F363512

General Info

Members Datasets Scaffolds Average Seq Length
252 179 504 295

Family's Representative Sequence

Representative Sequence 3300046663|Ga0495635_0218900|Ga0495635_0218900_181_1176
Length 331
Sequence MTSQLEQECADLCAVAQRYDARHRPITNLTWPNGARIAVNMTADFDAMLLRRLLNEPPMQLAKGEFGGRVGIWRLIELFDSHSIKATFFVPGRICELYPQALRAAARSGHEIADHMWEHHVPKDPVMEHDHLLKTANALEAIVGRRPLGSRSDHTLGLLKQEGFLYISHDSADHRPYYLRDADGGNTMLNLPFHYAIDDAMFYSFAWLGSGNAAQRITDPDRVFDLWWAAFWQQYRAGGYLNIVVHPFVSGRALRIEMMDRLITRMKTLPGVWFPTCEEVARHCSRISPPERRSAQCPGSKATRSPTKSDCGMTKFAGPTATAVASRSWWI

Samples

Sample ID Description Type Environment
1 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
85 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
86 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
87 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
89 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
90 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
95 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
96 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
112 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
174 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
177 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
178 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
179 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 0
Rhizoplane 3.57
Rhizosphere 80.56
Stem 0
Stem Tuber 0
Unclassified 9.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495635_0218900 3300046663 Bacteria 1288
2 Ga0065707_10269403 3300005295 Unclassified 1072
3 Ga0070680_100230270 3300005336 Unclassified 1565
4 Ga0070691_10035906 3300005341 Bacteria 2335
5 Ga0070714_100121023 3300005435 Bacteria 2328
6 Ga0070714_100227601 3300005435 Bacteria 1716
7 Ga0070713_100069632 3300005436 Bacteria 2967
8 Ga0070713_100119445 3300005436 Bacteria 2310
9 Ga0070713_100179050 3300005436 Bacteria 1904
10 Ga0070713_100608261 3300005436 Bacteria 1039
11 Ga0070710_10043703 3300005437 Bacteria 2483
12 Ga0070701_10070220 3300005438 Bacteria 1871
13 Ga0070711_100077191 3300005439 Bacteria 2364
14 Ga0070711_100163737 3300005439 Bacteria 1688
15 Ga0070694_100078872 3300005444 Bacteria 2285
16 Ga0070708_100099008 3300005445 Unclassified 2667
17 Ga0070678_100278457 3300005456 Bacteria 1414
18 Ga0070698_100137250 3300005471 Bacteria 2399
19 Ga0070695_100013703 3300005545 Bacteria 4874
20 Ga0070665_100265859 3300005548 Bacteria 1716
21 Ga0070664_100092990 3300005564 Bacteria 2612
22 Ga0068856_100065405 3300005614 Bacteria 3594
23 Ga0068856_100246971 3300005614 Unclassified 1800
24 Ga0068856_100267625 3300005614 Bacteria 1725
25 Ga0068861_100026263 3300005719 Bacteria 4233
26 Ga0068858_100518206 3300005842 Bacteria 1153
27 Ga0068860_100014261 3300005843 Bacteria 7793
28 Ga0068860_100308269 3300005843 Bacteria 1552
29 Ga0081455_10000302 3300005937 Bacteria 65101
30 Ga0081455_10002517 3300005937 Bacteria 21758
31 Ga0081455_10088334 3300005937 Bacteria 2519
32 Ga0081455_10097589 3300005937 Bacteria 2367
33 Ga0081455_10102733 3300005937 Bacteria 2291
34 Ga0081538_10005234 3300005981 Bacteria 11725
35 Ga0081540_1002759 3300005983 Bacteria 14251
36 Ga0081540_1003147 3300005983 Bacteria 13183
37 Ga0081540_1048968 3300005983 Unclassified 2112
38 Ga0081539_10013287 3300005985 Bacteria 6218
39 Ga0081539_10032428 3300005985 Bacteria 3199
40 Ga0081539_10063704 3300005985 Bacteria 2010
41 Ga0081539_10078151 3300005985 Bacteria 1747
42 Ga0070717_10012817 3300006028 Bacteria 6401
43 Ga0070717_10297643 3300006028 Bacteria 1434
44 Ga0075365_10001384 3300006038 Bacteria 10914
45 Ga0075365_10055194 3300006038 Bacteria 2636
46 Ga0075364_10009050 3300006051 Bacteria 5966
47 Ga0075364_10012396 3300006051 Bacteria 5213
48 Ga0070716_100035979 3300006173 Bacteria 2727
49 Ga0070716_100423044 3300006173 Bacteria 964
50 Ga0070712_100059159 3300006175 Bacteria 2697
51 Ga0070712_100292364 3300006175 Bacteria 1316
52 Ga0075362_10005976 3300006177 Bacteria 4500
53 Ga0075362_10014001 3300006177 Bacteria 3227
54 Ga0075362_10016003 3300006177 Plasmid 3063
55 Ga0075367_10040408 3300006178 Plasmid 2723
56 Ga0075367_10201781 3300006178 Bacteria 1242
57 Ga0075367_10287629 3300006178 Unclassified 1034
58 Ga0075369_10006518 3300006186 Plasmid 4414
59 Ga0075369_10087303 3300006186 Unclassified 1389
60 Ga0075366_10153336 3300006195 Bacteria 1395
61 Ga0075428_100043611 3300006844 Bacteria 4932
62 Ga0075430_100056032 3300006846 Bacteria 3314
63 Ga0075430_100131691 3300006846 Bacteria 2084
64 Ga0075433_10116382 3300006852 Bacteria 2372
65 Ga0075434_100002282 3300006871 Bacteria 16773
66 Ga0075434_100006763 3300006871 Bacteria 10537
67 Ga0075434_100107093 3300006871 Bacteria 2805
68 Ga0075434_100238679 3300006871 Bacteria 1838
69 Ga0075435_100069055 3300007076 Bacteria 2880
70 Ga0075435_100103100 3300007076 Bacteria 2366
71 Ga0105240_10350879 3300009093 Bacteria 1674
72 Ga0111539_10044121 3300009094 Bacteria 5343
73 Ga0111539_10113986 3300009094 Bacteria 3170
74 Ga0111539_10154478 3300009094 Bacteria 2686
75 Ga0105245_10621273 3300009098 Bacteria 1109
76 Ga0105243_10385422 3300009148 Bacteria 1298
77 Ga0105248_10198140 3300009177 Unclassified 2263
78 Ga0105237_10126105 3300009545 Bacteria 2554
79 Ga0105238_10071267 3300009551 Bacteria 3473
80 Ga0105239_10081010 3300010375 Bacteria 3573
81 Ga0105246_10042766 3300011119 Bacteria 3069
82 Ga0157373_10104629 3300013100 Bacteria 1991
83 Ga0157370_10092121 3300013104 Bacteria 2845
84 Ga0163162_10090910 3300013306 Unclassified 3135
85 Ga0163162_10175863 3300013306 Bacteria 2266
86 Ga0163162_10631041 3300013306 Bacteria 1196
87 Ga0157375_10179958 3300013308 Bacteria 2265
88 Ga0163163_10095968 3300014325 Bacteria 2985
89 Ga0157380_10322102 3300014326 Bacteria 1433
90 Ga0182008_10095370 3300014497 Bacteria 1468
91 Ga0182008_10102498 3300014497 Bacteria 1415
92 Ga0163161_10125270 3300017792 Bacteria 1934
93 Ga0213873_10010252 3300021358 Unclassified 1972
94 Ga0209148_1000305 3300025254 Bacteria 70375
95 Ga0209233_1029641 3300025261 Unclassified 1298
96 Ga0209455_1004164 3300025272 Bacteria 4838
97 Ga0209758_1008322 3300025297 Bacteria 6765
98 Ga0207692_10014644 3300025898 Bacteria 3430
99 Ga0207671_10055371 3300025914 Bacteria 2938
100 Ga0207663_10009064 3300025916 Bacteria 5241
101 Ga0207660_10437034 3300025917 Unclassified 1057
102 Ga0207657_10120965 3300025919 Bacteria 2154
103 Ga0207694_10034535 3300025924 Plasmid 3878
104 Ga0207694_10134082 3300025924 Bacteria 1987
105 Ga0207687_10046401 3300025927 Bacteria 3008
106 Ga0207700_10115823 3300025928 Bacteria 2165
107 Ga0207700_10151205 3300025928 Bacteria 1918
108 Ga0207700_10175501 3300025928 Bacteria 1791
109 Ga0207665_10192401 3300025939 Bacteria 1483
110 Ga0207703_10195724 3300026035 Bacteria 1793
111 Ga0207639_10432308 3300026041 Bacteria 1192
112 Ga0207708_10104903 3300026075 Bacteria 2190
113 Ga0207708_10123760 3300026075 Bacteria 2017
114 Ga0207702_10359091 3300026078 Bacteria 1396
115 Ga0207674_10029852 3300026116 Bacteria 5737
116 Ga0207675_100161601 3300026118 Bacteria 2137
117 Ga0207683_10012047 3300026121 Bacteria 7382
118 Ga0207683_10131135 3300026121 Bacteria 2255
119 Ga0207698_10251654 3300026142 Bacteria 1617
120 Ga0207428_10029183 3300027907 Bacteria 4575
121 Ga0207428_10320042 3300027907 Unclassified 1146
122 Ga0268266_10008002 3300028379 Bacteria 9452
123 Ga0268264_10010289 3300028381 Bacteria 7743
124 Ga0268264_10197279 3300028381 Bacteria 1839
125 Ga0268264_10344633 3300028381 Bacteria 1416
126 Ga0265337_1046326 3300028556 Unclassified 1235
127 Ga0265338_10013575 3300028800 Bacteria 9179
128 Ga0307412_10126708 3300031911 Bacteria 1848
129 Ga0373928_0020399 3300035084 Bacteria 1389
130 Ga0373934_0016497 3300035086 Bacteria 2808
131 Ga0373934_0064453 3300035086 Bacteria 1463
132 Ga0373940_0011791 3300035088 Bacteria 2083
133 Ga0373923_0019135 3300035111 Bacteria 2647
134 Ga0373939_0006245 3300035114 Bacteria 2866
135 Ga0373953_0021994 3300035117 Bacteria 2399
136 Ga0373954_0028186 3300035118 Bacteria 2581
137 Ga0373956_0014945 3300035119 Bacteria 3246
138 Ga0373957_0010506 3300035120 Bacteria 3063
139 Ga0373955_0072891 3300035172 Bacteria 1924
140 Ga0373942_0017752 3300035207 Bacteria 1758
141 Ga0373961_0001772 3300035241 Bacteria 5961
142 Ga0373962_0012795 3300035242 Bacteria 2118
143 Ga0373962_0014350 3300035242 Bacteria 2018
144 Ga0373924_0049381 3300035410 Bacteria 1741
145 Ga0373931_0005303 3300035691 Bacteria 5949
146 Ga0373931_0013166 3300035691 Bacteria 4023
147 Ga0373927_0096110 3300035695 Bacteria 1926
148 Ga0373947_0043650 3300035725 Bacteria 2678
149 Ga0373947_0099374 3300035725 Bacteria 1827
150 Ga0373937_0024470 3300036401 Bacteria 5447
151 Ga0373937_0050788 3300036401 Bacteria 3799
152 Ga0373937_0352386 3300036401 Unclassified 1394
153 Ga0373937_0425571 3300036401 Bacteria 1260
154 Ga0373925_0047028 3300037068 Bacteria 3210
155 Ga0373925_0280910 3300037068 Bacteria 1341
156 Ga0395899_0128889 3300037312 Bacteria 1808
157 Ga0395900_0094126 3300037418 Bacteria 3077
158 Ga0395900_0150482 3300037418 Unclassified 2378
159 Ga0395905_0287907 3300037471 Bacteria 1530
160 Ga0436364_0355092 3300037853 Bacteria 2349
161 Ga0436364_0429861 3300037853 Bacteria 2084
162 Ga0395901_0066957 3300038443 Bacteria 3740
163 Ga0436365_1006782 3300039437 Bacteria 2041
164 Ga0436365_1712955 3300039437 Bacteria 2903
165 Ga0436360_0183158 3300039438 Bacteria 1086
166 Ga0436363_0256725 3300039450 Unclassified 1017
167 Ga0436363_0859154 3300039450 Bacteria 1395
168 Ga0439465_0006606 3300041413 Bacteria 3685
169 Ga0451800_1514289 3300041459 Unclassified 1113
170 Ga0466972_0004556 3300044658 Bacteria 6944
171 Ga0466963_0059956 3300044694 Bacteria 2541
172 Ga0466968_0007263 3300044735 Bacteria 4210
173 Ga0466957_0029429 3300044842 Bacteria 3275
174 Ga0466960_0030758 3300044901 Bacteria 2473
175 Ga0495653_0072693 3300046463 Bacteria 2567
176 Ga0495580_0234858 3300046472 Bacteria 1258
177 Ga0495662_0103236 3300046476 Bacteria 1395
178 Ga0495664_0015692 3300046477 Bacteria 4309
179 Ga0495608_0005547 3300046511 Bacteria 9016
180 Ga0495640_0054355 3300046533 Bacteria 2743
181 Ga0495587_0030000 3300046536 Bacteria 3299
182 Ga0495645_0000658 3300046543 Bacteria 23841
183 Ga0495633_0022040 3300046558 Unclassified 3176
184 Ga0495656_0005718 3300046615 Plasmid 4311
185 Ga0495635_0041872 3300046663 Bacteria 3164
186 Ga0495588_0019291 3300046674 Bacteria 3339
187 Ga0495657_0027028 3300046675 Bacteria 4056
188 Ga0495599_0007899 3300046678 Bacteria 6452
189 Ga0495623_0036478 3300046679 Bacteria 3149
190 Ga0495646_0029290 3300046680 Bacteria 3442
191 Ga0495669_0038072 3300046684 Unclassified 2130
192 Ga0495600_0108472 3300046809 Bacteria 1808
193 Ga0495604_0008601 3300047317 Bacteria 8067
194 Ga0495674_0025356 3300047319 Bacteria 5438
195 Ga0495680_0073404 3300047322 Bacteria 2600
196 Ga0495684_0043800 3300047471 Bacteria 3426
197 Ga0495602_0013421 3300048088 Bacteria 8373
198 Ga0496101_0136788 3300048904 Bacteria 1865
199 Ga0496104_0004772 3300048907 Bacteria 11807
200 Ga0496104_0074328 3300048907 Bacteria 3236
201 Ga0496105_0024757 3300048908 Bacteria 4879
202 Ga0496110_0118133 3300048913 Bacteria 2388
203 Ga0496111_0010786 3300048914 Bacteria 6143
204 Ga0496112_0324266 3300048915 Bacteria 1484
205 Ga0496115_0043034 3300048918 Bacteria 3600
206 Ga0496119_0038437 3300048922 Bacteria 3092
207 Ga0501034_0007161 3300049571 Bacteria 11903
208 Ga0501034_0053322 3300049571 Bacteria 4073
209 Ga0501036_0204231 3300049572 Bacteria 1662
210 Ga0501047_0190371 3300049581 Bacteria 1915
211 Ga0501068_0054194 3300049584 Bacteria 2429
212 Ga0501070_0128708 3300049586 Bacteria 2092
213 Ga0501072_0404482 3300049588 Unclassified 1083
214 Ga0501076_0127298 3300049592 Bacteria 2065
215 Ga0501045_0172049 3300049824 Unclassified 1613
216 nmdc:mga03683_19290_c1 3300050489 Bacteria 2602
217 nmdc:mga03683_4553_c2 3300050489 Bacteria 3474
218 nmdc:mga03n38_11149_c1 3300050490 Bacteria 3338
219 nmdc:mga03n38_188144_c1 3300050490 Bacteria 1062
220 nmdc:mga00v17_12761_c1 3300050491 Bacteria 4641
221 nmdc:mga0yw44_10345_c1 3300050492 Bacteria 4760
222 nmdc:mga0yw44_115555_c1 3300050492 Bacteria 1724
223 nmdc:mga06z11_23026_c1 3300050494 Plasmid 2919
224 nmdc:mga06z11_284622_c1 3300050494 Unclassified 980
225 nmdc:mga05p37_131986_c1 3300050507 Bacteria 3065
226 nmdc:mga05p37_192993_c1 3300050507 Bacteria 2471
227 nmdc:mga05p37_684357_c1 3300050507 Bacteria 1142
228 nmdc:mga09592_294608_c1 3300050508 Bacteria 1407
229 nmdc:mga09592_94369_c1 3300050508 Bacteria 2559
230 nmdc:mga0qj67_176143_c1 3300050509 Bacteria 1737
231 nmdc:mga06r32_248683_c1 3300050510 Bacteria 1766
232 nmdc:mga08y16_168964_c1 3300050511 Bacteria 2272
233 nmdc:mga08y16_31653_c1 3300050511 Bacteria 5562
234 nmdc:mga08y16_85907_c1 3300050511 Bacteria 3279
235 nmdc:mga0n895_22078_c1 3300050512 Bacteria 5964
236 nmdc:mga0n895_311802_c1 3300050512 Bacteria 1594
237 nmdc:mga0n895_40738_c1 3300050512 Bacteria 4513
238 nmdc:mga0rr50_17459_c1 3300050513 Bacteria 4792
239 nmdc:mga0rr50_193847_c1 3300050513 Bacteria 1666
240 nmdc:mga08x19_17170_c1 3300050514 Bacteria 4424
241 nmdc:mga0sz30_60_c1 3300050516 Bacteria 41594
242 nmdc:mga0sz30_86945_c1 3300050516 Unclassified 1357
243 Ga0495601_0004671 3300053077 Bacteria 7930
244 Ga0495612_0000830 3300053078 Bacteria 12567
245 Ga0495619_0044124 3300053085 Bacteria 2925
246 Ga0500644_0014896 3300053088 Bacteria 2205
247 Ga0500651_0206785 3300053093 Bacteria 1156
248 Ga0501082_0231587 3300060353 Bacteria 1608
249 2842926642 2842922631 Bacteria 5824079
250 2857533176 2857531043 Bacteria 6754041
251 2883579888 2883577096 Bacteria 4709178
252 3005485618 3005483717 Bacteria 7877331
253 Ga0495635_0218900
254 Ga0065707_10269403
255 Ga0070680_100230270
256 Ga0070691_10035906
257 Ga0070714_100121023
258 Ga0070714_100227601
259 Ga0070713_100069632
260 Ga0070713_100119445
261 Ga0070713_100179050
262 Ga0070713_100608261
263 Ga0070710_10043703
264 Ga0070701_10070220
265 Ga0070711_100077191
266 Ga0070711_100163737
267 Ga0070694_100078872
268 Ga0070708_100099008
269 Ga0070678_100278457
270 Ga0070698_100137250
271 Ga0070695_100013703
272 Ga0070665_100265859
273 Ga0070664_100092990
274 Ga0068856_100065405
275 Ga0068856_100246971
276 Ga0068856_100267625
277 Ga0068861_100026263
278 Ga0068858_100518206
279 Ga0068860_100014261
280 Ga0068860_100308269
281 Ga0081455_10000302
282 Ga0081455_10002517
283 Ga0081455_10088334
284 Ga0081455_10097589
285 Ga0081455_10102733
286 Ga0081538_10005234
287 Ga0081540_1002759
288 Ga0081540_1003147
289 Ga0081540_1048968
290 Ga0081539_10013287
291 Ga0081539_10032428
292 Ga0081539_10063704
293 Ga0081539_10078151
294 Ga0070717_10012817
295 Ga0070717_10297643
296 Ga0075365_10001384
297 Ga0075365_10055194
298 Ga0075364_10009050
299 Ga0075364_10012396
300 Ga0070716_100035979
301 Ga0070716_100423044
302 Ga0070712_100059159
303 Ga0070712_100292364
304 Ga0075362_10005976
305 Ga0075362_10014001
306 Ga0075362_10016003
307 Ga0075367_10040408
308 Ga0075367_10201781
309 Ga0075367_10287629
310 Ga0075369_10006518
311 Ga0075369_10087303
312 Ga0075366_10153336
313 Ga0075428_100043611
314 Ga0075430_100056032
315 Ga0075430_100131691
316 Ga0075433_10116382
317 Ga0075434_100002282
318 Ga0075434_100006763
319 Ga0075434_100107093
320 Ga0075434_100238679
321 Ga0075435_100069055
322 Ga0075435_100103100
323 Ga0105240_10350879
324 Ga0111539_10044121
325 Ga0111539_10113986
326 Ga0111539_10154478
327 Ga0105245_10621273
328 Ga0105243_10385422
329 Ga0105248_10198140
330 Ga0105237_10126105
331 Ga0105238_10071267
332 Ga0105239_10081010
333 Ga0105246_10042766
334 Ga0157373_10104629
335 Ga0157370_10092121
336 Ga0163162_10090910
337 Ga0163162_10175863
338 Ga0163162_10631041
339 Ga0157375_10179958
340 Ga0163163_10095968
341 Ga0157380_10322102
342 Ga0182008_10095370
343 Ga0182008_10102498
344 Ga0163161_10125270
345 Ga0213873_10010252
346 Ga0209148_1000305
347 Ga0209233_1029641
348 Ga0209455_1004164
349 Ga0209758_1008322
350 Ga0207692_10014644
351 Ga0207671_10055371
352 Ga0207663_10009064
353 Ga0207660_10437034
354 Ga0207657_10120965
355 Ga0207694_10034535
356 Ga0207694_10134082
357 Ga0207687_10046401
358 Ga0207700_10115823
359 Ga0207700_10151205
360 Ga0207700_10175501
361 Ga0207665_10192401
362 Ga0207703_10195724
363 Ga0207639_10432308
364 Ga0207708_10104903
365 Ga0207708_10123760
366 Ga0207702_10359091
367 Ga0207674_10029852
368 Ga0207675_100161601
369 Ga0207683_10012047
370 Ga0207683_10131135
371 Ga0207698_10251654
372 Ga0207428_10029183
373 Ga0207428_10320042
374 Ga0268266_10008002
375 Ga0268264_10010289
376 Ga0268264_10197279
377 Ga0268264_10344633
378 Ga0265337_1046326
379 Ga0265338_10013575
380 Ga0307412_10126708
381 Ga0373928_0020399
382 Ga0373934_0016497
383 Ga0373934_0064453
384 Ga0373940_0011791
385 Ga0373923_0019135
386 Ga0373939_0006245
387 Ga0373953_0021994
388 Ga0373954_0028186
389 Ga0373956_0014945
390 Ga0373957_0010506
391 Ga0373955_0072891
392 Ga0373942_0017752
393 Ga0373961_0001772
394 Ga0373962_0012795
395 Ga0373962_0014350
396 Ga0373924_0049381
397 Ga0373931_0005303
398 Ga0373931_0013166
399 Ga0373927_0096110
400 Ga0373947_0043650
401 Ga0373947_0099374
402 Ga0373937_0024470
403 Ga0373937_0050788
404 Ga0373937_0352386
405 Ga0373937_0425571
406 Ga0373925_0047028
407 Ga0373925_0280910
408 Ga0395899_0128889
409 Ga0395900_0094126
410 Ga0395900_0150482
411 Ga0395905_0287907
412 Ga0436364_0355092
413 Ga0436364_0429861
414 Ga0395901_0066957
415 Ga0436365_1006782
416 Ga0436365_1712955
417 Ga0436360_0183158
418 Ga0436363_0256725
419 Ga0436363_0859154
420 Ga0439465_0006606
421 Ga0451800_1514289
422 Ga0466972_0004556
423 Ga0466963_0059956
424 Ga0466968_0007263
425 Ga0466957_0029429
426 Ga0466960_0030758
427 Ga0495653_0072693
428 Ga0495580_0234858
429 Ga0495662_0103236
430 Ga0495664_0015692
431 Ga0495608_0005547
432 Ga0495640_0054355
433 Ga0495587_0030000
434 Ga0495645_0000658
435 Ga0495633_0022040
436 Ga0495656_0005718
437 Ga0495635_0041872
438 Ga0495588_0019291
439 Ga0495657_0027028
440 Ga0495599_0007899
441 Ga0495623_0036478
442 Ga0495646_0029290
443 Ga0495669_0038072
444 Ga0495600_0108472
445 Ga0495604_0008601
446 Ga0495674_0025356
447 Ga0495680_0073404
448 Ga0495684_0043800
449 Ga0495602_0013421
450 Ga0496101_0136788
451 Ga0496104_0004772
452 Ga0496104_0074328
453 Ga0496105_0024757
454 Ga0496110_0118133
455 Ga0496111_0010786
456 Ga0496112_0324266
457 Ga0496115_0043034
458 Ga0496119_0038437
459 Ga0501034_0007161
460 Ga0501034_0053322
461 Ga0501036_0204231
462 Ga0501047_0190371
463 Ga0501068_0054194
464 Ga0501070_0128708
465 Ga0501072_0404482
466 Ga0501076_0127298
467 Ga0501045_0172049
468 nmdc:mga03683_19290_c1
469 nmdc:mga03683_4553_c2
470 nmdc:mga03n38_11149_c1
471 nmdc:mga03n38_188144_c1
472 nmdc:mga00v17_12761_c1
473 nmdc:mga0yw44_10345_c1
474 nmdc:mga0yw44_115555_c1
475 nmdc:mga06z11_23026_c1
476 nmdc:mga06z11_284622_c1
477 nmdc:mga05p37_131986_c1
478 nmdc:mga05p37_192993_c1
479 nmdc:mga05p37_684357_c1
480 nmdc:mga09592_294608_c1
481 nmdc:mga09592_94369_c1
482 nmdc:mga0qj67_176143_c1
483 nmdc:mga06r32_248683_c1
484 nmdc:mga08y16_168964_c1
485 nmdc:mga08y16_31653_c1
486 nmdc:mga08y16_85907_c1
487 nmdc:mga0n895_22078_c1
488 nmdc:mga0n895_311802_c1
489 nmdc:mga0n895_40738_c1
490 nmdc:mga0rr50_17459_c1
491 nmdc:mga0rr50_193847_c1
492 nmdc:mga08x19_17170_c1
493 nmdc:mga0sz30_60_c1
494 nmdc:mga0sz30_86945_c1
495 Ga0495601_0004671
496 Ga0495612_0000830
497 Ga0495619_0044124
498 Ga0500644_0014896
499 Ga0500651_0206785
500 Ga0501082_0231587
501 2842926642
502 2857533176
503 2883579888
504 3005485618

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

67

167

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rxz-assembly1.cif.gz_B crystal structure of putative polysaccharide deacetylase from mycobacterium smegmatis 0.8804 29 293
3cl6-assembly1.cif.gz_A crystal structure of puue allantoinase 0.8395 31 289
3qbu-assembly1.cif.gz_C crystal structure of putative peptidoglycan deactelyase (hp0310) from helicobacter pylori 0.839 37 289
1z7a-assembly1.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8285 31 292
3s6o-assembly1.cif.gz_D crystal structure of a polysaccharide deacetylase family protein from burkholderia pseudomallei 0.8274 31 289
ID Description Score Start End Superfamily
3qbuB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.839 37 289 3.20.20.370
3rxzD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8351 29 293 3.20.20.370
af_O13842_2_320_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8155 31 293 3.20.20.370
3rxzD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7935 29 293 3.20.20.370
1z7aC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7838 31 292 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A2E5PJ56-F1-model_v4 Chitooligosaccharide deacetylase (Nodulation protein B) 0.9479 1 293 GO:0005975
GO:0016810
AF-A0A2E5PJ56-F1-model_v4 Chitooligosaccharide deacetylase (Nodulation protein B) 0.9448 1 293 GO:0005975
GO:0016810
AF-A0A1H7EZV7-F1-model_v4 Polysaccharide deacetylase 0.9412 1 292 GO:0005975
GO:0016810
AF-A0A4R0YE63-F1-model_v4 Chitooligosaccharide deacetylase (Nodulation protein B) 0.934 2 293 GO:0005975
GO:0016810
AF-A0A1H7EZV7-F1-model_v4 Polysaccharide deacetylase 0.932 1 292 GO:0005975
GO:0016810

Map