F363625

General Info

Members Datasets Scaffolds Average Seq Length
252 174 504 157

Family's Representative Sequence

Representative Sequence 3300053158|Ga0500627_0135840|Ga0500627_0135840_331_816
Length 161
Sequence MTRKQRRLVLIGSSLGVLALAAFLILFALKDSIVFFNSPTDVVEKNLKPGTRIRLGGLVQTGTLTKQNLDTRFDVTDGKSVIHVSYRGILPDLFREGQGVVAEGVIENTTTFVADVVLAKHDETYMPKEVADALKKQGHWKDDYGKASGTKASGPAQGNKP

Samples

Sample ID Description Type Environment
1 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
75 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
76 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
77 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
78 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
80 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
81 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
82 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
97 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
98 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
99 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
100 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
101 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
102 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
162 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
163 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
164 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
165 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
166 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
167 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
170 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 1.98
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.7
Nodule 0.4
Rhizoplane 18.25
Rhizosphere 62.7
Stem 0
Stem Tuber 0
Unclassified 2.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500627_0135840 3300053158 Bacteria 1111
2 JGI25153J46596_10004860 3300003215 Bacteria 7156
3 JGI25153J46596_10005120 3300003215 Bacteria 6914
4 Ga0068868_100544802 3300005338 Bacteria 1022
5 Ga0070689_100164559 3300005340 Bacteria 1795
6 Ga0070689_100547342 3300005340 Bacteria 997
7 Ga0070691_10391229 3300005341 Bacteria 781
8 Ga0070687_100055250 3300005343 Bacteria 2073
9 Ga0070675_101099290 3300005354 Bacteria 731
10 Ga0070674_101233654 3300005356 Bacteria 665
11 Ga0070688_100218901 3300005365 Bacteria 1341
12 Ga0070688_100241281 3300005365 Bacteria 1283
13 Ga0070667_101375405 3300005367 Bacteria 662
14 Ga0070714_100399233 3300005435 Bacteria 1299
15 Ga0070711_100131872 3300005439 Bacteria 1862
16 Ga0070711_101392564 3300005439 Bacteria 610
17 Ga0070685_10109885 3300005466 Bacteria 1697
18 Ga0070699_101585677 3300005518 Bacteria 600
19 Ga0070679_100495985 3300005530 Bacteria 1165
20 Ga0070665_100286290 3300005548 Bacteria 1650
21 Ga0070702_100182087 3300005615 Bacteria 1376
22 Ga0068859_101541687 3300005617 Bacteria 734
23 Ga0068864_100323351 3300005618 Bacteria 1449
24 Ga0068860_100703066 3300005843 Bacteria 1021
25 Ga0081540_1143024 3300005983 Bacteria 957
26 Ga0081539_10002394 3300005985 Bacteria 26661
27 Ga0070717_10394804 3300006028 Bacteria 1242
28 Ga0070717_10710656 3300006028 Bacteria 913
29 Ga0070717_10820739 3300006028 Unclassified 846
30 Ga0075365_10046341 3300006038 Bacteria 2855
31 Ga0075368_10060389 3300006042 Bacteria 1517
32 Ga0070712_100000213 3300006175 Bacteria 32735
33 Ga0075367_10192700 3300006178 Bacteria 1272
34 Ga0075369_10044688 3300006186 Bacteria 1903
35 Ga0075366_10265602 3300006195 Bacteria 1048
36 Ga0075370_10061579 3300006353 Bacteria 2138
37 Ga0075370_10275501 3300006353 Bacteria 999
38 Ga0068871_100196521 3300006358 Bacteria 1740
39 Ga0075428_100419560 3300006844 Bacteria 1434
40 Ga0075430_100000182 3300006846 Bacteria 42018
41 Ga0075431_100104378 3300006847 Bacteria 2925
42 Ga0075431_100237605 3300006847 Bacteria 1855
43 Ga0075431_100409316 3300006847 Bacteria 1356
44 Ga0075431_100697615 3300006847 Bacteria 993
45 Ga0075434_100280849 3300006871 Bacteria 1685
46 Ga0075436_100003608 3300006914 Bacteria 10614
47 Ga0075436_100584204 3300006914 Bacteria 822
48 Ga0097620_101541508 3300006931 Bacteria 734
49 Ga0105245_10179258 3300009098 Bacteria 2023
50 Ga0105247_10571670 3300009101 Bacteria 834
51 Ga0105247_11005814 3300009101 Unclassified 651
52 Ga0114129_10143540 3300009147 Bacteria 3271
53 Ga0114129_10744429 3300009147 Bacteria 1255
54 Ga0114129_11741969 3300009147 Bacteria 759
55 Ga0105248_10087268 3300009177 Bacteria 3511
56 Ga0105249_10374168 3300009553 Bacteria 1449
57 Ga0105249_12230874 3300009553 Bacteria 620
58 Ga0105246_10246195 3300011119 Bacteria 1416
59 Ga0157374_10675921 3300013296 Bacteria 1045
60 Ga0163162_10449719 3300013306 Bacteria 1420
61 Ga0157380_10356131 3300014326 Bacteria 1371
62 Ga0157380_10468744 3300014326 Bacteria 1214
63 Ga0157380_11180295 3300014326 Bacteria 808
64 Ga0157380_12188582 3300014326 Bacteria 617
65 Ga0157377_10725432 3300014745 Unclassified 724
66 Ga0184600_141054 3300019190 Bacteria 723
67 Ga0213873_10230047 3300021358 Bacteria 583
68 Ga0213876_10344677 3300021384 Bacteria 792
69 Ga0247553_103412 3300023672 Bacteria 775
70 Ga0209758_1000063 3300025297 Bacteria 315999
71 Ga0207426_1052547 3300025302 Bacteria 1206
72 Ga0207692_10184474 3300025898 Unclassified 1217
73 Ga0207685_10258219 3300025905 Bacteria 845
74 Ga0207693_10000888 3300025915 Bacteria 26823
75 Ga0207663_10109650 3300025916 Bacteria 1871
76 Ga0207662_10004033 3300025918 Bacteria 7661
77 Ga0207681_10659018 3300025923 Bacteria 868
78 Ga0207687_10230875 3300025927 Bacteria 1462
79 Ga0207644_10089543 3300025931 Bacteria 2291
80 Ga0207690_10376859 3300025932 Bacteria 1127
81 Ga0207670_10033663 3300025936 Bacteria 3304
82 Ga0207670_10512670 3300025936 Bacteria 975
83 Ga0207669_10931365 3300025937 Bacteria 727
84 Ga0207665_10270010 3300025939 Bacteria 1263
85 Ga0207665_10281227 3300025939 Bacteria 1238
86 Ga0207677_11881828 3300026023 Bacteria 556
87 Ga0207641_10849808 3300026088 Bacteria 905
88 Ga0268266_10390192 3300028379 Bacteria 1315
89 Ga0268265_11956321 3300028380 Bacteria 593
90 Ga0265328_10000037 3300031239 Bacteria 93790
91 Ga0265331_10216557 3300031250 Bacteria 861
92 Ga0307513_10268880 3300031456 Bacteria 1489
93 Ga0307509_10414471 3300031507 Bacteria 1050
94 Ga0307509_10630761 3300031507 Bacteria 742
95 Ga0316575_10095775 3300031665 Bacteria 1204
96 Ga0316579_10303733 3300031691 Bacteria 771
97 Ga0316576_10368438 3300031727 Bacteria 1067
98 Ga0316578_10091728 3300031728 Bacteria 1814
99 Ga0316053_102880 3300032120 Bacteria 995
100 Ga0316053_109408 3300032120 Bacteria 671
101 Ga0316583_10001496 3300032133 Bacteria 7835
102 Ga0316585_10005306 3300032137 Bacteria 3632
103 Ga0316580_10024065 3300032139 Bacteria 1881
104 Ga0316596_1000844 3300033541 Bacteria 5726
105 Ga0373935_0415878 3300035692 Bacteria 967
106 Ga0373927_0058212 3300035695 Bacteria 2499
107 Ga0373947_0272477 3300035725 Bacteria 1124
108 Ga0316582_0063493 3300036647 Bacteria 2373
109 Ga0316584_0228261 3300036712 Bacteria 1365
110 Ga0373925_0240832 3300037068 Bacteria 1449
111 Ga0395900_0298557 3300037418 Bacteria 1598
112 Ga0436364_0363354 3300037853 Bacteria 1061
113 Ga0436364_1295366 3300037853 Bacteria 5067
114 Ga0436364_1295395 3300037853 Bacteria 906
115 Ga0436364_1559661 3300037853 Bacteria 3000
116 Ga0395901_1449763 3300038443 Bacteria 644
117 Ga0436365_0113998 3300039437 Bacteria 3815
118 Ga0436365_1266973 3300039437 Bacteria 585
119 Ga0436365_1404435 3300039437 Bacteria 4291
120 Ga0436365_1491667 3300039437 Bacteria 2223
121 Ga0436360_1058950 3300039438 Bacteria 1519
122 Ga0436361_0690859 3300039447 Bacteria 1255
123 Ga0436362_0751392 3300039453 Bacteria 1009
124 Ga0439439_0047300 3300041406 Bacteria 1124
125 Ga0439461_0113869 3300041410 Bacteria 670
126 Ga0451837_1127725 3300041494 Bacteria 542
127 Ga0439455_0201148 3300042012 Bacteria 577
128 Ga0439456_088057 3300042013 Bacteria 696
129 Ga0439434_0057487 3300042435 Bacteria 1213
130 Ga0495590_0155567 3300046457 Bacteria 830
131 Ga0495590_0228285 3300046457 Bacteria 689
132 Ga0495629_0192099 3300046459 Bacteria 1413
133 Ga0495638_0006101 3300046460 Bacteria 8823
134 Ga0495662_0157564 3300046476 Bacteria 1118
135 Ga0495664_0082526 3300046477 Bacteria 1928
136 Ga0495618_0568168 3300046514 Bacteria 678
137 Ga0495640_0058463 3300046533 Bacteria 2629
138 Ga0495587_0221455 3300046536 Bacteria 1067
139 Ga0495625_0484197 3300046660 Bacteria 759
140 Ga0495635_0247257 3300046663 Bacteria 1203
141 Ga0495661_0617342 3300046665 Bacteria 509
142 Ga0495624_0376955 3300046690 Bacteria 853
143 Ga0495670_0349147 3300046691 Bacteria 796
144 Ga0495600_0315507 3300046809 Bacteria 984
145 Ga0495581_0188599 3300047315 Bacteria 1206
146 Ga0495604_0982719 3300047317 Bacteria 523
147 Ga0495674_0292909 3300047319 Bacteria 1331
148 Ga0495672_0222788 3300047320 Bacteria 930
149 Ga0495676_0470337 3300047321 Bacteria 828
150 Ga0495680_0327110 3300047322 Bacteria 1072
151 Ga0496100_0557807 3300048903 Bacteria 887
152 Ga0496100_1552700 3300048903 Bacteria 523
153 Ga0496102_0070661 3300048905 Bacteria 3206
154 Ga0496102_0295838 3300048905 Bacteria 1526
155 Ga0496103_0915310 3300048906 Bacteria 549
156 Ga0496104_0000335 3300048907 Bacteria 42046
157 Ga0496104_0001470 3300048907 Bacteria 20337
158 Ga0496104_0006662 3300048907 Bacteria 10165
159 Ga0496104_0010396 3300048907 Bacteria 8311
160 Ga0496105_0000063 3300048908 Bacteria 84836
161 Ga0496105_0005604 3300048908 Bacteria 9547
162 Ga0496105_0008598 3300048908 Bacteria 7933
163 Ga0496105_0013477 3300048908 Bacteria 6491
164 Ga0496105_0609530 3300048908 Bacteria 846
165 Ga0496105_0809867 3300048908 Unclassified 711
166 Ga0496108_0051971 3300048911 Unclassified 3433
167 Ga0496108_0154715 3300048911 Bacteria 1980
168 Ga0496109_0004038 3300048912 Bacteria 12258
169 Ga0496109_0041816 3300048912 Bacteria 4151
170 Ga0496109_0156361 3300048912 Bacteria 2135
171 Ga0496110_0019286 3300048913 Bacteria 5735
172 Ga0496110_0020342 3300048913 Bacteria 5604
173 Ga0496110_0133102 3300048913 Bacteria 2246
174 Ga0496110_0697962 3300048913 Bacteria 916
175 Ga0496110_0884658 3300048913 Bacteria 799
176 Ga0496110_1275117 3300048913 Bacteria 644
177 Ga0496111_0027413 3300048914 Bacteria 4030
178 Ga0496111_0056312 3300048914 Unclassified 2844
179 Ga0496111_0171658 3300048914 Bacteria 1611
180 Ga0496111_0969921 3300048914 Bacteria 610
181 Ga0496112_0035100 3300048915 Bacteria 4881
182 Ga0496112_0100328 3300048915 Bacteria 2864
183 Ga0496112_0113782 3300048915 Bacteria 2676
184 Ga0496112_0333684 3300048915 Bacteria 1460
185 Ga0496113_0000343 3300048916 Bacteria 22137
186 Ga0496113_0008560 3300048916 Bacteria 6672
187 Ga0496113_0056939 3300048916 Bacteria 2936
188 Ga0496113_0728507 3300048916 Bacteria 790
189 Ga0496114_0045278 3300048917 Bacteria 3654
190 Ga0496114_0675386 3300048917 Bacteria 907
191 Ga0496115_0013958 3300048918 Bacteria 6079
192 Ga0496115_0028632 3300048918 Bacteria 4368
193 Ga0496115_0049722 3300048918 Bacteria 3357
194 Ga0496115_0053209 3300048918 Bacteria 3248
195 Ga0496115_0200792 3300048918 Bacteria 1647
196 Ga0496115_0493727 3300048918 Bacteria 984
197 Ga0496126_0490973 3300048929 Bacteria 983
198 Ga0496126_0625872 3300048929 Bacteria 845
199 Ga0501034_0096750 3300049571 Bacteria 2948
200 Ga0501034_0536801 3300049571 Bacteria 1080
201 Ga0501036_0407696 3300049572 Bacteria 1134
202 Ga0501036_1401635 3300049572 Bacteria 567
203 Ga0501039_0327072 3300049575 Bacteria 1205
204 Ga0501046_0248168 3300049580 Bacteria 1311
205 Ga0501048_0172087 3300049582 Bacteria 1534
206 Ga0501048_0343077 3300049582 Bacteria 1065
207 Ga0501072_0991883 3300049588 Bacteria 655
208 Ga0501076_0323629 3300049592 Bacteria 1265
209 Ga0501083_0076469 3300049744 Bacteria 2222
210 Ga0501083_0292370 3300049744 Bacteria 1060
211 Ga0501035_0142718 3300049822 Bacteria 2081
212 Ga0501044_0000361 3300049823 Bacteria 56979
213 Ga0501045_0643512 3300049824 Bacteria 784
214 nmdc:mga0yw44_111530_c1 3300050492 Bacteria 1753
215 nmdc:mga0yw44_12768_c1 3300050492 Bacteria 4392
216 nmdc:mga0k408_163098_c1 3300050493 Bacteria 1328
217 nmdc:mga06z11_343763_c1 3300050494 Bacteria 892
218 nmdc:mga06z11_522670_c1 3300050494 Bacteria 720
219 nmdc:mga06z11_860862_c1 3300050494 Bacteria 552
220 nmdc:mga04h51_33951_c1 3300050495 Bacteria 1627
221 nmdc:mga07m45_176690_c1 3300050496 Bacteria 1241
222 nmdc:mga07m45_291727_c1 3300050496 Bacteria 949
223 nmdc:mga07m45_42333_c1 3300050496 Bacteria 2552
224 nmdc:mga05p37_1213195_c1 3300050507 Bacteria 778
225 nmdc:mga05p37_17554_c1 3300050507 Bacteria 8639
226 nmdc:mga05p37_261657_c1 3300050507 Bacteria 2070
227 nmdc:mga09592_377165_c1 3300050508 Bacteria 1226
228 nmdc:mga0qj67_187_c1 3300050509 Bacteria 41920
229 nmdc:mga0qj67_450126_c1 3300050509 Bacteria 1037
230 nmdc:mga06r32_49468_c1 3300050510 Bacteria 4019
231 nmdc:mga06r32_53662_c1 3300050510 Bacteria 3862
232 nmdc:mga0rr50_50577_c1 3300050513 Bacteria 3080
233 nmdc:mga08x19_3209_c1 3300050514 Bacteria 9808
234 nmdc:mga08x19_4_c2 3300050514 Bacteria 202063
235 nmdc:mga0a205_380736_c1 3300050515 Bacteria 1276
236 Ga0495601_0041232 3300053077 Bacteria 2893
237 Ga0495601_0095384 3300053077 Bacteria 1918
238 Ga0495619_0515762 3300053085 Bacteria 821
239 Ga0500643_098656 3300053087 Bacteria 793
240 Ga0500583_0232410 3300053092 Bacteria 913
241 Ga0500641_0006576 3300053096 Bacteria 4125
242 Ga0500654_111471 3300053099 Bacteria 1118
243 Ga0500594_0200353 3300053118 Bacteria 656
244 Ga0500642_0098163 3300053130 Bacteria 1360
245 Ga0500658_0022459 3300053134 Bacteria 2400
246 Ga0500568_0064298 3300053139 Bacteria 1414
247 Ga0500589_112046 3300053147 Bacteria 1169
248 Ga0500622_0235343 3300053156 Bacteria 813
249 Ga0501084_0422582 3300054114 Bacteria 1127
250 Ga0590077_034320 3300059426 Bacteria 1115
251 Ga0501082_0000098 3300060353 Bacteria 67010
252 643601821 643348564 Bacteria 8839022
253 Ga0500627_0135840
254 JGI25153J46596_10004860
255 JGI25153J46596_10005120
256 Ga0068868_100544802
257 Ga0070689_100164559
258 Ga0070689_100547342
259 Ga0070691_10391229
260 Ga0070687_100055250
261 Ga0070675_101099290
262 Ga0070674_101233654
263 Ga0070688_100218901
264 Ga0070688_100241281
265 Ga0070667_101375405
266 Ga0070714_100399233
267 Ga0070711_100131872
268 Ga0070711_101392564
269 Ga0070685_10109885
270 Ga0070699_101585677
271 Ga0070679_100495985
272 Ga0070665_100286290
273 Ga0070702_100182087
274 Ga0068859_101541687
275 Ga0068864_100323351
276 Ga0068860_100703066
277 Ga0081540_1143024
278 Ga0081539_10002394
279 Ga0070717_10394804
280 Ga0070717_10710656
281 Ga0070717_10820739
282 Ga0075365_10046341
283 Ga0075368_10060389
284 Ga0070712_100000213
285 Ga0075367_10192700
286 Ga0075369_10044688
287 Ga0075366_10265602
288 Ga0075370_10061579
289 Ga0075370_10275501
290 Ga0068871_100196521
291 Ga0075428_100419560
292 Ga0075430_100000182
293 Ga0075431_100104378
294 Ga0075431_100237605
295 Ga0075431_100409316
296 Ga0075431_100697615
297 Ga0075434_100280849
298 Ga0075436_100003608
299 Ga0075436_100584204
300 Ga0097620_101541508
301 Ga0105245_10179258
302 Ga0105247_10571670
303 Ga0105247_11005814
304 Ga0114129_10143540
305 Ga0114129_10744429
306 Ga0114129_11741969
307 Ga0105248_10087268
308 Ga0105249_10374168
309 Ga0105249_12230874
310 Ga0105246_10246195
311 Ga0157374_10675921
312 Ga0163162_10449719
313 Ga0157380_10356131
314 Ga0157380_10468744
315 Ga0157380_11180295
316 Ga0157380_12188582
317 Ga0157377_10725432
318 Ga0184600_141054
319 Ga0213873_10230047
320 Ga0213876_10344677
321 Ga0247553_103412
322 Ga0209758_1000063
323 Ga0207426_1052547
324 Ga0207692_10184474
325 Ga0207685_10258219
326 Ga0207693_10000888
327 Ga0207663_10109650
328 Ga0207662_10004033
329 Ga0207681_10659018
330 Ga0207687_10230875
331 Ga0207644_10089543
332 Ga0207690_10376859
333 Ga0207670_10033663
334 Ga0207670_10512670
335 Ga0207669_10931365
336 Ga0207665_10270010
337 Ga0207665_10281227
338 Ga0207677_11881828
339 Ga0207641_10849808
340 Ga0268266_10390192
341 Ga0268265_11956321
342 Ga0265328_10000037
343 Ga0265331_10216557
344 Ga0307513_10268880
345 Ga0307509_10414471
346 Ga0307509_10630761
347 Ga0316575_10095775
348 Ga0316579_10303733
349 Ga0316576_10368438
350 Ga0316578_10091728
351 Ga0316053_102880
352 Ga0316053_109408
353 Ga0316583_10001496
354 Ga0316585_10005306
355 Ga0316580_10024065
356 Ga0316596_1000844
357 Ga0373935_0415878
358 Ga0373927_0058212
359 Ga0373947_0272477
360 Ga0316582_0063493
361 Ga0316584_0228261
362 Ga0373925_0240832
363 Ga0395900_0298557
364 Ga0436364_0363354
365 Ga0436364_1295366
366 Ga0436364_1295395
367 Ga0436364_1559661
368 Ga0395901_1449763
369 Ga0436365_0113998
370 Ga0436365_1266973
371 Ga0436365_1404435
372 Ga0436365_1491667
373 Ga0436360_1058950
374 Ga0436361_0690859
375 Ga0436362_0751392
376 Ga0439439_0047300
377 Ga0439461_0113869
378 Ga0451837_1127725
379 Ga0439455_0201148
380 Ga0439456_088057
381 Ga0439434_0057487
382 Ga0495590_0155567
383 Ga0495590_0228285
384 Ga0495629_0192099
385 Ga0495638_0006101
386 Ga0495662_0157564
387 Ga0495664_0082526
388 Ga0495618_0568168
389 Ga0495640_0058463
390 Ga0495587_0221455
391 Ga0495625_0484197
392 Ga0495635_0247257
393 Ga0495661_0617342
394 Ga0495624_0376955
395 Ga0495670_0349147
396 Ga0495600_0315507
397 Ga0495581_0188599
398 Ga0495604_0982719
399 Ga0495674_0292909
400 Ga0495672_0222788
401 Ga0495676_0470337
402 Ga0495680_0327110
403 Ga0496100_0557807
404 Ga0496100_1552700
405 Ga0496102_0070661
406 Ga0496102_0295838
407 Ga0496103_0915310
408 Ga0496104_0000335
409 Ga0496104_0001470
410 Ga0496104_0006662
411 Ga0496104_0010396
412 Ga0496105_0000063
413 Ga0496105_0005604
414 Ga0496105_0008598
415 Ga0496105_0013477
416 Ga0496105_0609530
417 Ga0496105_0809867
418 Ga0496108_0051971
419 Ga0496108_0154715
420 Ga0496109_0004038
421 Ga0496109_0041816
422 Ga0496109_0156361
423 Ga0496110_0019286
424 Ga0496110_0020342
425 Ga0496110_0133102
426 Ga0496110_0697962
427 Ga0496110_0884658
428 Ga0496110_1275117
429 Ga0496111_0027413
430 Ga0496111_0056312
431 Ga0496111_0171658
432 Ga0496111_0969921
433 Ga0496112_0035100
434 Ga0496112_0100328
435 Ga0496112_0113782
436 Ga0496112_0333684
437 Ga0496113_0000343
438 Ga0496113_0008560
439 Ga0496113_0056939
440 Ga0496113_0728507
441 Ga0496114_0045278
442 Ga0496114_0675386
443 Ga0496115_0013958
444 Ga0496115_0028632
445 Ga0496115_0049722
446 Ga0496115_0053209
447 Ga0496115_0200792
448 Ga0496115_0493727
449 Ga0496126_0490973
450 Ga0496126_0625872
451 Ga0501034_0096750
452 Ga0501034_0536801
453 Ga0501036_0407696
454 Ga0501036_1401635
455 Ga0501039_0327072
456 Ga0501046_0248168
457 Ga0501048_0172087
458 Ga0501048_0343077
459 Ga0501072_0991883
460 Ga0501076_0323629
461 Ga0501083_0076469
462 Ga0501083_0292370
463 Ga0501035_0142718
464 Ga0501044_0000361
465 Ga0501045_0643512
466 nmdc:mga0yw44_111530_c1
467 nmdc:mga0yw44_12768_c1
468 nmdc:mga0k408_163098_c1
469 nmdc:mga06z11_343763_c1
470 nmdc:mga06z11_522670_c1
471 nmdc:mga06z11_860862_c1
472 nmdc:mga04h51_33951_c1
473 nmdc:mga07m45_176690_c1
474 nmdc:mga07m45_291727_c1
475 nmdc:mga07m45_42333_c1
476 nmdc:mga05p37_1213195_c1
477 nmdc:mga05p37_17554_c1
478 nmdc:mga05p37_261657_c1
479 nmdc:mga09592_377165_c1
480 nmdc:mga0qj67_187_c1
481 nmdc:mga0qj67_450126_c1
482 nmdc:mga06r32_49468_c1
483 nmdc:mga06r32_53662_c1
484 nmdc:mga0rr50_50577_c1
485 nmdc:mga08x19_3209_c1
486 nmdc:mga08x19_4_c2
487 nmdc:mga0a205_380736_c1
488 Ga0495601_0041232
489 Ga0495601_0095384
490 Ga0495619_0515762
491 Ga0500643_098656
492 Ga0500583_0232410
493 Ga0500641_0006576
494 Ga0500654_111471
495 Ga0500594_0200353
496 Ga0500642_0098163
497 Ga0500658_0022459
498 Ga0500568_0064298
499 Ga0500589_112046
500 Ga0500622_0235343
501 Ga0501084_0422582
502 Ga0590077_034320
503 Ga0501082_0000098
504 643601821

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

3

128

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.8807 36 122
4gop-assembly2.cif.gz_Y structure and conformational change of a replication protein a heterotrimer bound to ssdna 0.8216 52 123
2pi2-assembly3.cif.gz_C full-length replication protein a subunits rpa14 and rpa32 0.8145 52 123
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.8112 47 121
8x70-assembly4.cif.gz_D the crystal structure of ifi16 from biortus. 0.8078 43 123
ID Description Score Start End Superfamily
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8807 36 122 2.40.50.140
4gopY00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8216 52 123 2.40.50.140
af_Q2FY46_5_100_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8125 51 119 2.40.50.140
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8112 47 121 2.40.50.140
af_Q8II42_53_185_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.807 51 123 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A353VYD4-F1-model_v4 Cytochrome c maturation protein CcmE 0.9163 1 125 GO:0005886
GO:0017004
GO:0020037
AF-Q5GS17-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.9115 1 129 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A7V9DNG9-F1-model_v4 Cytochrome c maturation protein CcmE 0.9114 49 127 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A353VYD4-F1-model_v4 Cytochrome c maturation protein CcmE 0.9025 1 125 GO:0005886
GO:0017004
GO:0020037
AF-A0A7Z6L7W3-F1-model_v4 deleted 0.9007 1 115

Map