F363591

General Info

Members Datasets Scaffolds Average Seq Length
252 113 504 293

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0020293|Ga0501069_0020293_649_1740
Length 328
Sequence VKRVFVLGPVVLSFVLGLALAGVFAGAVGADPGTXXXXTIAPTFQRGVRIAGVAVSKLSRADAQAAVSEAFAKPLHVSVDGETFSLEPKTVAGAYVKTAVARARIAAPNTNVKLVVAVHGPALRSWVKSIAARFATTPDDASLTFRGAKPVVTPDHPGRRLDKRTLTAKLVAALKANTRLPVRVHTKTTPAHVTLASLGPVIVINRSANRLTLYGKGKAVRTFPVATGQAIYPTPAGTFHIVTMQRNPWWYPPTYDSWAKGLKPVPPGPSNPLGTRWMGLSVPGVGIHGTDEPSSIGYSESHGCIRMQVPDAEWLFEHVKVGTTVHIV

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
28 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
29 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
30 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
61 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
94 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
110 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
111 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
112 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
113 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.44
Metatranscriptomes 5.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.76
Rhizosphere 94.05
Stem 0
Stem Tuber 0
Unclassified 6.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0020293 3300049585 Bacteria 3600
2 Ga0070658_10001317 3300005327 Bacteria 21168
3 Ga0070658_10015906 3300005327 Bacteria 6016
4 Ga0070658_10076077 3300005327 Bacteria 2753
5 Ga0070658_10149523 3300005327 Bacteria 1954
6 Ga0070683_100001088 3300005329 Bacteria 20441
7 Ga0070683_100001951 3300005329 Bacteria 16161
8 Ga0070683_100037677 3300005329 Bacteria 4427
9 Ga0070683_100129336 3300005329 Bacteria 2389
10 Ga0070660_100000651 3300005339 Bacteria 23008
11 Ga0070660_100034316 3300005339 Bacteria 3832
12 Ga0070660_100036031 3300005339 Bacteria 3746
13 Ga0070660_100045040 3300005339 Bacteria 3376
14 Ga0070660_100375235 3300005339 Bacteria 1174
15 Ga0070691_10080957 3300005341 Bacteria 1590
16 Ga0070661_100012997 3300005344 Bacteria 5836
17 Ga0070661_100127565 3300005344 Bacteria 1909
18 Ga0070661_100134783 3300005344 Bacteria 1857
19 Ga0070659_100009404 3300005366 Bacteria 7180
20 Ga0070663_100209448 3300005455 Bacteria 1526
21 Ga0070681_10002352 3300005458 Bacteria 17268
22 Ga0070681_10002582 3300005458 Bacteria 16612
23 Ga0070681_10010574 3300005458 Bacteria 9115
24 Ga0070681_10080413 3300005458 Bacteria 3215
25 Ga0070681_10080525 3300005458 Bacteria 3213
26 Ga0070681_10426620 3300005458 Unclassified 1238
27 Ga0070679_100003582 3300005530 Bacteria 14210
28 Ga0070679_100007912 3300005530 Bacteria 9974
29 Ga0070679_100020102 3300005530 Bacteria 6506
30 Ga0070679_100026646 3300005530 Bacteria 5684
31 Ga0070679_100032462 3300005530 Bacteria 5165
32 Ga0070679_100048717 3300005530 Bacteria 4220
33 Ga0070679_100097118 3300005530 Unclassified 2934
34 Ga0070684_100035027 3300005535 Bacteria 4295
35 Ga0070684_100072826 3300005535 Bacteria 3026
36 Ga0070684_100135208 3300005535 Bacteria 2226
37 Ga0068855_100007604 3300005563 Bacteria 13111
38 Ga0068855_100030809 3300005563 Bacteria 6413
39 Ga0068855_100039275 3300005563 Bacteria 5618
40 Ga0068857_100014571 3300005577 Bacteria 6858
41 Ga0068856_100045426 3300005614 Bacteria 4325
42 Ga0068852_100034851 3300005616 Bacteria 4192
43 Ga0068852_100427912 3300005616 Bacteria 1307
44 Ga0075435_100003270 3300007076 Bacteria 10981
45 Ga0105240_10020317 3300009093 Bacteria 8862
46 Ga0105240_10027832 3300009093 Bacteria 7396
47 Ga0105240_10045838 3300009093 Bacteria 5545
48 Ga0105242_10020448 3300009176 Bacteria 5190
49 Ga0105237_10109378 3300009545 Unclassified 2756
50 Ga0105237_10193513 3300009545 Bacteria 2033
51 Ga0105238_10021384 3300009551 Bacteria 6591
52 Ga0105239_10190857 3300010375 Bacteria 2293
53 Ga0157373_10086319 3300013100 Bacteria 2212
54 Ga0157371_10108261 3300013102 Bacteria 1972
55 Ga0157370_10018219 3300013104 Bacteria 7066
56 Ga0157370_10031630 3300013104 Bacteria 5175
57 Ga0157370_10103661 3300013104 Bacteria 2662
58 Ga0157370_10153661 3300013104 Bacteria 2141
59 Ga0157369_10002883 3300013105 Bacteria 20540
60 Ga0157369_10015917 3300013105 Bacteria 8469
61 Ga0157369_10017119 3300013105 Bacteria 8144
62 Ga0157369_10036333 3300013105 Bacteria 5398
63 Ga0157369_10049518 3300013105 Bacteria 4554
64 Ga0157369_10088859 3300013105 Unclassified 3299
65 Ga0157372_10053852 3300013307 Bacteria 4486
66 Ga0157372_10365722 3300013307 Bacteria 1681
67 Ga0182008_10145638 3300014497 Unclassified 1186
68 Ga0182006_1012853 3300015261 Bacteria 3652
69 Ga0182005_1024738 3300015265 Bacteria 1639
70 Ga0197907_10130320 3300020069 Bacteria 1597
71 Ga0197907_10486216 3300020069 Bacteria 4233
72 Ga0206356_10050462 3300020070 Bacteria 3245
73 Ga0206356_11107425 3300020070 Bacteria 1844
74 Ga0206349_1803918 3300020075 Bacteria 1550
75 Ga0206354_10704196 3300020081 Bacteria 2915
76 Ga0206354_10962717 3300020081 Bacteria 2988
77 Ga0206354_11371064 3300020081 Archaea 3469
78 Ga0206353_10004980 3300020082 Bacteria 12482
79 Ga0206353_10138765 3300020082 Bacteria 6751
80 Ga0206353_10866168 3300020082 Bacteria 6983
81 Ga0206353_11322877 3300020082 Bacteria 4940
82 Ga0206353_11370173 3300020082 Bacteria 4720
83 Ga0213876_10047479 3300021384 Bacteria 2270
84 Ga0224712_10027086 3300022467 Bacteria 2035
85 Ga0207705_10003887 3300025909 Bacteria 11365
86 Ga0207705_10157119 3300025909 Bacteria 1706
87 Ga0207654_10064494 3300025911 Bacteria 2153
88 Ga0207707_10004063 3300025912 Bacteria 12958
89 Ga0207707_10008618 3300025912 Bacteria 8845
90 Ga0207707_10015282 3300025912 Bacteria 6684
91 Ga0207707_10290656 3300025912 Bacteria 1414
92 Ga0207695_10161853 3300025913 Bacteria 2169
93 Ga0207671_10234450 3300025914 Bacteria 1440
94 Ga0207657_10001863 3300025919 Bacteria 22803
95 Ga0207657_10002690 3300025919 Bacteria 19155
96 Ga0207657_10018008 3300025919 Bacteria 6758
97 Ga0207657_10074726 3300025919 Bacteria 2861
98 Ga0207657_10090006 3300025919 Bacteria 2562
99 Ga0207657_10099513 3300025919 Bacteria 2415
100 Ga0207649_10006711 3300025920 Bacteria 6254
101 Ga0207649_10020608 3300025920 Bacteria 3783
102 Ga0207652_10019328 3300025921 Bacteria 5602
103 Ga0207652_10042246 3300025921 Bacteria 3879
104 Ga0207652_10107069 3300025921 Bacteria 2476
105 Ga0207652_10148659 3300025921 Bacteria 2097
106 Ga0207646_10267350 3300025922 Bacteria 1546
107 Ga0207694_10161048 3300025924 Bacteria 1812
108 Ga0207664_10080200 3300025929 Bacteria 2652
109 Ga0207686_10008571 3300025934 Bacteria 5525
110 Ga0207661_10084484 3300025944 Bacteria 2629
111 Ga0207661_10113942 3300025944 Unclassified 2292
112 Ga0207661_10172300 3300025944 Bacteria 1884
113 Ga0207661_10426981 3300025944 Bacteria 1204
114 Ga0207667_10192339 3300025949 Bacteria 2094
115 Ga0207667_10263279 3300025949 Bacteria 1763
116 Ga0207639_10245192 3300026041 Bacteria 1560
117 Ga0207678_10111162 3300026067 Unclassified 2337
118 Ga0207678_10228049 3300026067 Bacteria 1595
119 Ga0207702_10031510 3300026078 Bacteria 4419
120 Ga0207702_10203015 3300026078 Bacteria 1839
121 Ga0207698_10072612 3300026142 Bacteria 2736
122 Ga0268266_10100868 3300028379 Bacteria 2544
123 Ga0265338_10029180 3300028800 Bacteria 5476
124 Ga0265338_10139380 3300028800 Bacteria 1902
125 Ga0265338_10214416 3300028800 Bacteria 1443
126 Ga0265327_10020771 3300031251 Bacteria 3988
127 Ga0265316_10105641 3300031344 Bacteria 2136
128 Ga0265342_10110013 3300031712 Unclassified 1560
129 Ga0373943_0000773 3300035170 Bacteria 13963
130 Ga0373947_0062545 3300035725 Bacteria 2265
131 Ga0373925_0036665 3300037068 Bacteria 3618
132 Ga0395899_0010766 3300037312 Bacteria 7012
133 Ga0395899_0231157 3300037312 Bacteria 1277
134 Ga0395900_0035347 3300037418 Bacteria 5146
135 Ga0395900_0055874 3300037418 Bacteria 4064
136 Ga0395900_0102485 3300037418 Bacteria 2940
137 Ga0395898_0001904 3300037466 Bacteria 26581
138 Ga0395898_0066851 3300037466 Bacteria 3481
139 Ga0395898_0143154 3300037466 Bacteria 2289
140 Ga0395898_0401015 3300037466 Unclassified 1308
141 Ga0395905_0302702 3300037471 Bacteria 1486
142 Ga0395901_0004613 3300038443 Bacteria 13905
143 Ga0395901_0051846 3300038443 Bacteria 4265
144 Ga0395901_0152941 3300038443 Unclassified 2424
145 Ga0395901_0168841 3300038443 Bacteria 2296
146 Ga0395901_0228268 3300038443 Bacteria 1944
147 Ga0436365_0242560 3300039437 Bacteria 2566
148 Ga0436360_0082255 3300039438 Bacteria 2803
149 Ga0466969_0021737 3300044656 Bacteria 3316
150 Ga0466969_0057961 3300044656 Bacteria 1887
151 Ga0466966_0097742 3300044684 Bacteria 1818
152 Ga0466966_0160655 3300044684 Bacteria 1368
153 Ga0466961_0003294 3300044693 Bacteria 10063
154 Ga0466961_0063355 3300044693 Bacteria 2349
155 Ga0466963_0000164 3300044694 Bacteria 26985
156 Ga0466963_0000276 3300044694 Bacteria 22861
157 Ga0466963_0000438 3300044694 Bacteria 19248
158 Ga0466963_0000673 3300044694 Bacteria 16556
159 Ga0466963_0001413 3300044694 Bacteria 12908
160 Ga0466963_0068161 3300044694 Bacteria 2389
161 Ga0466963_0080749 3300044694 Bacteria 2202
162 Ga0466963_0097171 3300044694 Unclassified 2012
163 Ga0466963_0115832 3300044694 Bacteria 1842
164 Ga0466963_0127673 3300044694 Bacteria 1754
165 Ga0466963_0291940 3300044694 Unclassified 1146
166 Ga0466964_0037502 3300044706 Bacteria 1947
167 Ga0466964_0067110 3300044706 Bacteria 1507
168 Ga0466964_0111854 3300044706 Bacteria 1219
169 Ga0466971_0000481 3300044719 Bacteria 15690
170 Ga0466971_0001552 3300044719 Bacteria 9688
171 Ga0466971_0021919 3300044719 Bacteria 2844
172 Ga0466971_0048360 3300044719 Bacteria 1912
173 Ga0466970_0020205 3300044765 Bacteria 3458
174 Ga0466970_0088937 3300044765 Bacteria 1675
175 Ga0466970_0118701 3300044765 Bacteria 1448
176 Ga0466957_0000468 3300044842 Bacteria 20063
177 Ga0466957_0003662 3300044842 Bacteria 8480
178 Ga0466957_0072372 3300044842 Bacteria 2134
179 Ga0466957_0095617 3300044842 Bacteria 1866
180 Ga0466957_0107101 3300044842 Bacteria 1769
181 Ga0466957_0200340 3300044842 Bacteria 1311
182 Ga0466959_0019080 3300045049 Bacteria 5040
183 Ga0466959_0044025 3300045049 Bacteria 3289
184 Ga0466959_0046345 3300045049 Bacteria 3200
185 Ga0466959_0149112 3300045049 Bacteria 1650
186 Ga0466958_0029960 3300045836 Bacteria 3228
187 Ga0466958_0031143 3300045836 Bacteria 3170
188 Ga0466958_0036022 3300045836 Bacteria 2959
189 Ga0466958_0065059 3300045836 Bacteria 2225
190 Ga0466958_0070623 3300045836 Bacteria 2137
191 Ga0466958_0089240 3300045836 Bacteria 1906
192 Ga0466958_0156125 3300045836 Bacteria 1440
193 Ga0466967_0007722 3300045976 Bacteria 7796
194 Ga0466967_0011353 3300045976 Bacteria 6740
195 Ga0466967_0018092 3300045976 Bacteria 5622
196 Ga0466967_0029149 3300045976 Bacteria 4616
197 Ga0466967_0033502 3300045976 Bacteria 4349
198 Ga0466967_0043797 3300045976 Bacteria 3877
199 Ga0466967_0047348 3300045976 Bacteria 3748
200 Ga0466967_0047626 3300045976 Bacteria 3738
201 Ga0466967_0053227 3300045976 Bacteria 3556
202 Ga0466967_0075594 3300045976 Bacteria 3027
203 Ga0466967_0101553 3300045976 Bacteria 2629
204 Ga0466967_0118767 3300045976 Bacteria 2439
205 Ga0495641_0087676 3300046461 Bacteria 1392
206 Ga0495651_0075068 3300046462 Bacteria 2564
207 Ga0495664_0111385 3300046477 Bacteria 1652
208 Ga0495630_0040887 3300046517 Bacteria 3464
209 Ga0495652_0032453 3300046529 Bacteria 4566
210 Ga0495652_0117436 3300046529 Bacteria 2128
211 Ga0495667_0171514 3300046559 Unclassified 1394
212 Ga0495657_0036202 3300046675 Bacteria 3413
213 Ga0495674_0130414 3300047319 Bacteria 2118
214 Ga0495676_0098386 3300047321 Bacteria 2170
215 Ga0496100_0078085 3300048903 Bacteria 2228
216 Ga0496102_0099452 3300048905 Unclassified 2700
217 Ga0496104_0296582 3300048907 Bacteria 1529
218 Ga0496105_0085990 3300048908 Bacteria 2599
219 Ga0496105_0091300 3300048908 Bacteria 2515
220 Ga0496106_0002200 3300048909 Bacteria 14565
221 Ga0496112_0035228 3300048915 Bacteria 4874
222 Ga0496112_0220890 3300048915 Bacteria 1851
223 Ga0496114_0013740 3300048917 Bacteria 6490
224 Ga0496114_0030564 3300048917 Bacteria 4432
225 Ga0496115_0014908 3300048918 Bacteria 5893
226 Ga0496115_0069556 3300048918 Bacteria 2852
227 Ga0496126_0128237 3300048929 Bacteria 2194
228 Ga0501034_0028414 3300049571 Bacteria 5691
229 Ga0501034_0113093 3300049571 Bacteria 2705
230 Ga0501067_0000303 3300049583 Bacteria 27180
231 Ga0501069_0003107 3300049585 Bacteria 8510
232 Ga0501070_0007708 3300049586 Bacteria 9126
233 Ga0501070_0019327 3300049586 Bacteria 5714
234 Ga0501070_0138508 3300049586 Bacteria 2009
235 Ga0501070_0327017 3300049586 Bacteria 1246
236 Ga0501072_0110551 3300049588 Bacteria 2187
237 Ga0501073_0020972 3300049589 Bacteria 4714
238 Ga0501073_0121487 3300049589 Bacteria 1810
239 Ga0501074_0013155 3300049590 Bacteria 6018
240 Ga0501074_0034735 3300049590 Bacteria 3654
241 Ga0501074_0057521 3300049590 Bacteria 2801
242 Ga0501079_0009230 3300049741 Bacteria 7471
243 Ga0501080_0002895 3300049742 Bacteria 15091
244 Ga0501083_0001297 3300049744 Bacteria 16900
245 Ga0501035_0268709 3300049822 Unclassified 1444
246 nmdc:mga0rr50_208557_c1 3300050513 Bacteria 1609
247 nmdc:mga08x19_165859_c1 3300050514 Bacteria 1502
248 Ga0495601_0010788 3300053077 Bacteria 5452
249 Ga0466962_0000435 3300061719 Bacteria 18150
250 Ga0466962_0022421 3300061719 Bacteria 3033
251 Ga0466962_0053880 3300061719 Bacteria 1922
252 Ga0530510_0119727 3300061734 Unclassified 1932
253 Ga0501069_0020293
254 Ga0070658_10001317
255 Ga0070658_10015906
256 Ga0070658_10076077
257 Ga0070658_10149523
258 Ga0070683_100001088
259 Ga0070683_100001951
260 Ga0070683_100037677
261 Ga0070683_100129336
262 Ga0070660_100000651
263 Ga0070660_100034316
264 Ga0070660_100036031
265 Ga0070660_100045040
266 Ga0070660_100375235
267 Ga0070691_10080957
268 Ga0070661_100012997
269 Ga0070661_100127565
270 Ga0070661_100134783
271 Ga0070659_100009404
272 Ga0070663_100209448
273 Ga0070681_10002352
274 Ga0070681_10002582
275 Ga0070681_10010574
276 Ga0070681_10080413
277 Ga0070681_10080525
278 Ga0070681_10426620
279 Ga0070679_100003582
280 Ga0070679_100007912
281 Ga0070679_100020102
282 Ga0070679_100026646
283 Ga0070679_100032462
284 Ga0070679_100048717
285 Ga0070679_100097118
286 Ga0070684_100035027
287 Ga0070684_100072826
288 Ga0070684_100135208
289 Ga0068855_100007604
290 Ga0068855_100030809
291 Ga0068855_100039275
292 Ga0068857_100014571
293 Ga0068856_100045426
294 Ga0068852_100034851
295 Ga0068852_100427912
296 Ga0075435_100003270
297 Ga0105240_10020317
298 Ga0105240_10027832
299 Ga0105240_10045838
300 Ga0105242_10020448
301 Ga0105237_10109378
302 Ga0105237_10193513
303 Ga0105238_10021384
304 Ga0105239_10190857
305 Ga0157373_10086319
306 Ga0157371_10108261
307 Ga0157370_10018219
308 Ga0157370_10031630
309 Ga0157370_10103661
310 Ga0157370_10153661
311 Ga0157369_10002883
312 Ga0157369_10015917
313 Ga0157369_10017119
314 Ga0157369_10036333
315 Ga0157369_10049518
316 Ga0157369_10088859
317 Ga0157372_10053852
318 Ga0157372_10365722
319 Ga0182008_10145638
320 Ga0182006_1012853
321 Ga0182005_1024738
322 Ga0197907_10130320
323 Ga0197907_10486216
324 Ga0206356_10050462
325 Ga0206356_11107425
326 Ga0206349_1803918
327 Ga0206354_10704196
328 Ga0206354_10962717
329 Ga0206354_11371064
330 Ga0206353_10004980
331 Ga0206353_10138765
332 Ga0206353_10866168
333 Ga0206353_11322877
334 Ga0206353_11370173
335 Ga0213876_10047479
336 Ga0224712_10027086
337 Ga0207705_10003887
338 Ga0207705_10157119
339 Ga0207654_10064494
340 Ga0207707_10004063
341 Ga0207707_10008618
342 Ga0207707_10015282
343 Ga0207707_10290656
344 Ga0207695_10161853
345 Ga0207671_10234450
346 Ga0207657_10001863
347 Ga0207657_10002690
348 Ga0207657_10018008
349 Ga0207657_10074726
350 Ga0207657_10090006
351 Ga0207657_10099513
352 Ga0207649_10006711
353 Ga0207649_10020608
354 Ga0207652_10019328
355 Ga0207652_10042246
356 Ga0207652_10107069
357 Ga0207652_10148659
358 Ga0207646_10267350
359 Ga0207694_10161048
360 Ga0207664_10080200
361 Ga0207686_10008571
362 Ga0207661_10084484
363 Ga0207661_10113942
364 Ga0207661_10172300
365 Ga0207661_10426981
366 Ga0207667_10192339
367 Ga0207667_10263279
368 Ga0207639_10245192
369 Ga0207678_10111162
370 Ga0207678_10228049
371 Ga0207702_10031510
372 Ga0207702_10203015
373 Ga0207698_10072612
374 Ga0268266_10100868
375 Ga0265338_10029180
376 Ga0265338_10139380
377 Ga0265338_10214416
378 Ga0265327_10020771
379 Ga0265316_10105641
380 Ga0265342_10110013
381 Ga0373943_0000773
382 Ga0373947_0062545
383 Ga0373925_0036665
384 Ga0395899_0010766
385 Ga0395899_0231157
386 Ga0395900_0035347
387 Ga0395900_0055874
388 Ga0395900_0102485
389 Ga0395898_0001904
390 Ga0395898_0066851
391 Ga0395898_0143154
392 Ga0395898_0401015
393 Ga0395905_0302702
394 Ga0395901_0004613
395 Ga0395901_0051846
396 Ga0395901_0152941
397 Ga0395901_0168841
398 Ga0395901_0228268
399 Ga0436365_0242560
400 Ga0436360_0082255
401 Ga0466969_0021737
402 Ga0466969_0057961
403 Ga0466966_0097742
404 Ga0466966_0160655
405 Ga0466961_0003294
406 Ga0466961_0063355
407 Ga0466963_0000164
408 Ga0466963_0000276
409 Ga0466963_0000438
410 Ga0466963_0000673
411 Ga0466963_0001413
412 Ga0466963_0068161
413 Ga0466963_0080749
414 Ga0466963_0097171
415 Ga0466963_0115832
416 Ga0466963_0127673
417 Ga0466963_0291940
418 Ga0466964_0037502
419 Ga0466964_0067110
420 Ga0466964_0111854
421 Ga0466971_0000481
422 Ga0466971_0001552
423 Ga0466971_0021919
424 Ga0466971_0048360
425 Ga0466970_0020205
426 Ga0466970_0088937
427 Ga0466970_0118701
428 Ga0466957_0000468
429 Ga0466957_0003662
430 Ga0466957_0072372
431 Ga0466957_0095617
432 Ga0466957_0107101
433 Ga0466957_0200340
434 Ga0466959_0019080
435 Ga0466959_0044025
436 Ga0466959_0046345
437 Ga0466959_0149112
438 Ga0466958_0029960
439 Ga0466958_0031143
440 Ga0466958_0036022
441 Ga0466958_0065059
442 Ga0466958_0070623
443 Ga0466958_0089240
444 Ga0466958_0156125
445 Ga0466967_0007722
446 Ga0466967_0011353
447 Ga0466967_0018092
448 Ga0466967_0029149
449 Ga0466967_0033502
450 Ga0466967_0043797
451 Ga0466967_0047348
452 Ga0466967_0047626
453 Ga0466967_0053227
454 Ga0466967_0075594
455 Ga0466967_0101553
456 Ga0466967_0118767
457 Ga0495641_0087676
458 Ga0495651_0075068
459 Ga0495664_0111385
460 Ga0495630_0040887
461 Ga0495652_0032453
462 Ga0495652_0117436
463 Ga0495667_0171514
464 Ga0495657_0036202
465 Ga0495674_0130414
466 Ga0495676_0098386
467 Ga0496100_0078085
468 Ga0496102_0099452
469 Ga0496104_0296582
470 Ga0496105_0085990
471 Ga0496105_0091300
472 Ga0496106_0002200
473 Ga0496112_0035228
474 Ga0496112_0220890
475 Ga0496114_0013740
476 Ga0496114_0030564
477 Ga0496115_0014908
478 Ga0496115_0069556
479 Ga0496126_0128237
480 Ga0501034_0028414
481 Ga0501034_0113093
482 Ga0501067_0000303
483 Ga0501069_0003107
484 Ga0501070_0007708
485 Ga0501070_0019327
486 Ga0501070_0138508
487 Ga0501070_0327017
488 Ga0501072_0110551
489 Ga0501073_0020972
490 Ga0501073_0121487
491 Ga0501074_0013155
492 Ga0501074_0034735
493 Ga0501074_0057521
494 Ga0501079_0009230
495 Ga0501080_0002895
496 Ga0501083_0001297
497 Ga0501035_0268709
498 nmdc:mga0rr50_208557_c1
499 nmdc:mga08x19_165859_c1
500 Ga0495601_0010788
501 Ga0466962_0000435
502 Ga0466962_0022421
503 Ga0466962_0053880
504 Ga0530510_0119727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

199

327

0.91

PF12229

PG_binding_4

Putative peptidoglycan binding domain

54

183

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a1i-assembly1.cif.gz_A ykud from b.subtilis 0.8187 169 312
5bmq-assembly1.cif.gz_A crystal structure of l,d-transpeptidase (yku) from stackebrandtia nassauensis 0.8115 184 313
3zg4-assembly1.cif.gz_A nmr structure of the catalytic domain from e. faecium l,d- transpeptidase 0.7552 186 312
3hi0-assembly1.cif.gz_A crystal structure of putative exopolyphosphatase (17739545) from agrobacterium tumefaciens str. c58 (dupont) at 2.30 a resolution 0.7516 184 207
3zgp-assembly1.cif.gz_A nmr structure of the catalytic domain from e. faecium l,d- transpeptidase acylated by ertapenem 0.7392 184 312
ID Description Score Start End Superfamily
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8936 180 312 2.40.440.10
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8572 180 312 2.40.440.10
6d5aA03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8264 184 313 2.40.440.10
af_Q17353_64_152_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8257 57 71 3.10.20.90
5uwvD03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.7944 184 314 2.40.440.10
ID Description Score Start End GO Terms
AF-A0A537W746-F1-model_v4 YoaR-like putative peptidoglycan binding domain-containing protein 0.9239 13 201
AF-A0A538H931-F1-model_v4 YoaR-like putative peptidoglycan binding domain-containing protein 0.8701 1 179
AF-A0A355FQ00-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.8653 184 313 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A7V9KY09-F1-model_v4 L,D-transpeptidase 0.8636 24 314 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A537W746-F1-model_v4 YoaR-like putative peptidoglycan binding domain-containing protein 0.8492 13 201

Map