F363915

General Info

Members Datasets Scaffolds Average Seq Length
253 102 506 165

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100895256|Ga0068862_1008952562
Length 195
Sequence MGDFYHCVPGIALNIIPLENRIIMLNASMEEQMEKVDDRVSSFLHQKKIAVVGVSDKRETGCNLAYKKFKENGYQVYAVNPRISNYDADACYADLKSIPDRPEAVFILANPKVTEQIVGQCVELGIKHVWMHCMMGTKPGLAAGMTSVSKSAVELCNSNGIEVIPGSCPNQFLKPDIAHALMKGMWRMFGFMNMN

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
56 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
57 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
58 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
76 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
77 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
78 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
79 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
84 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
89 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
90 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
91 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
98 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
99 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
101 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.58
Rhizosphere 98.42
Stem 0
Stem Tuber 0
Unclassified 23.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100895256 3300005844 Unclassified 872
2 SwRhRL3b_contig_1779525 2162886006 Bacteria 4088
3 SwRhRL2b_contig_1115187 2162886007 Unclassified 1003
4 SwRhRL2b_contig_1676647 2162886007 Bacteria 8576
5 SwRhRL2b_contig_2002100 2162886007 Bacteria 8031
6 Ga0065704_10000320 3300005289 Bacteria 67636
7 Ga0065704_10202280 3300005289 Bacteria 1141
8 Ga0065707_10000464 3300005295 Bacteria 36674
9 Ga0065707_10003627 3300005295 Bacteria 6097
10 Ga0065707_10005632 3300005295 Bacteria 3270
11 Ga0065707_10082075 3300005295 Bacteria 22566
12 Ga0070670_100647019 3300005331 Bacteria 948
13 Ga0070689_100099928 3300005340 Bacteria 2295
14 Ga0070689_100337409 3300005340 Bacteria 1262
15 Ga0070689_100727303 3300005340 Bacteria 868
16 Ga0070689_100856312 3300005340 Unclassified 802
17 Ga0070687_100041822 3300005343 Bacteria 2318
18 Ga0070705_100053718 3300005440 Bacteria 2360
19 Ga0070705_100590685 3300005440 Bacteria 857
20 Ga0070706_100137771 3300005467 Bacteria 2277
21 Ga0070706_100686093 3300005467 Bacteria 950
22 Ga0070707_100478945 3300005468 Bacteria 1206
23 Ga0070698_100063264 3300005471 Bacteria 3732
24 Ga0070698_100181115 3300005471 Bacteria 2045
25 Ga0070698_100343247 3300005471 Unclassified 1424
26 Ga0070698_100350007 3300005471 Bacteria 1409
27 Ga0070698_100610337 3300005471 Bacteria 1031
28 Ga0070699_100072710 3300005518 Bacteria 2992
29 Ga0070699_100102290 3300005518 Unclassified 2512
30 Ga0070684_100150494 3300005535 Bacteria 2108
31 Ga0070684_100470893 3300005535 Unclassified 1162
32 Ga0070686_100107195 3300005544 Bacteria 1897
33 Ga0070695_100283667 3300005545 Bacteria 1218
34 Ga0070696_100108611 3300005546 Bacteria 1996
35 Ga0070704_100026002 3300005549 Unclassified 3861
36 Ga0070704_100144402 3300005549 Bacteria 1863
37 Ga0068857_100214970 3300005577 Bacteria 1755
38 Ga0068857_100243439 3300005577 Bacteria 1647
39 Ga0068859_100356046 3300005617 Unclassified 1558
40 Ga0068859_100610311 3300005617 Bacteria 1184
41 Ga0068859_100827161 3300005617 Unclassified 1013
42 Ga0068859_101568025 3300005617 Bacteria 727
43 Ga0068864_100065107 3300005618 Bacteria 3162
44 Ga0068864_101154203 3300005618 Bacteria 772
45 Ga0068861_100433528 3300005719 Bacteria 1174
46 Ga0068861_100647075 3300005719 Unclassified 976
47 Ga0068861_100740117 3300005719 Bacteria 917
48 Ga0068870_10561275 3300005840 Bacteria 770
49 Ga0068858_100417555 3300005842 Bacteria 1290
50 Ga0068862_100045931 3300005844 Bacteria 3728
51 Ga0068862_100104494 3300005844 Bacteria 2481
52 Ga0068862_101313633 3300005844 Bacteria 725
53 Ga0075428_100014737 3300006844 Bacteria 8683
54 Ga0075428_100115511 3300006844 Bacteria 2924
55 Ga0075428_100960495 3300006844 Bacteria 905
56 Ga0075428_100970640 3300006844 Bacteria 900
57 Ga0075430_100146951 3300006846 Bacteria 1963
58 Ga0075430_100593132 3300006846 Bacteria 914
59 Ga0075430_100919182 3300006846 Bacteria 721
60 Ga0075430_101107503 3300006846 Bacteria 652
61 Ga0075430_101349355 3300006846 Bacteria 586
62 Ga0075431_100203174 3300006847 Unclassified 2027
63 Ga0075431_100478540 3300006847 Bacteria 1238
64 Ga0075431_101005520 3300006847 Bacteria 801
65 Ga0075434_100590004 3300006871 Bacteria 1130
66 Ga0075429_100003307 3300006880 Bacteria 13727
67 Ga0075429_100008955 3300006880 Bacteria 8694
68 Ga0075429_100012688 3300006880 Bacteria 7307
69 Ga0075429_100141744 3300006880 Bacteria 2104
70 Ga0075429_100156141 3300006880 Unclassified 1998
71 Ga0075429_100169822 3300006880 Unclassified 1910
72 Ga0097620_100356069 3300006931 Unclassified 1558
73 Ga0097620_100610395 3300006931 Bacteria 1184
74 Ga0097620_100827111 3300006931 Unclassified 1013
75 Ga0097620_101568570 3300006931 Bacteria 727
76 Ga0111539_10028032 3300009094 Bacteria 6877
77 Ga0105247_10170168 3300009101 Unclassified 1448
78 Ga0114129_10002309 3300009147 Bacteria 26439
79 Ga0114129_10008406 3300009147 Bacteria 14702
80 Ga0114129_10048021 3300009147 Bacteria 5998
81 Ga0114129_10075634 3300009147 Bacteria 4689
82 Ga0114129_11450162 3300009147 Bacteria 845
83 Ga0105243_10019979 3300009148 Bacteria 5078
84 Ga0105242_10920611 3300009176 Bacteria 876
85 Ga0105249_10093690 3300009553 Bacteria 2814
86 Ga0105249_10690603 3300009553 Bacteria 1080
87 Ga0105249_10991766 3300009553 Unclassified 909
88 Ga0105249_12269471 3300009553 Bacteria 615
89 Ga0105246_10020657 3300011119 Bacteria 4227
90 Ga0105246_10313038 3300011119 Unclassified 1272
91 Ga0105246_10423137 3300011119 Bacteria 1112
92 Ga0157374_10529769 3300013296 Bacteria 1185
93 Ga0163162_10368011 3300013306 Unclassified 1570
94 Ga0157375_10709241 3300013308 Bacteria 1159
95 Ga0157377_11073155 3300014745 Bacteria 615
96 Ga0163161_10406041 3300017792 Bacteria 1093
97 Ga0207684_10236323 3300025910 Bacteria 1576
98 Ga0207660_10113234 3300025917 Bacteria 2045
99 Ga0207646_10330304 3300025922 Bacteria 1378
100 Ga0207670_10305110 3300025936 Bacteria 1248
101 Ga0207670_10359172 3300025936 Unclassified 1155
102 Ga0207670_10474019 3300025936 Bacteria 1013
103 Ga0207689_10611608 3300025942 Bacteria 917
104 Ga0207712_10234175 3300025961 Bacteria 1476
105 Ga0207712_11151408 3300025961 Bacteria 691
106 Ga0207676_10223983 3300026095 Bacteria 1677
107 Ga0207676_10246437 3300026095 Unclassified 1606
108 Ga0207676_11050534 3300026095 Bacteria 804
109 Ga0207674_10096255 3300026116 Bacteria 2945
110 Ga0207674_10323792 3300026116 Bacteria 1491
111 Ga0207674_10808788 3300026116 Bacteria 904
112 Ga0207675_100353036 3300026118 Bacteria 1441
113 Ga0207675_100794594 3300026118 Bacteria 959
114 Ga0209968_1043559 3300027526 Bacteria 770
115 Ga0209999_1016590 3300027543 Bacteria 1340
116 Ga0268265_10024732 3300028380 Bacteria 4254
117 Ga0268265_10050251 3300028380 Bacteria 3141
118 Ga0268265_10257538 3300028380 Unclassified 1549
119 Ga0268265_11079640 3300028380 Unclassified 796
120 Ga0268265_11211151 3300028380 Bacteria 753
121 Ga0268265_11304936 3300028380 Bacteria 726
122 Ga0265326_10032148 3300028558 Bacteria 1494
123 Ga0265318_10004351 3300028577 Bacteria 6881
124 Ga0265323_10026904 3300028653 Bacteria 2165
125 Ga0265322_10004464 3300028654 Bacteria 4166
126 Ga0265322_10065306 3300028654 Bacteria 1032
127 Ga0265338_10007098 3300028800 Bacteria 14036
128 Ga0265320_10022422 3300031240 Bacteria 3378
129 Ga0265340_10001226 3300031247 Bacteria 14684
130 Ga0265327_10014598 3300031251 Bacteria 5127
131 Ga0265316_10094396 3300031344 Bacteria 2279
132 Ga0265316_10332719 3300031344 Unclassified 1102
133 Ga0307408_101248069 3300031548 Bacteria 695
134 Ga0316575_10047473 3300031665 Bacteria 1707
135 Ga0316575_10243020 3300031665 Unclassified 754
136 Ga0316578_10478202 3300031728 Unclassified 735
137 Ga0307407_11178732 3300031903 Unclassified 598
138 Ga0316574_0141406 3300035398 Bacteria 1551
139 Ga0316574_0338252 3300035398 Unclassified 954
140 Ga0316574_0628224 3300035398 Bacteria 662
141 Ga0316582_0625970 3300036647 Unclassified 740
142 Ga0316582_0724923 3300036647 Bacteria 683
143 Ga0316584_0114359 3300036712 Bacteria 2019
144 Ga0451577_0003347 3300042876 Bacteria 17951
145 Ga0451577_0214167 3300042876 Bacteria 1741
146 Ga0451577_0414019 3300042876 Unclassified 1223
147 Ga0451577_0453777 3300042876 Bacteria 1164
148 Ga0451577_0497453 3300042876 Bacteria 1107
149 Ga0451577_0963923 3300042876 Bacteria 767
150 Ga0451577_0984576 3300042876 Unclassified 758
151 Ga0451577_1389553 3300042876 Bacteria 623
152 Ga0451577_1742251 3300042876 Unclassified 547
153 Ga0453683_0000733 3300044673 Bacteria 33588
154 Ga0453683_0008926 3300044673 Bacteria 6705
155 Ga0453683_0017255 3300044673 Bacteria 4650
156 Ga0453683_0082175 3300044673 Bacteria 2019
157 Ga0453683_0092663 3300044673 Bacteria 1894
158 Ga0453683_0252349 3300044673 Bacteria 1124
159 Ga0453683_0628925 3300044673 Bacteria 701
160 Ga0453684_0000125 3300044712 Bacteria 336972
161 Ga0453684_0006242 3300044712 Bacteria 22837
162 Ga0453684_0009565 3300044712 Bacteria 16914
163 Ga0453684_0015944 3300044712 Bacteria 11815
164 Ga0453684_0030188 3300044712 Bacteria 7666
165 Ga0453684_0044246 3300044712 Bacteria 5963
166 Ga0453684_0057472 3300044712 Bacteria 5035
167 Ga0453684_0062133 3300044712 Bacteria 4786
168 Ga0453684_0067859 3300044712 Bacteria 4532
169 Ga0453684_0072474 3300044712 Bacteria 4349
170 Ga0453684_0094179 3300044712 Bacteria 3686
171 Ga0453684_0192998 3300044712 Bacteria 2381
172 Ga0453684_0198953 3300044712 Bacteria 2337
173 Ga0453684_0228291 3300044712 Unclassified 2151
174 Ga0453684_0297703 3300044712 Bacteria 1835
175 Ga0453684_0306231 3300044712 Unclassified 1804
176 Ga0453684_0322547 3300044712 Bacteria 1749
177 Ga0453684_0326643 3300044712 Bacteria 1736
178 Ga0453684_0357365 3300044712 Bacteria 1645
179 Ga0453684_0385460 3300044712 Bacteria 1573
180 Ga0453684_0403623 3300044712 Bacteria 1530
181 Ga0453684_0476468 3300044712 Bacteria 1385
182 Ga0453684_0481819 3300044712 Bacteria 1376
183 Ga0453684_0511619 3300044712 Bacteria 1328
184 Ga0453684_0555902 3300044712 Unclassified 1263
185 Ga0453684_0637857 3300044712 Bacteria 1164
186 Ga0453684_0654931 3300044712 Bacteria 1146
187 Ga0453684_0705736 3300044712 Bacteria 1096
188 Ga0453684_0826252 3300044712 Unclassified 997
189 Ga0453684_0843046 3300044712 Bacteria 985
190 Ga0453684_0910992 3300044712 Bacteria 941
191 Ga0453684_1104486 3300044712 Unclassified 837
192 Ga0451576_0012799 3300045051 Bacteria 9413
193 Ga0451576_0060452 3300045051 Unclassified 3953
194 Ga0451576_0159644 3300045051 Bacteria 2352
195 Ga0451576_0186293 3300045051 Bacteria 2167
196 Ga0451576_0218963 3300045051 Bacteria 1988
197 Ga0451576_0284263 3300045051 Bacteria 1730
198 Ga0451576_0458161 3300045051 Bacteria 1339
199 Ga0451576_1005060 3300045051 Unclassified 874
200 Ga0451576_1005977 3300045051 Unclassified 874
201 Ga0451576_1202544 3300045051 Bacteria 791
202 Ga0496104_0817168 3300048907 Bacteria 838
203 Ga0496105_0664450 3300048908 Unclassified 803
204 Ga0496106_0437339 3300048909 Bacteria 1051
205 Ga0496110_0202465 3300048913 Bacteria 1804
206 Ga0501299_004913 3300049522 Bacteria 2027
207 Ga0501037_0738356 3300049573 Unclassified 653
208 Ga0501039_0949851 3300049575 Unclassified 669
209 Ga0501048_0271242 3300049582 Unclassified 1206
210 Ga0501048_1082538 3300049582 Unclassified 577
211 Ga0501068_0192230 3300049584 Bacteria 1293
212 Ga0501071_0089283 3300049587 Unclassified 2262
213 Ga0501071_1059109 3300049587 Unclassified 627
214 Ga0501072_0116553 3300049588 Bacteria 2128
215 Ga0501072_0387753 3300049588 Bacteria 1108
216 Ga0501073_0099701 3300049589 Bacteria 2017
217 Ga0501074_0313470 3300049590 Bacteria 1114
218 Ga0501075_0003026 3300049591 Bacteria 11229
219 Ga0501075_0295857 3300049591 Unclassified 1233
220 Ga0501076_0005344 3300049592 Bacteria 9223
221 Ga0501227_015441 3300049665 Unclassified 1706
222 Ga0501079_0071733 3300049741 Unclassified 2676
223 Ga0501079_0487931 3300049741 Unclassified 968
224 Ga0501080_0077245 3300049742 Bacteria 3097
225 Ga0501080_0080859 3300049742 Bacteria 3020
226 Ga0501081_0404747 3300049743 Unclassified 1010
227 Ga0501081_0494657 3300049743 Unclassified 911
228 Ga0501083_0313288 3300049744 Bacteria 1021
229 nmdc:mga05p37_148_c1 3300050507 Bacteria 66254
230 nmdc:mga05p37_4632_c1 3300050507 Bacteria 16082
231 nmdc:mga05p37_696425_c1 3300050507 Unclassified 1129
232 nmdc:mga05p37_70516_c1 3300050507 Bacteria 4298
233 nmdc:mga09592_109783_c1 3300050508 Bacteria 2366
234 nmdc:mga09592_116362_c1 3300050508 Bacteria 2294
235 nmdc:mga09592_144919_c1 3300050508 Bacteria 2048
236 nmdc:mga09592_169971_c1 3300050508 Bacteria 1885
237 nmdc:mga09592_4025_c1 3300050508 Bacteria 11860
238 nmdc:mga09592_4732_c1 3300050508 Bacteria 7570
239 nmdc:mga09592_804239_c1 3300050508 Bacteria 795
240 nmdc:mga0qj67_1207389_c1 3300050509 Bacteria 588
241 nmdc:mga0qj67_1222331_c1 3300050509 Bacteria 584
242 nmdc:mga06r32_306313_c1 3300050510 Unclassified 1574
243 nmdc:mga06r32_469374_c1 3300050510 Bacteria 1237
244 nmdc:mga08y16_34178_c1 3300050511 Bacteria 5340
245 nmdc:mga0a205_388937_c1 3300050515 Bacteria 1259
246 Ga0501084_0050795 3300054114 Bacteria 3470
247 Ga0501084_0394582 3300054114 Unclassified 1169
248 Ga0501084_0838142 3300054114 Unclassified 774
249 Ga0501084_0992683 3300054114 Bacteria 706
250 Ga0501082_0757193 3300060353 Unclassified 850
251 Ga0501082_0773249 3300060353 Unclassified 840
252 Ga0501082_0863423 3300060353 Unclassified 792
253 Ga0501082_1161398 3300060353 Bacteria 675
254 Ga0068862_100895256
255 SwRhRL3b_contig_1779525
256 SwRhRL2b_contig_1115187
257 SwRhRL2b_contig_1676647
258 SwRhRL2b_contig_2002100
259 Ga0065704_10000320
260 Ga0065704_10202280
261 Ga0065707_10000464
262 Ga0065707_10003627
263 Ga0065707_10005632
264 Ga0065707_10082075
265 Ga0070670_100647019
266 Ga0070689_100099928
267 Ga0070689_100337409
268 Ga0070689_100727303
269 Ga0070689_100856312
270 Ga0070687_100041822
271 Ga0070705_100053718
272 Ga0070705_100590685
273 Ga0070706_100137771
274 Ga0070706_100686093
275 Ga0070707_100478945
276 Ga0070698_100063264
277 Ga0070698_100181115
278 Ga0070698_100343247
279 Ga0070698_100350007
280 Ga0070698_100610337
281 Ga0070699_100072710
282 Ga0070699_100102290
283 Ga0070684_100150494
284 Ga0070684_100470893
285 Ga0070686_100107195
286 Ga0070695_100283667
287 Ga0070696_100108611
288 Ga0070704_100026002
289 Ga0070704_100144402
290 Ga0068857_100214970
291 Ga0068857_100243439
292 Ga0068859_100356046
293 Ga0068859_100610311
294 Ga0068859_100827161
295 Ga0068859_101568025
296 Ga0068864_100065107
297 Ga0068864_101154203
298 Ga0068861_100433528
299 Ga0068861_100647075
300 Ga0068861_100740117
301 Ga0068870_10561275
302 Ga0068858_100417555
303 Ga0068862_100045931
304 Ga0068862_100104494
305 Ga0068862_101313633
306 Ga0075428_100014737
307 Ga0075428_100115511
308 Ga0075428_100960495
309 Ga0075428_100970640
310 Ga0075430_100146951
311 Ga0075430_100593132
312 Ga0075430_100919182
313 Ga0075430_101107503
314 Ga0075430_101349355
315 Ga0075431_100203174
316 Ga0075431_100478540
317 Ga0075431_101005520
318 Ga0075434_100590004
319 Ga0075429_100003307
320 Ga0075429_100008955
321 Ga0075429_100012688
322 Ga0075429_100141744
323 Ga0075429_100156141
324 Ga0075429_100169822
325 Ga0097620_100356069
326 Ga0097620_100610395
327 Ga0097620_100827111
328 Ga0097620_101568570
329 Ga0111539_10028032
330 Ga0105247_10170168
331 Ga0114129_10002309
332 Ga0114129_10008406
333 Ga0114129_10048021
334 Ga0114129_10075634
335 Ga0114129_11450162
336 Ga0105243_10019979
337 Ga0105242_10920611
338 Ga0105249_10093690
339 Ga0105249_10690603
340 Ga0105249_10991766
341 Ga0105249_12269471
342 Ga0105246_10020657
343 Ga0105246_10313038
344 Ga0105246_10423137
345 Ga0157374_10529769
346 Ga0163162_10368011
347 Ga0157375_10709241
348 Ga0157377_11073155
349 Ga0163161_10406041
350 Ga0207684_10236323
351 Ga0207660_10113234
352 Ga0207646_10330304
353 Ga0207670_10305110
354 Ga0207670_10359172
355 Ga0207670_10474019
356 Ga0207689_10611608
357 Ga0207712_10234175
358 Ga0207712_11151408
359 Ga0207676_10223983
360 Ga0207676_10246437
361 Ga0207676_11050534
362 Ga0207674_10096255
363 Ga0207674_10323792
364 Ga0207674_10808788
365 Ga0207675_100353036
366 Ga0207675_100794594
367 Ga0209968_1043559
368 Ga0209999_1016590
369 Ga0268265_10024732
370 Ga0268265_10050251
371 Ga0268265_10257538
372 Ga0268265_11079640
373 Ga0268265_11211151
374 Ga0268265_11304936
375 Ga0265326_10032148
376 Ga0265318_10004351
377 Ga0265323_10026904
378 Ga0265322_10004464
379 Ga0265322_10065306
380 Ga0265338_10007098
381 Ga0265320_10022422
382 Ga0265340_10001226
383 Ga0265327_10014598
384 Ga0265316_10094396
385 Ga0265316_10332719
386 Ga0307408_101248069
387 Ga0316575_10047473
388 Ga0316575_10243020
389 Ga0316578_10478202
390 Ga0307407_11178732
391 Ga0316574_0141406
392 Ga0316574_0338252
393 Ga0316574_0628224
394 Ga0316582_0625970
395 Ga0316582_0724923
396 Ga0316584_0114359
397 Ga0451577_0003347
398 Ga0451577_0214167
399 Ga0451577_0414019
400 Ga0451577_0453777
401 Ga0451577_0497453
402 Ga0451577_0963923
403 Ga0451577_0984576
404 Ga0451577_1389553
405 Ga0451577_1742251
406 Ga0453683_0000733
407 Ga0453683_0008926
408 Ga0453683_0017255
409 Ga0453683_0082175
410 Ga0453683_0092663
411 Ga0453683_0252349
412 Ga0453683_0628925
413 Ga0453684_0000125
414 Ga0453684_0006242
415 Ga0453684_0009565
416 Ga0453684_0015944
417 Ga0453684_0030188
418 Ga0453684_0044246
419 Ga0453684_0057472
420 Ga0453684_0062133
421 Ga0453684_0067859
422 Ga0453684_0072474
423 Ga0453684_0094179
424 Ga0453684_0192998
425 Ga0453684_0198953
426 Ga0453684_0228291
427 Ga0453684_0297703
428 Ga0453684_0306231
429 Ga0453684_0322547
430 Ga0453684_0326643
431 Ga0453684_0357365
432 Ga0453684_0385460
433 Ga0453684_0403623
434 Ga0453684_0476468
435 Ga0453684_0481819
436 Ga0453684_0511619
437 Ga0453684_0555902
438 Ga0453684_0637857
439 Ga0453684_0654931
440 Ga0453684_0705736
441 Ga0453684_0826252
442 Ga0453684_0843046
443 Ga0453684_0910992
444 Ga0453684_1104486
445 Ga0451576_0012799
446 Ga0451576_0060452
447 Ga0451576_0159644
448 Ga0451576_0186293
449 Ga0451576_0218963
450 Ga0451576_0284263
451 Ga0451576_0458161
452 Ga0451576_1005060
453 Ga0451576_1005977
454 Ga0451576_1202544
455 Ga0496104_0817168
456 Ga0496105_0664450
457 Ga0496106_0437339
458 Ga0496110_0202465
459 Ga0501299_004913
460 Ga0501037_0738356
461 Ga0501039_0949851
462 Ga0501048_0271242
463 Ga0501048_1082538
464 Ga0501068_0192230
465 Ga0501071_0089283
466 Ga0501071_1059109
467 Ga0501072_0116553
468 Ga0501072_0387753
469 Ga0501073_0099701
470 Ga0501074_0313470
471 Ga0501075_0003026
472 Ga0501075_0295857
473 Ga0501076_0005344
474 Ga0501227_015441
475 Ga0501079_0071733
476 Ga0501079_0487931
477 Ga0501080_0077245
478 Ga0501080_0080859
479 Ga0501081_0404747
480 Ga0501081_0494657
481 Ga0501083_0313288
482 nmdc:mga05p37_148_c1
483 nmdc:mga05p37_4632_c1
484 nmdc:mga05p37_696425_c1
485 nmdc:mga05p37_70516_c1
486 nmdc:mga09592_109783_c1
487 nmdc:mga09592_116362_c1
488 nmdc:mga09592_144919_c1
489 nmdc:mga09592_169971_c1
490 nmdc:mga09592_4025_c1
491 nmdc:mga09592_4732_c1
492 nmdc:mga09592_804239_c1
493 nmdc:mga0qj67_1207389_c1
494 nmdc:mga0qj67_1222331_c1
495 nmdc:mga06r32_306313_c1
496 nmdc:mga06r32_469374_c1
497 nmdc:mga08y16_34178_c1
498 nmdc:mga0a205_388937_c1
499 Ga0501084_0050795
500 Ga0501084_0394582
501 Ga0501084_0838142
502 Ga0501084_0992683
503 Ga0501082_0757193
504 Ga0501082_0773249
505 Ga0501082_0863423
506 Ga0501082_1161398

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

47

171

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y81-assembly1.cif.gz_A conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus 0.9191 15 136
3q9u-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.8725 1 136
3q9n-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.8717 3 136
1y81-assembly1.cif.gz_A conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus 0.8675 15 136
3q9n-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.8662 3 141
ID Description Score Start End Superfamily
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9191 15 136 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8745 15 136 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8717 3 136 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8662 1 136 3.40.50.720
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.861 14 136 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C3KKW4-F1-model_v4 CoA-binding protein 0.9923 1 163
AF-A0A419EA62-F1-model_v4 CoA-binding protein 0.9919 1 163
AF-A0A7C3KKW4-F1-model_v4 CoA-binding protein 0.9863 1 163
AF-A0A419EA62-F1-model_v4 CoA-binding protein 0.9859 1 163
AF-A0A1F8KFS4-F1-model_v4 CoA-binding domain-containing protein 0.984 1 163

Map