F363865

General Info

Members Datasets Scaffolds Average Seq Length
253 173 252 235

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100107100|Ga0070708_1001071003
Length 272
Sequence MSTPALGRIIMWTSRPKGRNEDSVREWRMKGAGGEAAYGSRVALVTGANRGLGLETCRQLLARGLRVVMTGRNEDATKQALRGIGQTREGGKAIALRLDVTDPASIEAARGAAEEQLGAIDVLVNNAALLLFEDGDVLSIPKEGFQRTLETNLLGVIETCRVFVPPMAARGHGRVVNVSSGVGQLAKLSTYAPAYAISKVALNALTRILSETYRDRGVLVNAVNPGWVRTDMGGPEAPRSVEQGVDTAVWLATLPDDGPSGAFFRDRQRIEW

Samples

Sample ID Description Type Environment
1 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.4
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.35
Nodule 0
Rhizoplane 3.95
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10073573 3300005290 Bacteria 4343
2 Ga0065715_10093909 3300005293 Bacteria 4487
3 Ga0070670_100030996 3300005331 Bacteria 4605
4 Ga0070666_10326939 3300005335 Unclassified 1094
5 Ga0070680_100151461 3300005336 Bacteria 1947
6 Ga0070682_100003684 3300005337 Bacteria 8509
7 Ga0070660_100018561 3300005339 Bacteria 5084
8 Ga0070660_100288494 3300005339 Bacteria 1344
9 Ga0070689_100005233 3300005340 Bacteria 8839
10 Ga0070691_10010837 3300005341 Bacteria 4160
11 Ga0070687_100094149 3300005343 Bacteria 1663
12 Ga0070668_100336572 3300005347 Unclassified 1274
13 Ga0070668_100837101 3300005347 Bacteria 819
14 Ga0070669_100242694 3300005353 Bacteria 1432
15 Ga0070671_100086090 3300005355 Bacteria 2629
16 Ga0070673_100300946 3300005364 Bacteria 1412
17 Ga0070659_100265748 3300005366 Bacteria 1424
18 Ga0070709_10125160 3300005434 Bacteria 1748
19 Ga0070705_100008940 3300005440 Bacteria 4966
20 Ga0070705_100121306 3300005440 Bacteria 1688
21 Ga0070700_100014980 3300005441 Bacteria 4385
22 Ga0070694_100102165 3300005444 Bacteria 2030
23 Ga0070694_100381618 3300005444 Bacteria 1099
24 Ga0070708_100107100 3300005445 Unclassified 2566
25 Ga0070681_10001424 3300005458 Bacteria 21046
26 Ga0070681_10016143 3300005458 Bacteria 7444
27 Ga0068867_100148275 3300005459 Bacteria 1840
28 Ga0070685_10161354 3300005466 Bacteria 1429
29 Ga0070707_100235792 3300005468 Bacteria 1781
30 Ga0070679_100170561 3300005530 Unclassified 2149
31 Ga0070679_100533412 3300005530 Bacteria 1117
32 Ga0068853_100027935 3300005539 Bacteria 4744
33 Ga0070672_100026175 3300005543 Bacteria 4336
34 Ga0070696_100010271 3300005546 Bacteria 6266
35 Ga0070696_100107499 3300005546 Bacteria 2006
36 Ga0070693_100002160 3300005547 Bacteria 9017
37 Ga0070665_100539142 3300005548 Bacteria 1179
38 Ga0070704_100081172 3300005549 Bacteria 2388
39 Ga0070664_100131093 3300005564 Bacteria 2202
40 Ga0068857_100043957 3300005577 Bacteria 3962
41 Ga0068857_100134266 3300005577 Bacteria 2234
42 Ga0068857_100192446 3300005577 Unclassified 1858
43 Ga0068852_100560897 3300005616 Bacteria 1143
44 Ga0068861_100016922 3300005719 Bacteria 5169
45 Ga0068863_100100669 3300005841 Bacteria 2747
46 Ga0068860_100036481 3300005843 Bacteria 4710
47 Ga0068860_100115549 3300005843 Bacteria 2567
48 Ga0075362_10038996 3300006177 Bacteria 2087
49 Ga0075367_10000462 3300006178 Bacteria 15113
50 Ga0075367_10085074 3300006178 Unclassified 1919
51 Ga0075366_10002378 3300006195 Bacteria 9644
52 Ga0075428_100426260 3300006844 Bacteria 1421
53 Ga0075430_100015109 3300006846 Bacteria 6572
54 Ga0075431_100020514 3300006847 Bacteria 6752
55 Ga0075431_100705153 3300006847 Bacteria 987
56 Ga0075433_10081117 3300006852 Bacteria 2860
57 Ga0075433_10309705 3300006852 Bacteria 1398
58 Ga0075434_100021841 3300006871 Bacteria 6228
59 Ga0075434_100198325 3300006871 Bacteria 2027
60 Ga0075429_100009566 3300006880 Bacteria 8409
61 Ga0075429_100047758 3300006880 Bacteria 3723
62 Ga0075429_100062338 3300006880 Bacteria 3249
63 Ga0075435_100054868 3300007076 Bacteria 3217
64 Ga0075435_100351042 3300007076 Bacteria 1264
65 Ga0105240_10088097 3300009093 Bacteria 3799
66 Ga0105240_10159908 3300009093 Bacteria 2676
67 Ga0111539_10003879 3300009094 Bacteria 19686
68 Ga0111539_10008615 3300009094 Bacteria 12956
69 Ga0111539_10082832 3300009094 Bacteria 3773
70 Ga0114129_10000558 3300009147 Bacteria 45754
71 Ga0114129_10002782 3300009147 Bacteria 24386
72 Ga0114129_10006045 3300009147 Bacteria 17165
73 Ga0114129_10033046 3300009147 Bacteria 7311
74 Ga0114129_10384213 3300009147 Bacteria 1854
75 Ga0105243_10004699 3300009148 Bacteria 10751
76 Ga0105241_10022560 3300009174 Bacteria 4663
77 Ga0105248_11022735 3300009177 Bacteria 933
78 Ga0105237_10169672 3300009545 Unclassified 2182
79 Ga0105237_11036132 3300009545 Bacteria 827
80 Ga0105238_10213932 3300009551 Bacteria 1904
81 Ga0105249_10350904 3300009553 Bacteria 1495
82 Ga0105239_10124154 3300010375 Bacteria 2868
83 Ga0105239_10237615 3300010375 Bacteria 2045
84 Ga0105246_10235939 3300011119 Bacteria 1443
85 Ga0157373_10040416 3300013100 Bacteria 3337
86 Ga0163162_10072916 3300013306 Bacteria 3488
87 Ga0157375_10099021 3300013308 Bacteria 2994
88 Ga0157375_10805765 3300013308 Bacteria 1088
89 Ga0163163_10014515 3300014325 Bacteria 7245
90 Ga0157380_10019800 3300014326 Bacteria 5020
91 Ga0157379_10287417 3300014968 Bacteria 1497
92 Ga0157376_10083967 3300014969 Bacteria 2741
93 Ga0206354_10801281 3300020081 Bacteria 1879
94 Ga0207699_10083828 3300025906 Bacteria 1984
95 Ga0207707_10006011 3300025912 Bacteria 10622
96 Ga0207671_10005336 3300025914 Bacteria 11895
97 Ga0207660_10295004 3300025917 Bacteria 1290
98 Ga0207662_10008495 3300025918 Bacteria 5624
99 Ga0207657_10034773 3300025919 Bacteria 4526
100 Ga0207652_10036622 3300025921 Unclassified 4148
101 Ga0207652_10081130 3300025921 Bacteria 2837
102 Ga0207646_10175872 3300025922 Bacteria 1933
103 Ga0207681_10231377 3300025923 Bacteria 1435
104 Ga0207650_10018389 3300025925 Bacteria 4905
105 Ga0207650_10036229 3300025925 Bacteria 3588
106 Ga0207644_10059484 3300025931 Bacteria 2763
107 Ga0207690_10004746 3300025932 Bacteria 8024
108 Ga0207690_10264536 3300025932 Bacteria 1334
109 Ga0207704_10029788 3300025938 Bacteria 3050
110 Ga0207691_10013196 3300025940 Bacteria 7911
111 Ga0207651_10281322 3300025960 Bacteria 1375
112 Ga0207658_10073909 3300025986 Bacteria 2589
113 Ga0207703_10068040 3300026035 Bacteria 2933
114 Ga0207639_10613280 3300026041 Bacteria 1004
115 Ga0207678_10000075 3300026067 Bacteria 79006
116 Ga0207708_10007701 3300026075 Bacteria 7973
117 Ga0207641_10730737 3300026088 Bacteria 976
118 Ga0207648_10005646 3300026089 Bacteria 12562
119 Ga0207674_10025547 3300026116 Bacteria 6296
120 Ga0207674_10052733 3300026116 Bacteria 4147
121 Ga0207674_10145649 3300026116 Unclassified 2327
122 Ga0207675_100013974 3300026118 Bacteria 7486
123 Ga0207698_10773100 3300026142 Bacteria 961
124 Ga0207428_10001854 3300027907 Bacteria 21608
125 Ga0207428_10008791 3300027907 Bacteria 9107
126 Ga0268266_10460491 3300028379 Bacteria 1210
127 Ga0268265_10069655 3300028380 Bacteria 2732
128 Ga0268264_10026678 3300028381 Bacteria 4721
129 Ga0268264_10431330 3300028381 Bacteria 1273
130 Ga0268264_10891382 3300028381 Bacteria 892
131 Ga0307515_10197614 3300028794 Bacteria 1898
132 Ga0265327_10030476 3300031251 Bacteria 3049
133 Ga0265327_10042185 3300031251 Bacteria 2452
134 Ga0307408_100011682 3300031548 Bacteria 5806
135 Ga0307408_100045732 3300031548 Unclassified 3128
136 Ga0307405_10045435 3300031731 Bacteria 2691
137 Ga0307405_10334370 3300031731 Bacteria 1162
138 Ga0307405_10477224 3300031731 Bacteria 995
139 Ga0307413_10305992 3300031824 Bacteria 1208
140 Ga0307410_10021897 3300031852 Bacteria 3940
141 Ga0307416_100086541 3300032002 Bacteria 2672
142 Ga0307414_10141382 3300032004 Unclassified 1885
143 Ga0307411_10003665 3300032005 Bacteria 7187
144 Ga0373935_0146165 3300035692 Bacteria 1601
145 Ga0373937_0173924 3300036401 Bacteria 2021
146 Ga0395899_0114792 3300037312 Bacteria 1933
147 Ga0395900_0330919 3300037418 Bacteria 1501
148 Ga0395898_0049468 3300037466 Bacteria 4119
149 Ga0395898_0129305 3300037466 Bacteria 2419
150 Ga0395905_0012212 3300037471 Bacteria 8273
151 Ga0395901_0622709 3300038443 Bacteria 1086
152 Ga0395901_0844185 3300038443 Bacteria 902
153 Ga0439436_0129220 3300041404 Bacteria 708
154 Ga0451577_0068821 3300042876 Bacteria 3157
155 Ga0451577_0446198 3300042876 Bacteria 1175
156 Ga0453684_0781168 3300044712 Unclassified 1031
157 Ga0451576_0378357 3300045051 Bacteria 1484
158 Ga0451576_0430053 3300045051 Bacteria 1385
159 Ga0451576_0543744 3300045051 Bacteria 1220
160 Ga0495584_0205408 3300046491 Bacteria 1001
161 Ga0495663_0066512 3300046525 Bacteria 1141
162 Ga0495669_0010067 3300046684 Bacteria 3993
163 Ga0496102_0003831 3300048905 Bacteria 12726
164 Ga0496103_0001923 3300048906 Bacteria 13486
165 Ga0496104_0027703 3300048907 Bacteria 5246
166 Ga0496104_0396796 3300048907 Bacteria 1292
167 Ga0496105_0323733 3300048908 Bacteria 1235
168 Ga0496106_0004868 3300048909 Bacteria 9940
169 Ga0496107_0136160 3300048910 Bacteria 1814
170 Ga0496108_0142104 3300048911 Unclassified 2068
171 Ga0496110_0627961 3300048913 Unclassified 973
172 Ga0496112_0264350 3300048915 Bacteria 1669
173 Ga0501034_0000076 3300049571 Bacteria 174683
174 Ga0501034_0011405 3300049571 Bacteria 9214
175 Ga0501034_0013364 3300049571 Bacteria 8453
176 Ga0501036_0135902 3300049572 Bacteria 2075
177 Ga0501037_0006877 3300049573 Bacteria 8308
178 Ga0501038_0008951 3300049574 Bacteria 9184
179 Ga0501039_0000746 3300049575 Bacteria 23377
180 Ga0501039_0139604 3300049575 Bacteria 1904
181 Ga0501040_0050747 3300049576 Bacteria 2838
182 Ga0501041_0175494 3300049577 Bacteria 1341
183 Ga0501043_0118454 3300049579 Bacteria 2077
184 Ga0501046_0017034 3300049580 Bacteria 6075
185 Ga0501046_0041912 3300049580 Bacteria 3651
186 Ga0501047_0000130 3300049581 Bacteria 91144
187 Ga0501047_0103600 3300049581 Bacteria 2726
188 Ga0501047_0194088 3300049581 Bacteria 1893
189 Ga0501048_0000043 3300049582 Bacteria 61640
190 Ga0501048_0148058 3300049582 Bacteria 1660
191 Ga0501067_0006686 3300049583 Bacteria 6400
192 Ga0501067_0264012 3300049583 Bacteria 958
193 Ga0501070_0033255 3300049586 Bacteria 4315
194 Ga0501071_0059041 3300049587 Bacteria 2775
195 Ga0501071_0121125 3300049587 Bacteria 1939
196 Ga0501072_0043561 3300049588 Bacteria 3527
197 Ga0501072_0230329 3300049588 Bacteria 1476
198 Ga0501073_0176273 3300049589 Unclassified 1480
199 Ga0501073_0200740 3300049589 Bacteria 1379
200 Ga0501074_0134318 3300049590 Bacteria 1770
201 Ga0501074_0379381 3300049590 Bacteria 1003
202 Ga0501075_0020764 3300049591 Bacteria 4781
203 Ga0501076_0180474 3300049592 Bacteria 1721
204 Ga0501076_0277668 3300049592 Bacteria 1372
205 Ga0501077_0273927 3300049593 Unclassified 1074
206 Ga0501079_0054761 3300049741 Bacteria 3077
207 Ga0501080_0000004 3300049742 Bacteria 180905
208 Ga0501080_0653879 3300049742 Bacteria 930
209 Ga0501081_0096896 3300049743 Bacteria 2081
210 Ga0501083_0019918 3300049744 Bacteria 4669
211 Ga0501035_0000191 3300049822 Bacteria 75056
212 Ga0501035_0323213 3300049822 Bacteria 1296
213 Ga0501035_0658606 3300049822 Unclassified 848
214 Ga0501044_0000227 3300049823 Bacteria 70875
215 Ga0501045_0087226 3300049824 Bacteria 2304
216 Ga0501045_0184534 3300049824 Bacteria 1554
217 nmdc:mga03683_16040_c1 3300050489 Bacteria 2806
218 nmdc:mga00v17_11462_c1 3300050491 Bacteria 4872
219 nmdc:mga0yw44_14823_c1 3300050492 Bacteria 4153
220 nmdc:mga0k408_292094_c1 3300050493 Bacteria 973
221 nmdc:mga0k408_969_c1 3300050493 Bacteria 15769
222 nmdc:mga05p37_292231_c1 3300050507 Bacteria 1939
223 nmdc:mga05p37_3376_c1 3300050507 Bacteria 18634
224 nmdc:mga05p37_596022_c1 3300050507 Bacteria 1248
225 nmdc:mga09592_137157_c1 3300050508 Bacteria 2107
226 nmdc:mga09592_41295_c1 3300050508 Bacteria 3878
227 nmdc:mga09592_6017_c1 3300050508 Bacteria 9896
228 nmdc:mga0qj67_271536_c1 3300050509 Bacteria 1375
229 nmdc:mga0qj67_4554_c1 3300050509 Bacteria 10047
230 nmdc:mga06r32_150129_c1 3300050510 Bacteria 2308
231 nmdc:mga06r32_162715_c1 3300050510 Unclassified 2214
232 nmdc:mga06r32_387320_c1 3300050510 Bacteria 1380
233 nmdc:mga08y16_512_c1 3300050511 Bacteria 35786
234 nmdc:mga08y16_59835_c1 3300050511 Bacteria 3979
235 nmdc:mga08y16_72900_c1 3300050511 Bacteria 3579
236 nmdc:mga0n895_273801_c1 3300050512 Bacteria 1712
237 nmdc:mga0n895_320036_c1 3300050512 Bacteria 1572
238 nmdc:mga0rr50_2102_c1 3300050513 Bacteria 11130
239 nmdc:mga08x19_269918_c1 3300050514 Bacteria 1177
240 nmdc:mga0a205_171216_c1 3300050515 Bacteria 2067
241 nmdc:mga0a205_524236_c1 3300050515 Bacteria 1041
242 nmdc:mga0a205_56687_c1 3300050515 Bacteria 3782
243 Ga0500568_0002910 3300053139 Bacteria 9816
244 Ga0500616_0011131 3300053153 Bacteria 5340
245 Ga0501084_0094679 3300054114 Unclassified 2508
246 Ga0501084_0207322 3300054114 Unclassified 1654
247 Ga0501084_0359284 3300054114 Unclassified 1231
248 Ga0501082_0005898 3300060353 Bacteria 10627
249 Ga0501082_0086316 3300060353 Bacteria 2707
250 Ga0501082_0547392 3300060353 Bacteria 1012
251 Ga0530510_0475005 3300061734 Unclassified 947
252 Ga0530510_0588650 3300061734 Bacteria 846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006178 Ga0075367_10000462 Ga0075367_100004628 202
2 3300006195 Ga0075366_10002378 Ga0075366_100023788 202
3 3300009545 Ga0105237_11036132 Ga0105237_110361321 202
4 3300027907 Ga0207428_10001854 Ga0207428_1000185412 202
5 3300049822 Ga0501035_0658606 Ga0501035_0658606_13_621 202
6 3300050493 nmdc:mga0k408_292094_c1 nmdc:mga0k408_292094_c1_11_622 202
7 3300060353 Ga0501082_0547392 Ga0501082_0547392_386_994 202
8 3300014325 Ga0163163_10014515 Ga0163163_100145151 204
9 3300025925 Ga0207650_10036229 Ga0207650_100362294 204
10 3300050510 nmdc:mga06r32_150129_c1 nmdc:mga06r32_150129_c1_496_1212 205
11 3300009094 Ga0111539_10082832 Ga0111539_100828321 206
12 3300050511 nmdc:mga08y16_59835_c1 nmdc:mga08y16_59835_c1_355_975 206
13 3300050515 nmdc:mga0a205_524236_c1 nmdc:mga0a205_524236_c1_17_637 206
14 3300028794 Ga0307515_10197614 Ga0307515_101976142 208
15 3300006847 Ga0075431_100020514 Ga0075431_1000205143 210
16 3300006880 Ga0075429_100009566 Ga0075429_1000095666 210
17 3300027907 Ga0207428_10008791 Ga0207428_100087913 210
18 3300031731 Ga0307405_10045435 Ga0307405_100454353 210
19 3300050508 nmdc:mga09592_6017_c1 nmdc:mga09592_6017_c1_21_656 210
20 3300009093 Ga0105240_10159908 Ga0105240_101599082 212
21 3300041404 Ga0439436_0129220 Ga0439436_0129220_36_689 217
22 3300048911 Ga0496108_0142104 Ga0496108_0142104_585_1238 217
23 3300031251 Ga0265327_10030476 Ga0265327_100304764 219
24 3300031251 Ga0265327_10042185 Ga0265327_100421852 219
25 3300048907 Ga0496104_0396796 Ga0496104_0396796_14_673 219
26 3300050514 nmdc:mga08x19_269918_c1 nmdc:mga08x19_269918_c1_217_876 219
27 3300031852 Ga0307410_10021897 Ga0307410_100218973 222
28 iso_pu_bacteria 2919688452 2919690444 222
29 3300020081 Ga0206354_10801281 Ga0206354_108012812 223
30 3300037312 Ga0395899_0114792 Ga0395899_0114792_866_1543 223
31 3300037466 Ga0395898_0129305 Ga0395898_0129305_737_1414 223
32 3300037471 Ga0395905_0012212 Ga0395905_0012212_6023_6700 223
33 3300005547 Ga0070693_100002160 Ga0070693_1000021602 224
34 3300031548 Ga0307408_100011682 Ga0307408_1000116823 224
35 3300032005 Ga0307411_10003665 Ga0307411_100036658 224
36 3300049571 Ga0501034_0013364 Ga0501034_0013364_3164_3847 226
37 3300049587 Ga0501071_0121125 Ga0501071_0121125_243_923 226
38 3300049588 Ga0501072_0043561 Ga0501072_0043561_1081_1761 226
39 3300049590 Ga0501074_0134318 Ga0501074_0134318_1055_1735 226
40 3300049741 Ga0501079_0054761 Ga0501079_0054761_2013_2693 226
41 3300049743 Ga0501081_0096896 Ga0501081_0096896_791_1471 226
42 3300049824 Ga0501045_0087226 Ga0501045_0087226_949_1629 226
43 3300054114 Ga0501084_0359284 Ga0501084_0359284_319_999 226
44 3300005577 Ga0068857_100192446 Ga0068857_1001924461 227
45 3300026116 Ga0207674_10145649 Ga0207674_101456491 227
46 3300005343 Ga0070687_100094149 Ga0070687_1000941491 229
47 3300005355 Ga0070671_100086090 Ga0070671_1000860902 229
48 3300006880 Ga0075429_100047758 Ga0075429_1000477582 229
49 3300014326 Ga0157380_10019800 Ga0157380_100198003 229
50 3300025931 Ga0207644_10059484 Ga0207644_100594842 229
51 3300044712 Ga0453684_0781168 Ga0453684_0781168_102_812 229
52 3300049592 Ga0501076_0180474 Ga0501076_0180474_883_1572 229
53 3300028381 Ga0268264_10891382 Ga0268264_108913821 231
54 3300049571 Ga0501034_0011405 Ga0501034_0011405_7983_8690 231
55 3300049575 Ga0501039_0139604 Ga0501039_0139604_1025_1732 231
56 3300049580 Ga0501046_0041912 Ga0501046_0041912_2644_3351 231
57 3300049581 Ga0501047_0103600 Ga0501047_0103600_1796_2503 231
58 3300049581 Ga0501047_0194088 Ga0501047_0194088_303_1010 231
59 3300049583 Ga0501067_0264012 Ga0501067_0264012_55_762 231
60 3300049588 Ga0501072_0230329 Ga0501072_0230329_194_889 231
61 3300049589 Ga0501073_0200740 Ga0501073_0200740_321_1028 231
62 3300049742 Ga0501080_0653879 Ga0501080_0653879_107_802 231
63 3300050509 nmdc:mga0qj67_271536_c1 nmdc:mga0qj67_271536_c1_481_1200 231
64 3300054114 Ga0501084_0094679 Ga0501084_0094679_1468_2166 231
65 3300061734 Ga0530510_0475005 Ga0530510_0475005_88_792 231
66 3300005440 Ga0070705_100121306 Ga0070705_1001213062 232
67 3300005546 Ga0070696_100107499 Ga0070696_1001074992 232
68 3300006178 Ga0075367_10085074 Ga0075367_100850742 232
69 3300006847 Ga0075431_100705153 Ga0075431_1007051531 232
70 3300006880 Ga0075429_100062338 Ga0075429_1000623382 232
71 3300009147 Ga0114129_10000558 Ga0114129_1000055821 232
72 3300009147 Ga0114129_10006045 Ga0114129_100060453 232
73 3300025922 Ga0207646_10175872 Ga0207646_101758722 232
74 3300032002 Ga0307416_100086541 Ga0307416_1000865413 232
75 3300050510 nmdc:mga06r32_387320_c1 nmdc:mga06r32_387320_c1_442_1143 232
76 3300005290 Ga0065712_10073573 Ga0065712_100735731 233
77 3300005293 Ga0065715_10093909 Ga0065715_100939092 233
78 3300005331 Ga0070670_100030996 Ga0070670_1000309963 233
79 3300005335 Ga0070666_10326939 Ga0070666_103269391 233
80 3300005336 Ga0070680_100151461 Ga0070680_1001514611 233
81 3300005337 Ga0070682_100003684 Ga0070682_1000036849 233
82 3300005339 Ga0070660_100018561 Ga0070660_1000185615 233
83 3300005339 Ga0070660_100288494 Ga0070660_1002884942 233
84 3300005340 Ga0070689_100005233 Ga0070689_1000052332 233
85 3300005341 Ga0070691_10010837 Ga0070691_100108373 233
86 3300005347 Ga0070668_100336572 Ga0070668_1003365722 233
87 3300005347 Ga0070668_100837101 Ga0070668_1008371011 233
88 3300005353 Ga0070669_100242694 Ga0070669_1002426941 233
89 3300005364 Ga0070673_100300946 Ga0070673_1003009462 233
90 3300005366 Ga0070659_100265748 Ga0070659_1002657482 233
91 3300005434 Ga0070709_10125160 Ga0070709_101251602 233
92 3300005440 Ga0070705_100008940 Ga0070705_1000089401 233
93 3300005441 Ga0070700_100014980 Ga0070700_1000149802 233
94 3300005444 Ga0070694_100102165 Ga0070694_1001021651 233
95 3300005444 Ga0070694_100381618 Ga0070694_1003816181 233
96 3300005445 Ga0070708_100107100 Ga0070708_1001071003 233
97 3300005458 Ga0070681_10001424 Ga0070681_1000142411 233
98 3300005458 Ga0070681_10016143 Ga0070681_100161437 233
99 3300005459 Ga0068867_100148275 Ga0068867_1001482752 233
100 3300005466 Ga0070685_10161354 Ga0070685_101613542 233
101 3300005468 Ga0070707_100235792 Ga0070707_1002357922 233
102 3300005530 Ga0070679_100170561 Ga0070679_1001705612 233
103 3300005530 Ga0070679_100533412 Ga0070679_1005334122 233
104 3300005539 Ga0068853_100027935 Ga0068853_1000279353 233
105 3300005543 Ga0070672_100026175 Ga0070672_1000261752 233
106 3300005546 Ga0070696_100010271 Ga0070696_1000102714 233
107 3300005548 Ga0070665_100539142 Ga0070665_1005391422 233
108 3300005549 Ga0070704_100081172 Ga0070704_1000811722 233
109 3300005564 Ga0070664_100131093 Ga0070664_1001310932 233
110 3300005577 Ga0068857_100043957 Ga0068857_1000439572 233
111 3300005577 Ga0068857_100134266 Ga0068857_1001342663 233
112 3300005616 Ga0068852_100560897 Ga0068852_1005608972 233
113 3300005719 Ga0068861_100016922 Ga0068861_1000169222 233
114 3300005841 Ga0068863_100100669 Ga0068863_1001006692 233
115 3300005843 Ga0068860_100036481 Ga0068860_1000364813 233
116 3300005843 Ga0068860_100115549 Ga0068860_1001155492 233
117 3300006177 Ga0075362_10038996 Ga0075362_100389962 233
118 3300006844 Ga0075428_100426260 Ga0075428_1004262602 233
119 3300006846 Ga0075430_100015109 Ga0075430_1000151098 233
120 3300006852 Ga0075433_10081117 Ga0075433_100811172 233
121 3300006852 Ga0075433_10309705 Ga0075433_103097051 233
122 3300006871 Ga0075434_100021841 Ga0075434_1000218416 233
123 3300006871 Ga0075434_100198325 Ga0075434_1001983252 233
124 3300007076 Ga0075435_100054868 Ga0075435_1000548683 233
125 3300007076 Ga0075435_100351042 Ga0075435_1003510422 233
126 3300009093 Ga0105240_10088097 Ga0105240_100880972 233
127 3300009094 Ga0111539_10003879 Ga0111539_100038798 233
128 3300009094 Ga0111539_10008615 Ga0111539_100086152 233
129 3300009147 Ga0114129_10002782 Ga0114129_100027828 233
130 3300009147 Ga0114129_10033046 Ga0114129_100330463 233
131 3300009147 Ga0114129_10384213 Ga0114129_103842132 233
132 3300009148 Ga0105243_10004699 Ga0105243_100046998 233
133 3300009174 Ga0105241_10022560 Ga0105241_100225602 233
134 3300009177 Ga0105248_11022735 Ga0105248_110227351 233
135 3300009545 Ga0105237_10169672 Ga0105237_101696723 233
136 3300009551 Ga0105238_10213932 Ga0105238_102139322 233
137 3300009553 Ga0105249_10350904 Ga0105249_103509041 233
138 3300010375 Ga0105239_10124154 Ga0105239_101241541 233
139 3300010375 Ga0105239_10237615 Ga0105239_102376152 233
140 3300011119 Ga0105246_10235939 Ga0105246_102359391 233
141 3300013100 Ga0157373_10040416 Ga0157373_100404163 233
142 3300013306 Ga0163162_10072916 Ga0163162_100729161 233
143 3300013308 Ga0157375_10099021 Ga0157375_100990212 233
144 3300013308 Ga0157375_10805765 Ga0157375_108057651 233
145 3300014968 Ga0157379_10287417 Ga0157379_102874172 233
146 3300014969 Ga0157376_10083967 Ga0157376_100839673 233
147 3300025906 Ga0207699_10083828 Ga0207699_100838282 233
148 3300025912 Ga0207707_10006011 Ga0207707_100060118 233
149 3300025914 Ga0207671_10005336 Ga0207671_100053368 233
150 3300025917 Ga0207660_10295004 Ga0207660_102950041 233
151 3300025918 Ga0207662_10008495 Ga0207662_100084954 233
152 3300025919 Ga0207657_10034773 Ga0207657_100347734 233
153 3300025921 Ga0207652_10036622 Ga0207652_100366223 233
154 3300025921 Ga0207652_10081130 Ga0207652_100811302 233
155 3300025923 Ga0207681_10231377 Ga0207681_102313771 233
156 3300025925 Ga0207650_10018389 Ga0207650_100183892 233
157 3300025932 Ga0207690_10004746 Ga0207690_100047463 233
158 3300025932 Ga0207690_10264536 Ga0207690_102645361 233
159 3300025938 Ga0207704_10029788 Ga0207704_100297883 233
160 3300025940 Ga0207691_10013196 Ga0207691_100131963 233
161 3300025960 Ga0207651_10281322 Ga0207651_102813222 233
162 3300025986 Ga0207658_10073909 Ga0207658_100739092 233
163 3300026035 Ga0207703_10068040 Ga0207703_100680404 233
164 3300026041 Ga0207639_10613280 Ga0207639_106132802 233
165 3300026067 Ga0207678_10000075 Ga0207678_1000007562 233
166 3300026075 Ga0207708_10007701 Ga0207708_100077013 233
167 3300026088 Ga0207641_10730737 Ga0207641_107307371 233
168 3300026089 Ga0207648_10005646 Ga0207648_100056462 233
169 3300026116 Ga0207674_10025547 Ga0207674_100255473 233
170 3300026116 Ga0207674_10052733 Ga0207674_100527335 233
171 3300026118 Ga0207675_100013974 Ga0207675_1000139744 233
172 3300026142 Ga0207698_10773100 Ga0207698_107731002 233
173 3300028379 Ga0268266_10460491 Ga0268266_104604912 233
174 3300028380 Ga0268265_10069655 Ga0268265_100696551 233
175 3300028381 Ga0268264_10026678 Ga0268264_100266783 233
176 3300028381 Ga0268264_10431330 Ga0268264_104313302 233
177 3300031548 Ga0307408_100045732 Ga0307408_1000457322 233
178 3300031731 Ga0307405_10334370 Ga0307405_103343701 233
179 3300031731 Ga0307405_10477224 Ga0307405_104772241 233
180 3300031824 Ga0307413_10305992 Ga0307413_103059921 233
181 3300032004 Ga0307414_10141382 Ga0307414_101413822 233
182 3300035692 Ga0373935_0146165 Ga0373935_0146165_703_1404 233
183 3300036401 Ga0373937_0173924 Ga0373937_0173924_1198_1956 233
184 3300037418 Ga0395900_0330919 Ga0395900_0330919_295_1035 233
185 3300037466 Ga0395898_0049468 Ga0395898_0049468_1991_2731 233
186 3300038443 Ga0395901_0622709 Ga0395901_0622709_305_1045 233
187 3300038443 Ga0395901_0844185 Ga0395901_0844185_52_762 233
188 3300042876 Ga0451577_0068821 Ga0451577_0068821_2247_2957 233
189 3300042876 Ga0451577_0446198 Ga0451577_0446198_322_1035 233
190 3300045051 Ga0451576_0378357 Ga0451576_0378357_343_1053 233
191 3300045051 Ga0451576_0430053 Ga0451576_0430053_239_952 233
192 3300045051 Ga0451576_0543744 Ga0451576_0543744_60_770 233
193 3300046491 Ga0495584_0205408 Ga0495584_0205408_237_944 233
194 3300046525 Ga0495663_0066512 Ga0495663_0066512_354_1061 233
195 3300046684 Ga0495669_0010067 Ga0495669_0010067_1866_2609 233
196 3300048905 Ga0496102_0003831 Ga0496102_0003831_4564_5289 233
197 3300048906 Ga0496103_0001923 Ga0496103_0001923_5597_6322 233
198 3300048907 Ga0496104_0027703 Ga0496104_0027703_21_746 233
199 3300048908 Ga0496105_0323733 Ga0496105_0323733_223_948 233
200 3300048909 Ga0496106_0004868 Ga0496106_0004868_4470_5195 233
201 3300048910 Ga0496107_0136160 Ga0496107_0136160_1022_1747 233
202 3300048913 Ga0496110_0627961 Ga0496110_0627961_41_742 233
203 3300048915 Ga0496112_0264350 Ga0496112_0264350_241_942 233
204 3300049571 Ga0501034_0000076 Ga0501034_0000076_21959_22699 233
205 3300049572 Ga0501036_0135902 Ga0501036_0135902_987_1727 233
206 3300049573 Ga0501037_0006877 Ga0501037_0006877_1316_2056 233
207 3300049574 Ga0501038_0008951 Ga0501038_0008951_4564_5304 233
208 3300049575 Ga0501039_0000746 Ga0501039_0000746_4903_5643 233
209 3300049576 Ga0501040_0050747 Ga0501040_0050747_1665_2375 233
210 3300049577 Ga0501041_0175494 Ga0501041_0175494_591_1301 233
211 3300049579 Ga0501043_0118454 Ga0501043_0118454_1036_1776 233
212 3300049580 Ga0501046_0017034 Ga0501046_0017034_4381_5121 233
213 3300049581 Ga0501047_0000130 Ga0501047_0000130_5729_6469 233
214 3300049582 Ga0501048_0000043 Ga0501048_0000043_44060_44791 233
215 3300049582 Ga0501048_0148058 Ga0501048_0148058_457_1197 233
216 3300049583 Ga0501067_0006686 Ga0501067_0006686_1276_2016 233
217 3300049586 Ga0501070_0033255 Ga0501070_0033255_428_1168 233
218 3300049587 Ga0501071_0059041 Ga0501071_0059041_959_1669 233
219 3300049589 Ga0501073_0176273 Ga0501073_0176273_617_1357 233
220 3300049590 Ga0501074_0379381 Ga0501074_0379381_263_973 233
221 3300049591 Ga0501075_0020764 Ga0501075_0020764_3307_4017 233
222 3300049592 Ga0501076_0277668 Ga0501076_0277668_638_1348 233
223 3300049593 Ga0501077_0273927 Ga0501077_0273927_18_752 233
224 3300049742 Ga0501080_0000004 Ga0501080_0000004_23337_24077 233
225 3300049744 Ga0501083_0019918 Ga0501083_0019918_2966_3682 233
226 3300049822 Ga0501035_0000191 Ga0501035_0000191_52887_53627 233
227 3300049822 Ga0501035_0323213 Ga0501035_0323213_550_1275 233
228 3300049823 Ga0501044_0000227 Ga0501044_0000227_22588_23328 233
229 3300049824 Ga0501045_0184534 Ga0501045_0184534_246_956 233
230 3300050489 nmdc:mga03683_16040_c1 nmdc:mga03683_16040_c1_900_1628 233
231 3300050491 nmdc:mga00v17_11462_c1 nmdc:mga00v17_11462_c1_2521_3249 233
232 3300050492 nmdc:mga0yw44_14823_c1 nmdc:mga0yw44_14823_c1_1830_2558 233
233 3300050493 nmdc:mga0k408_969_c1 nmdc:mga0k408_969_c1_5448_6176 233
234 3300050507 nmdc:mga05p37_292231_c1 nmdc:mga05p37_292231_c1_512_1222 233
235 3300050507 nmdc:mga05p37_3376_c1 nmdc:mga05p37_3376_c1_13447_14160 233
236 3300050507 nmdc:mga05p37_596022_c1 nmdc:mga05p37_596022_c1_69_794 233
237 3300050508 nmdc:mga09592_137157_c1 nmdc:mga09592_137157_c1_614_1327 233
238 3300050508 nmdc:mga09592_41295_c1 nmdc:mga09592_41295_c1_1235_1963 233
239 3300050509 nmdc:mga0qj67_4554_c1 nmdc:mga0qj67_4554_c1_2762_3475 233
240 3300050510 nmdc:mga06r32_162715_c1 nmdc:mga06r32_162715_c1_1204_1917 233
241 3300050511 nmdc:mga08y16_512_c1 nmdc:mga08y16_512_c1_25753_26466 233
242 3300050511 nmdc:mga08y16_72900_c1 nmdc:mga08y16_72900_c1_641_1369 233
243 3300050512 nmdc:mga0n895_273801_c1 nmdc:mga0n895_273801_c1_765_1496 233
244 3300050512 nmdc:mga0n895_320036_c1 nmdc:mga0n895_320036_c1_160_888 233
245 3300050513 nmdc:mga0rr50_2102_c1 nmdc:mga0rr50_2102_c1_8946_9674 233
246 3300050515 nmdc:mga0a205_171216_c1 nmdc:mga0a205_171216_c1_979_1689 233
247 3300050515 nmdc:mga0a205_56687_c1 nmdc:mga0a205_56687_c1_1367_2095 233
248 3300053139 Ga0500568_0002910 Ga0500568_0002910_7467_8177 233
249 3300053153 Ga0500616_0011131 Ga0500616_0011131_3966_4691 233
250 3300054114 Ga0501084_0207322 Ga0501084_0207322_789_1529 233
251 3300060353 Ga0501082_0005898 Ga0501082_0005898_8798_9538 233
252 3300060353 Ga0501082_0086316 Ga0501082_0086316_1096_1806 233
253 3300061734 Ga0530510_0588650 Ga0530510_0588650_45_755 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

240

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

47

252

0.9

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

43

226

0.77

PF08659

KR

KR domain

42

223

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9411 4 224
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9363 4 224
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9338 3 221
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9332 4 224
7djs-assembly1.cif.gz_A crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9319 4 224
ID Description Score Start End Superfamily
af_A4IB16_1_233_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9542 3 233 3.40.50.720
4e6pC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9499 4 192 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9417 4 183 3.40.50.720
af_A0A0R0IJI3_1_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9417 6 90 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9411 4 224 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V0Y2P2-F1-model_v4 SDR family oxidoreductase 0.9906 3 233 GO:0016616
AF-A0A7V0Y2P2-F1-model_v4 SDR family oxidoreductase 0.9864 3 233 GO:0016616
AF-A0A2V8EZL3-F1-model_v4 Short-chain dehydrogenase 0.9862 65 233 GO:0016491
AF-A0A6J6SUX9-F1-model_v4 Unannotated protein 0.9756 1 233 GO:0016491
AF-A0A2V8EZL3-F1-model_v4 Short-chain dehydrogenase 0.9748 65 233 GO:0016491

Feature Viewer

pLDDT pTM Quality
96.72 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map