384307 3300049593 Bacteria 897
214 Ga0501198_046632 3300049649 Bacteria 763
215 Ga0501207_076321 3300049654 Unclassified 638
216 Ga0501209_189663 3300049656 Bacteria 630
217 Ga0501217_040982 3300049661 Bacteria 1178
218 Ga0501227_221906 3300049665 Unclassified 538
219 Ga0501233_025663 3300049668 Bacteria 1297
220 Ga0501235_020065 3300049669 Bacteria 1484
221 Ga0501249_112567 3300049679 Bacteria 659
222 Ga0501245_092082 3300049708 Bacteria 602
223 Ga0501080_0841482 3300049742 Bacteria 803
224 Ga0501268_042979 3300049765 Bacteria 855
225 Ga0501273_008262 3300049770 Bacteria 1243
226 Ga0501283_038403 3300049779 Bacteria 823
227 Ga0501045_0503121 3300049824 Unclassified 900
228 nmdc:mga05p37_151308_c1 3300050507 Bacteria 2838
229 nmdc:mga05p37_594592_c1 3300050507 Bacteria 1250
230 nmdc:mga09592_159841_c1 3300050508 Bacteria 1946
231 nmdc:mga09592_31619_c1 3300050508 Bacteria 4411
232 nmdc:mga09592_534558_c1 3300050508 Bacteria 1007
233 nmdc:mga0qj67_595680_c1 3300050509 Bacteria 884
234 nmdc:mga0qj67_608297_c1 3300050509 Unclassified 874
235 nmdc:mga06r32_43523_c1 3300050510 Bacteria 4272
236 nmdc:mga08y16_113285_c1 3300050511 Bacteria 2823
237 nmdc:mga08y16_2090686_c1 3300050511 Bacteria 514
238 nmdc:mga08y16_356080_c1 3300050511 Bacteria 1503
239 nmdc:mga08y16_88057_c1 3300050511 Bacteria 3235
240 nmdc:mga0n895_352354_c1 3300050512 Unclassified 1491
241 nmdc:mga0a205_32443_c1 3300050515 Bacteria 5007
242 Ga0495601_0693111 3300053077 Bacteria 650
243 Ga0590071_000287 3300059421 Bacteria 14693
244 Ga0590071_075151 3300059421 Unclassified 836
245 Ga0590074_001159 3300059423 Bacteria 4155
246 Ga0590074_007692 3300059423 Bacteria 1791
247 Ga0590074_111447 3300059423 Unclassified 540
248 Ga0590075_000062 3300059424 Bacteria 26775
249 Ga0590075_001316 3300059424 Bacteria 6232
250 Ga0590077_000925 3300059426 Bacteria 7489
251 Ga0590077_001625 3300059426 Bacteria 5155
252 Ga0590077_010645 3300059426 Bacteria 1892
253 Ga0587073_0290409 3300059492 Unclassified 528
254 Ga0157376_11245517
255 JGI25406J46586_10000179
256 Ga0058862_12251586
257 Ga0065714_10286127
258 Ga0065712_10072002
259 Ga0065712_10344012
260 Ga0065712_10506586
261 Ga0065715_10210569
262 Ga0065707_10045979
263 Ga0065707_10265961
264 Ga0070676_10531406
265 Ga0070690_100025470
266 Ga0070670_100000742
267 Ga0070666_10513831
268 Ga0070680_100532461
269 Ga0070660_100998299
270 Ga0070689_100178457
271 Ga0070687_100031681
272 Ga0070692_10581893
273 Ga0070668_100306534
274 Ga0070668_100399477
275 Ga0070669_100146513
276 Ga0070675_100082427
277 Ga0070671_100533039
278 Ga0070671_101167467
279 Ga0070673_100032170
280 Ga0070673_100612621
281 Ga0070688_100194004
282 Ga0070688_100347422
283 Ga0070659_100318911
284 Ga0070667_100903571
285 Ga0070713_100451777
286 Ga0070701_10042540
287 Ga0070701_10073485
288 Ga0070701_10812261
289 Ga0070705_100479105
290 Ga0070700_100662229
291 Ga0070694_100958411
292 Ga0070662_100097421
293 Ga0070685_10032449
294 Ga0070706_100605311
295 Ga0070707_100477533
296 Ga0070707_100961580
297 Ga0070707_101459543
298 Ga0070698_101025525
299 Ga0070699_100244788
300 Ga0070699_100329481
301 Ga0070699_101103510
302 Ga0070672_100019804
303 Ga0070686_100164199
304 Ga0070696_100649862
305 Ga0070696_100674624
306 Ga0070665_100660090
307 Ga0070704_100069426
308 Ga0070704_100278251
309 Ga0070704_100463977
310 Ga0070704_100539137
311 Ga0070664_100009982
312 Ga0070664_100576137
313 Ga0068857_100047131
314 Ga0070702_101348771
315 Ga0068859_100015057
316 Ga0068864_100256550
317 Ga0068864_100515080
318 Ga0068863_100458277
319 Ga0068858_100330085
320 Ga0068860_100118446
321 Ga0081538_10102145
322 Ga0081539_10000535
323 Ga0081539_10002612
324 Ga0097621_101344779
325 Ga0075428_100036512
326 Ga0075428_100766503
327 Ga0075430_100395904
328 Ga0075430_100630644
329 Ga0075431_100027319
330 Ga0075433_10054913
331 Ga0075433_10249921
332 Ga0075434_100323179
333 Ga0075429_100038603
334 Ga0075429_100181129
335 Ga0075429_100612334
336 Ga0068865_101216629
337 Ga0097620_100015057
338 Ga0111539_10023246
339 Ga0111539_10154634
340 Ga0111539_10175612
341 Ga0111539_10413065
342 Ga0111539_10458856
343 Ga0114129_10173790
344 Ga0114129_11058103
345 Ga0105248_11119364
346 Ga0105249_10123504
347 Ga0105249_11310771
348 Ga0105246_11163216
349 Ga0157378_11309603
350 Ga0157378_11588112
351 Ga0163163_10183505
352 Ga0157380_11507800
353 Ga0157377_10245577
354 Ga0182005_1082252
355 Ga0206350_10846886
356 Ga0224712_10680890
357 Ga0207697_10203750
358 Ga0207680_10356158
359 Ga0207645_10411595
360 Ga0207663_10542051
361 Ga0207660_10270209
362 Ga0207660_10947281
363 Ga0207657_10955485
364 Ga0207681_10185833
365 Ga0207681_10489529
366 Ga0207650_10022669
367 Ga0207659_10132727
368 Ga0207644_10300285
369 Ga0207670_10252964
370 Ga0207669_11063182
371 Ga0207691_10025858
372 Ga0207679_10075489
373 Ga0207712_11602317
374 Ga0207668_10340385
375 Ga0207703_10398562
376 Ga0207708_10208926
377 Ga0207708_10290902
378 Ga0207641_11786663
379 Ga0207641_11860879
380 Ga0207676_10065819
381 Ga0207676_10557961
382 Ga0207674_10057174
383 Ga0209966_1053282
384 Ga0207428_10313259
385 Ga0268266_10469674
386 Ga0268265_11329392
387 Ga0268264_10136908
388 Ga0307408_100185119
389 Ga0307408_101536264
390 Ga0307405_10001671
391 Ga0307405_10183293
392 Ga0307405_10749619
393 Ga0307413_10003365
394 Ga0307413_10003594
395 Ga0307413_10306763
396 Ga0307413_11063965
397 Ga0307413_11311338
398 Ga0307410_10103116
399 Ga0307410_10364274
400 Ga0307406_10073016
401 Ga0307406_10206492
402 Ga0307407_10002187
403 Ga0307407_10027119
404 Ga0307407_10122409
405 Ga0307412_10004544
406 Ga0307412_10040908
407 Ga0307412_10261997
408 Ga0307412_10417033
409 Ga0307412_10661800
410 Ga0307409_100005975
411 Ga0307409_100018798
412 Ga0307409_100021287
413 Ga0307409_100349440
414 Ga0307409_100425269
415 Ga0307409_102411340
416 Ga0307416_100008660
417 Ga0307416_100109800
418 Ga0307416_100249116
419 Ga0307416_100352374
420 Ga0307416_100792993
421 Ga0307416_100948831
422 Ga0307414_10210665
423 Ga0307414_10311256
424 Ga0307414_10373020
425 Ga0307411_10008856
426 Ga0307411_10009524
427 Ga0307411_10033494
428 Ga0307411_10333258
429 Ga0307411_10353114
430 Ga0307411_12019076
431 Ga0307415_100033165
432 Ga0307415_100077761
433 Ga0307415_100106366
434 Ga0373953_0066851
435 Ga0373924_0396826
436 Ga0373937_0020670
437 Ga0439436_0180223
438 Ga0439433_0091255
439 Ga0439457_008571
440 Ga0439446_0084150
441 Ga0439446_0272735
442 Ga0466957_0640387
443 Ga0495603_0169824
444 Ga0495594_0158713
445 Ga0495598_0058264
446 Ga0495598_0134344
447 Ga0495621_0260384
448 Ga0495621_0265890
449 Ga0495633_0051350
450 Ga0495588_0062967
451 Ga0501308_080631
452 Ga0501291_167738
453 Ga0501292_039177
454 Ga0501298_057166
455 Ga0501299_128368
456 Ga0501313_032005
457 Ga0501313_070173
458 Ga0501315_089411
459 Ga0501317_073212
460 Ga0501040_0568430
461 Ga0501042_1105445
462 Ga0501042_1272243
463 Ga0501068_0757706
464 Ga0501075_0477879
465 Ga0501076_0126321
466 Ga0501077_0384307
467 Ga0501198_046632
468 Ga0501207_076321
469 Ga0501209_189663
470 Ga0501217_040982
471 Ga0501227_221906
472 Ga0501233_025663
473 Ga0501235_020065
474 Ga0501249_112567
475 Ga0501245_092082
476 Ga0501080_0841482
477 Ga0501268_042979
478 Ga0501273_008262
479 Ga0501283_038403
480 Ga0501045_0503121
481 nmdc:mga05p37_151308_c1
482 nmdc:mga05p37_594592_c1
483 nmdc:mga09592_159841_c1
484 nmdc:mga09592_31619_c1
485 nmdc:mga09592_534558_c1
486 nmdc:mga0qj67_595680_c1
487 nmdc:mga0qj67_608297_c1
488 nmdc:mga06r32_43523_c1
489 nmdc:mga08y16_113285_c1
490 nmdc:mga08y16_2090686_c1
491 nmdc:mga08y16_356080_c1
492 nmdc:mga08y16_88057_c1
493 nmdc:mga0n895_352354_c1
494 nmdc:mga0a205_32443_c1
495 Ga0495601_0693111
496 Ga0590071_000287
497 Ga0590071_075151
498 Ga0590074_001159
499 Ga0590074_007692
500 Ga0590074_111447
501 Ga0590075_000062
502 Ga0590075_001316
503 Ga0590077_000925
504 Ga0590077_001625
505 Ga0590077_010645
506 Ga0587073_0290409

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01476

LysM

LysM domain

111

159

0.98

Map