F363446

General Info

Members Datasets Scaffolds Average Seq Length
252 161 246 118

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0363902|Ga0466966_0363902_469_858
Length 129
Sequence VQDIGMAAPNPRTLVVKCTAGVDEPERCSQAFTVAATALAAGAQVSLWLTGEAAWLAVPGRAEAFTLPHAAPLAELRDAVLAGGTLTVCSQCAARRDITEEMLVAGTVIRGSASFVDECLADTAQALVY

Samples

Sample ID Description Type Environment
1 2643221604 Nocardioides sp. Root190 Isolate Unclassified
2 2643221617 Nocardioides sp. Root79 Isolate Unclassified
3 2643221620 Nocardioides sp. Root240 Isolate Unclassified
4 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
5 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
6 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
101 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
112 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
113 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.97
Nodule 0
Rhizoplane 6.35
Rhizosphere 86.11
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10047069 3300002067 Bacteria 1250
2 Ga0070658_10000206 3300005327 Bacteria 52179
3 Ga0070683_100005748 3300005329 Bacteria 10362
4 Ga0070683_100317436 3300005329 Bacteria 1483
5 Ga0070683_100596100 3300005329 Bacteria 1057
6 Ga0068869_100019925 3300005334 Bacteria 4593
7 Ga0068869_100144313 3300005334 Bacteria 1841
8 Ga0070666_10187775 3300005335 Bacteria 1451
9 Ga0070680_100038904 3300005336 Unclassified 3848
10 Ga0070682_100004617 3300005337 Bacteria 7652
11 Ga0070682_100654316 3300005337 Bacteria 837
12 Ga0068868_100072499 3300005338 Bacteria 2748
13 Ga0068868_100158631 3300005338 Bacteria 1867
14 Ga0070660_100144839 3300005339 Bacteria 1908
15 Ga0070660_101650085 3300005339 Bacteria 546
16 Ga0070687_100048974 3300005343 Bacteria 2175
17 Ga0070692_10002083 3300005345 Bacteria 7626
18 Ga0070692_10051036 3300005345 Bacteria 2150
19 Ga0070692_10155382 3300005345 Bacteria 1306
20 Ga0070668_100279628 3300005347 Bacteria 1393
21 Ga0070668_101908858 3300005347 Bacteria 547
22 Ga0070675_100529088 3300005354 Bacteria 1064
23 Ga0070671_100079784 3300005355 Bacteria 2736
24 Ga0070671_101723513 3300005355 Bacteria 556
25 Ga0070659_100007094 3300005366 Bacteria 8126
26 Ga0070659_100214772 3300005366 Bacteria 1586
27 Ga0070659_100435045 3300005366 Bacteria 1111
28 Ga0070659_100791366 3300005366 Bacteria 824
29 Ga0070667_100002932 3300005367 Bacteria 14665
30 Ga0070667_100025482 3300005367 Bacteria 4917
31 Ga0070667_100091991 3300005367 Bacteria 2609
32 Ga0070714_102134351 3300005435 Bacteria 546
33 Ga0070701_10803338 3300005438 Bacteria 642
34 Ga0070663_100694632 3300005455 Bacteria 864
35 Ga0070678_100200682 3300005456 Bacteria 1646
36 Ga0070681_10227620 3300005458 Bacteria 1779
37 Ga0070681_10255859 3300005458 Bacteria 1663
38 Ga0070681_10686008 3300005458 Bacteria 940
39 Ga0070681_11505764 3300005458 Bacteria 597
40 Ga0070685_10125377 3300005466 Bacteria 1599
41 Ga0070679_101283661 3300005530 Bacteria 678
42 Ga0070679_101466589 3300005530 Bacteria 629
43 Ga0070679_102008574 3300005530 Viruses 527
44 Ga0070684_100016408 3300005535 Bacteria 6053
45 Ga0070684_100072282 3300005535 Bacteria 3037
46 Ga0070684_101483628 3300005535 Unclassified 639
47 Ga0068853_100853842 3300005539 Bacteria 873
48 Ga0070686_100034770 3300005544 Bacteria 3108
49 Ga0070665_100003883 3300005548 Bacteria 15786
50 Ga0070665_100335028 3300005548 Bacteria 1518
51 Ga0070665_100751960 3300005548 Bacteria 988
52 Ga0068855_100073816 3300005563 Bacteria 3963
53 Ga0068855_100322292 3300005563 Bacteria 1708
54 Ga0068855_100570831 3300005563 Bacteria 1223
55 Ga0068855_101080030 3300005563 Bacteria 840
56 Ga0070664_100809600 3300005564 Bacteria 876
57 Ga0068857_100001796 3300005577 Bacteria 17261
58 Ga0068857_101411895 3300005577 Bacteria 677
59 Ga0068854_101487527 3300005578 Bacteria 614
60 Ga0068856_100010096 3300005614 Bacteria 9175
61 Ga0068856_100013129 3300005614 Bacteria 8024
62 Ga0068856_100047448 3300005614 Bacteria 4231
63 Ga0068856_100847460 3300005614 Bacteria 933
64 Ga0070702_100641658 3300005615 Bacteria 802
65 Ga0068859_100001814 3300005617 Bacteria 21752
66 Ga0068864_100006283 3300005618 Bacteria 9744
67 Ga0068864_100374508 3300005618 Bacteria 1348
68 Ga0068866_10192947 3300005718 Bacteria 1211
69 Ga0068863_100015970 3300005841 Bacteria 7202
70 Ga0068858_100031845 3300005842 Bacteria 4901
71 Ga0068858_100036146 3300005842 Bacteria 4580
72 Ga0068860_100000114 3300005843 Bacteria 128789
73 Ga0068860_100075501 3300005843 Bacteria 3206
74 Ga0075365_10443740 3300006038 Bacteria 916
75 Ga0075368_10030629 3300006042 Bacteria 2084
76 Ga0075367_10167533 3300006178 Bacteria 1368
77 Ga0097621_101786352 3300006237 Bacteria 586
78 Ga0068871_100260640 3300006358 Bacteria 1512
79 Ga0097620_100001814 3300006931 Bacteria 21752
80 Ga0105247_10005186 3300009101 Bacteria 8242
81 Ga0105248_11263719 3300009177 Unclassified 835
82 Ga0105249_11638683 3300009553 Bacteria 716
83 Ga0105239_11415316 3300010375 Unclassified 803
84 Ga0157373_10297767 3300013100 Bacteria 1145
85 Ga0157371_10008884 3300013102 Bacteria 7957
86 Ga0157374_10163581 3300013296 Bacteria 2168
87 Ga0157378_12722432 3300013297 Bacteria 547
88 Ga0163162_11210596 3300013306 Bacteria 857
89 Ga0157375_11834794 3300013308 Bacteria 719
90 Ga0157375_12004125 3300013308 Bacteria 688
91 Ga0163163_10567072 3300014325 Bacteria 1198
92 Ga0163163_11520567 3300014325 Bacteria 731
93 Ga0157379_10137611 3300014968 Bacteria 2201
94 Ga0157376_10912024 3300014969 Bacteria 897
95 Ga0207642_10058605 3300025899 Bacteria 1777
96 Ga0207710_10006182 3300025900 Bacteria 5123
97 Ga0207688_10020860 3300025901 Bacteria 3577
98 Ga0207680_10017231 3300025903 Bacteria 3813
99 Ga0207647_10110105 3300025904 Unclassified 1629
100 Ga0207647_10126912 3300025904 Bacteria 1501
101 Ga0207705_10000289 3300025909 Bacteria 46941
102 Ga0207654_10328684 3300025911 Bacteria 1047
103 Ga0207707_10123398 3300025912 Bacteria 2265
104 Ga0207707_11460247 3300025912 Bacteria 543
105 Ga0207671_10065014 3300025914 Bacteria 2712
106 Ga0207671_10539375 3300025914 Bacteria 930
107 Ga0207671_10553073 3300025914 Bacteria 917
108 Ga0207662_10554894 3300025918 Bacteria 796
109 Ga0207657_10013107 3300025919 Bacteria 8144
110 Ga0207652_10331262 3300025921 Bacteria 1375
111 Ga0207652_11633790 3300025921 Bacteria 549
112 Ga0207687_10085016 3300025927 Bacteria 2294
113 Ga0207644_10047373 3300025931 Bacteria 3067
114 Ga0207690_10008194 3300025932 Bacteria 6199
115 Ga0207690_10207973 3300025932 Bacteria 1490
116 Ga0207690_10226236 3300025932 Bacteria 1434
117 Ga0207709_10390544 3300025935 Bacteria 1061
118 Ga0207711_10847108 3300025941 Unclassified 851
119 Ga0207711_11297857 3300025941 Bacteria 670
120 Ga0207689_10217490 3300025942 Bacteria 1579
121 Ga0207689_10741961 3300025942 Bacteria 828
122 Ga0207661_10247843 3300025944 Bacteria 1582
123 Ga0207661_10550473 3300025944 Bacteria 1057
124 Ga0207661_11894797 3300025944 Bacteria 542
125 Ga0207679_10543855 3300025945 Bacteria 1041
126 Ga0207667_10192009 3300025949 Bacteria 2095
127 Ga0207667_10442558 3300025949 Bacteria 1321
128 Ga0207667_10604294 3300025949 Bacteria 1106
129 Ga0207712_10577518 3300025961 Bacteria 970
130 Ga0207712_11318862 3300025961 Bacteria 645
131 Ga0207668_10396810 3300025972 Unclassified 1165
132 Ga0207658_10021606 3300025986 Bacteria 4471
133 Ga0207658_10840941 3300025986 Bacteria 834
134 Ga0207677_10015036 3300026023 Bacteria 4538
135 Ga0207703_10036436 3300026035 Bacteria 3916
136 Ga0207703_10056803 3300026035 Bacteria 3189
137 Ga0207639_10063120 3300026041 Bacteria 2867
138 Ga0207639_10349031 3300026041 Bacteria 1321
139 Ga0207702_10125942 3300026078 Bacteria 2300
140 Ga0207702_10468495 3300026078 Bacteria 1224
141 Ga0207702_10798646 3300026078 Bacteria 933
142 Ga0207641_10051452 3300026088 Bacteria 3488
143 Ga0207676_10164123 3300026095 Bacteria 1928
144 Ga0207674_10006958 3300026116 Bacteria 13240
145 Ga0207683_10208297 3300026121 Bacteria 1779
146 Ga0209813_10090298 3300027866 Bacteria 1027
147 Ga0268266_10001159 3300028379 Bacteria 32594
148 Ga0268266_10360418 3300028379 Bacteria 1368
149 Ga0268266_10658392 3300028379 Bacteria 1008
150 Ga0268266_11877253 3300028379 Bacteria 573
151 Ga0268264_10000147 3300028381 Bacteria 164790
152 Ga0316177_1105534 3300030731 Bacteria 807
153 Ga0316577_10152432 3300031733 Bacteria 1303
154 Ga0307407_11041551 3300031903 Bacteria 634
155 Ga0307412_10240202 3300031911 Bacteria 1401
156 Ga0307416_100369293 3300032002 Bacteria 1460
157 Ga0307414_10398484 3300032004 Bacteria 1195
158 Ga0307411_12116204 3300032005 Bacteria 527
159 Ga0316585_10197338 3300032137 Bacteria 665
160 Ga0316574_0073007 3300035398 Unclassified 2169
161 Ga0395900_1665001 3300037418 Bacteria 549
162 Ga0395901_0017388 3300038443 Bacteria 7341
163 Ga0439438_131091 3300041405 Bacteria 601
164 Ga0439465_0084971 3300041413 Bacteria 1077
165 Ga0439465_0249579 3300041413 Bacteria 656
166 Ga0439442_156641 3300042002 Bacteria 508
167 Ga0439448_0123483 3300042005 Bacteria 889
168 Ga0466969_0208757 3300044656 Bacteria 890
169 Ga0466969_0277152 3300044656 Bacteria 759
170 Ga0466966_0025573 3300044684 Bacteria 3855
171 Ga0466966_0216109 3300044684 Bacteria 1158
172 Ga0466966_0363902 3300044684 Bacteria 869
173 Ga0466961_0002462 3300044693 Bacteria 11487
174 Ga0466961_0023245 3300044693 Bacteria 3988
175 Ga0466961_0038992 3300044693 Bacteria 3046
176 Ga0466961_0095701 3300044693 Bacteria 1872
177 Ga0466961_0631687 3300044693 Bacteria 643
178 Ga0466963_0015704 3300044694 Bacteria 4696
179 Ga0466963_0466842 3300044694 Bacteria 891
180 Ga0466964_0136850 3300044706 Bacteria 1122
181 Ga0466971_0079239 3300044719 Bacteria 1497
182 Ga0466971_0154552 3300044719 Bacteria 1072
183 Ga0466971_0162852 3300044719 Bacteria 1044
184 Ga0466971_0577037 3300044719 Bacteria 559
185 Ga0466968_0740485 3300044735 Bacteria 504
186 Ga0466970_0007684 3300044765 Bacteria 5408
187 Ga0466970_0737333 3300044765 Bacteria 575
188 Ga0466957_0129433 3300044842 Bacteria 1616
189 Ga0466957_0687295 3300044842 Bacteria 721
190 Ga0466960_0131144 3300044901 Bacteria 1323
191 Ga0466960_0724884 3300044901 Bacteria 598
192 Ga0466959_0004060 3300045049 Bacteria 9740
193 Ga0466959_0017888 3300045049 Bacteria 5198
194 Ga0466959_0037258 3300045049 Bacteria 3593
195 Ga0466959_0060496 3300045049 Unclassified 2756
196 Ga0466959_0116638 3300045049 Bacteria 1901
197 Ga0466959_0555478 3300045049 Bacteria 774
198 Ga0466958_0035534 3300045836 Bacteria 2977
199 Ga0466958_0043164 3300045836 Bacteria 2715
200 Ga0466967_0020226 3300045976 Bacteria 5374
201 Ga0466967_1164751 3300045976 Bacteria 768
202 Ga0466967_1654665 3300045976 Bacteria 637
203 Ga0495606_0003885 3300046507 Bacteria 15405
204 Ga0495668_0000111 3300046616 Bacteria 130715
205 Ga0495625_0004275 3300046660 Bacteria 13588
206 Ga0495658_0649324 3300046683 Bacteria 676
207 Ga0495674_0782848 3300047319 Bacteria 743
208 Ga0495674_0977158 3300047319 Bacteria 650
209 Ga0495680_0279604 3300047322 Bacteria 1177
210 Ga0495683_0022573 3300047323 Bacteria 3236
211 Ga0495675_0377192 3300047444 Bacteria 830
212 Ga0495602_0189180 3300048088 Bacteria 1580
213 Ga0495626_0000875 3300048091 Bacteria 26772
214 Ga0496100_1023314 3300048903 Bacteria 650
215 Ga0496102_0000013 3300048905 Bacteria 311668
216 Ga0496102_0504100 3300048905 Bacteria 1132
217 Ga0496102_0586014 3300048905 Bacteria 1038
218 Ga0496102_0701289 3300048905 Bacteria 935
219 Ga0496103_0000239 3300048906 Bacteria 53554
220 Ga0496104_0075336 3300048907 Bacteria 3213
221 Ga0496104_0742734 3300048907 Bacteria 888
222 Ga0496105_0953349 3300048908 Bacteria 644
223 Ga0496106_0723421 3300048909 Bacteria 792
224 Ga0496107_0298572 3300048910 Bacteria 1199
225 Ga0496110_0214347 3300048913 Bacteria 1751
226 Ga0496110_1350415 3300048913 Bacteria 622
227 Ga0496111_0042710 3300048914 Bacteria 3256
228 Ga0496112_0418864 3300048915 Bacteria 1278
229 Ga0496115_0682334 3300048918 Bacteria 809
230 Ga0496118_0017555 3300048921 Bacteria 6506
231 Ga0496119_0000200 3300048922 Bacteria 84506
232 Ga0496119_0187184 3300048922 Bacteria 1081
233 Ga0496120_0003141 3300048923 Bacteria 15447
234 Ga0501032_0936862 3300049569 Bacteria 545
235 Ga0501034_0578847 3300049571 Bacteria 1030
236 Ga0501075_0336340 3300049591 Bacteria 1151
237 Ga0501083_0420520 3300049744 Bacteria 870
238 nmdc:mga03n38_358739_c1 3300050490 Bacteria 795
239 nmdc:mga03n38_584843_c1 3300050490 Bacteria 634
240 nmdc:mga00v17_308880_c1 3300050491 Bacteria 1027
241 nmdc:mga00v17_748210_c1 3300050491 Bacteria 625
242 nmdc:mga0yw44_451458_c1 3300050492 Bacteria 871
243 nmdc:mga04h51_106285_c1 3300050495 Bacteria 1029
244 nmdc:mga08y16_1800473_c1 3300050511 Bacteria 565
245 Ga0466962_0124457 3300061719 Bacteria 1245
246 Ga0466962_0324561 3300061719 Bacteria 764

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0216109 Ga0466966_0216109_301_699 94
2 3300044693 Ga0466961_0002462 Ga0466961_0002462_997_1395 94
3 3300044719 Ga0466971_0154552 Ga0466971_0154552_572_970 94
4 3300044735 Ga0466968_0740485 Ga0466968_0740485_42_410 94
5 3300044765 Ga0466970_0007684 Ga0466970_0007684_2444_2842 94
6 3300044842 Ga0466957_0687295 Ga0466957_0687295_205_603 94
7 3300045049 Ga0466959_0017888 Ga0466959_0017888_3602_4000 94
8 3300005530 Ga0070679_101283661 Ga0070679_1012836611 97
9 3300025921 Ga0207652_10331262 Ga0207652_103312622 97
10 3300005366 Ga0070659_100214772 Ga0070659_1002147722 101
11 3300005458 Ga0070681_10227620 Ga0070681_102276202 101
12 3300013100 Ga0157373_10297767 Ga0157373_102977672 101
13 3300025932 Ga0207690_10226236 Ga0207690_102262362 101
14 3300044656 Ga0466969_0277152 Ga0466969_0277152_259_621 105
15 3300045049 Ga0466959_0116638 Ga0466959_0116638_1179_1541 105
16 3300044684 Ga0466966_0025573 Ga0466966_0025573_1192_1554 106
17 3300044719 Ga0466971_0162852 Ga0466971_0162852_645_1007 106
18 3300044842 Ga0466957_0129433 Ga0466957_0129433_482_844 106
19 3300045049 Ga0466959_0004060 Ga0466959_0004060_1123_1485 106
20 3300045836 Ga0466958_0035534 Ga0466958_0035534_2039_2401 106
21 3300061719 Ga0466962_0124457 Ga0466962_0124457_858_1220 106
22 3300045976 Ga0466967_1164751 Ga0466967_1164751_387_746 107
23 3300044719 Ga0466971_0079239 Ga0466971_0079239_843_1205 109
24 3300044765 Ga0466970_0737333 Ga0466970_0737333_53_415 109
25 3300061719 Ga0466962_0324561 Ga0466962_0324561_208_570 109
26 3300005438 Ga0070701_10803338 Ga0070701_108033382 110
27 3300005347 Ga0070668_101908858 Ga0070668_1019088581 112
28 3300048908 Ga0496105_0953349 Ga0496105_0953349_249_611 112
29 3300005329 Ga0070683_100005748 Ga0070683_1000057482 114
30 3300005334 Ga0068869_100144313 Ga0068869_1001443133 114
31 3300005337 Ga0070682_100004617 Ga0070682_1000046173 114
32 3300005338 Ga0068868_100158631 Ga0068868_1001586312 114
33 3300005339 Ga0070660_101650085 Ga0070660_1016500851 114
34 3300005343 Ga0070687_100048974 Ga0070687_1000489743 114
35 3300005345 Ga0070692_10051036 Ga0070692_100510362 114
36 3300005367 Ga0070667_100091991 Ga0070667_1000919913 114
37 3300005456 Ga0070678_100200682 Ga0070678_1002006822 114
38 3300005458 Ga0070681_10686008 Ga0070681_106860081 114
39 3300005466 Ga0070685_10125377 Ga0070685_101253774 114
40 3300005535 Ga0070684_100016408 Ga0070684_1000164088 114
41 3300005544 Ga0070686_100034770 Ga0070686_1000347704 114
42 3300005548 Ga0070665_100751960 Ga0070665_1007519602 114
43 3300005563 Ga0068855_100570831 Ga0068855_1005708313 114
44 3300005564 Ga0070664_100809600 Ga0070664_1008096002 114
45 3300005577 Ga0068857_100001796 Ga0068857_1000017969 114
46 3300005614 Ga0068856_100010096 Ga0068856_10001009611 114
47 3300005615 Ga0070702_100641658 Ga0070702_1006416582 114
48 3300005618 Ga0068864_100006283 Ga0068864_1000062838 114
49 3300005718 Ga0068866_10192947 Ga0068866_101929473 114
50 3300005842 Ga0068858_100036146 Ga0068858_1000361464 114
51 3300005843 Ga0068860_100075501 Ga0068860_1000755014 114
52 3300006358 Ga0068871_100260640 Ga0068871_1002606402 114
53 3300025899 Ga0207642_10058605 Ga0207642_100586052 114
54 3300025901 Ga0207688_10020860 Ga0207688_100208605 114
55 3300025911 Ga0207654_10328684 Ga0207654_103286842 114
56 3300025912 Ga0207707_11460247 Ga0207707_114602471 114
57 3300025914 Ga0207671_10539375 Ga0207671_105393752 114
58 3300025918 Ga0207662_10554894 Ga0207662_105548942 114
59 3300025927 Ga0207687_10085016 Ga0207687_100850164 114
60 3300025941 Ga0207711_11297857 Ga0207711_112978571 114
61 3300025942 Ga0207689_10217490 Ga0207689_102174903 114
62 3300025944 Ga0207661_10247843 Ga0207661_102478432 114
63 3300025945 Ga0207679_10543855 Ga0207679_105438552 114
64 3300025961 Ga0207712_10577518 Ga0207712_105775182 114
65 3300026035 Ga0207703_10036436 Ga0207703_100364363 114
66 3300026041 Ga0207639_10063120 Ga0207639_100631204 114
67 3300026095 Ga0207676_10164123 Ga0207676_101641234 114
68 3300026116 Ga0207674_10006958 Ga0207674_100069582 114
69 3300028379 Ga0268266_10658392 Ga0268266_106583922 114
70 3300028379 Ga0268266_11877253 Ga0268266_118772532 114
71 3300047319 Ga0495674_0977158 Ga0495674_0977158_158_502 114
72 3300048905 Ga0496102_0586014 Ga0496102_0586014_677_1021 114
73 3300050511 nmdc:mga08y16_1800473_c1 nmdc:mga08y16_1800473_c1_14_358 114
74 3300005327 Ga0070658_10000206 Ga0070658_1000020639 115
75 3300005336 Ga0070680_100038904 Ga0070680_1000389043 115
76 3300005366 Ga0070659_100791366 Ga0070659_1007913662 115
77 3300005458 Ga0070681_11505764 Ga0070681_115057641 115
78 3300006038 Ga0075365_10443740 Ga0075365_104437402 115
79 3300006178 Ga0075367_10167533 Ga0075367_101675332 115
80 3300025909 Ga0207705_10000289 Ga0207705_1000028912 115
81 3300046507 Ga0495606_0003885 Ga0495606_0003885_12222_12602 115
82 3300046616 Ga0495668_0000111 Ga0495668_0000111_87700_88080 115
83 3300046660 Ga0495625_0004275 Ga0495625_0004275_3936_4316 115
84 3300047323 Ga0495683_0022573 Ga0495683_0022573_367_747 115
85 3300048091 Ga0495626_0000875 Ga0495626_0000875_14107_14487 115
86 3300050491 nmdc:mga00v17_308880_c1 nmdc:mga00v17_308880_c1_298_660 115
87 3300050492 nmdc:mga0yw44_451458_c1 nmdc:mga0yw44_451458_c1_193_555 115
88 iso_pu_bacteria 2855386786 2855389710 115
89 3300048905 Ga0496102_0504100 Ga0496102_0504100_18_368 116
90 iso_pu_bacteria 2643221604 2644033107 116
91 iso_pu_bacteria 2643221617 2644099870 116
92 iso_pu_bacteria 2643221620 2644117476 116
93 3300041405 Ga0439438_131091 Ga0439438_131091_119_472 117
94 3300042005 Ga0439448_0123483 Ga0439448_0123483_410_763 117
95 3300044901 Ga0466960_0724884 Ga0466960_0724884_12_365 117
96 3300005345 Ga0070692_10155382 Ga0070692_101553821 118
97 3300014325 Ga0163163_11520567 Ga0163163_115205672 118
98 3300026121 Ga0207683_10208297 Ga0207683_102082972 118
99 3300005339 Ga0070660_100144839 Ga0070660_1001448392 119
100 3300005366 Ga0070659_100435045 Ga0070659_1004350452 119
101 3300005530 Ga0070679_101466589 Ga0070679_1014665892 119
102 3300005539 Ga0068853_100853842 Ga0068853_1008538422 119
103 3300005563 Ga0068855_100073816 Ga0068855_1000738165 119
104 3300025904 Ga0207647_10126912 Ga0207647_101269122 119
105 3300025919 Ga0207657_10013107 Ga0207657_100131079 119
106 3300025921 Ga0207652_11633790 Ga0207652_116337901 119
107 3300025932 Ga0207690_10207973 Ga0207690_102079732 119
108 3300025949 Ga0207667_10192009 Ga0207667_101920093 119
109 3300026041 Ga0207639_10349031 Ga0207639_103490312 119
110 3300030731 Ga0316177_1105534 Ga0316177_11055343 119
111 3300031733 Ga0316577_10152432 Ga0316577_101524323 119
112 3300032137 Ga0316585_10197338 Ga0316585_101973381 119
113 3300035398 Ga0316574_0073007 Ga0316574_0073007_946_1323 119
114 3300041413 Ga0439465_0249579 Ga0439465_0249579_37_396 119
115 3300045976 Ga0466967_1654665 Ga0466967_1654665_129_488 119
116 3300049571 Ga0501034_0578847 Ga0501034_0578847_300_659 119
117 iso_pu_bacteria 2818991318 2819426032 119
118 iso_pu_bacteria 2919446982 2919448268 119
119 3300005329 Ga0070683_100596100 Ga0070683_1005961002 120
120 3300005334 Ga0068869_100019925 Ga0068869_1000199252 120
121 3300005335 Ga0070666_10187775 Ga0070666_101877752 120
122 3300005338 Ga0068868_100072499 Ga0068868_1000724994 120
123 3300005345 Ga0070692_10002083 Ga0070692_100020835 120
124 3300005347 Ga0070668_100279628 Ga0070668_1002796281 120
125 3300005354 Ga0070675_100529088 Ga0070675_1005290882 120
126 3300005355 Ga0070671_100079784 Ga0070671_1000797842 120
127 3300005366 Ga0070659_100007094 Ga0070659_1000070942 120
128 3300005367 Ga0070667_100002932 Ga0070667_10000293210 120
129 3300005367 Ga0070667_100025482 Ga0070667_1000254825 120
130 3300005458 Ga0070681_10255859 Ga0070681_102558593 120
131 3300005548 Ga0070665_100003883 Ga0070665_10000388321 120
132 3300005618 Ga0068864_100374508 Ga0068864_1003745083 120
133 3300005841 Ga0068863_100015970 Ga0068863_1000159704 120
134 3300005842 Ga0068858_100031845 Ga0068858_1000318456 120
135 3300005843 Ga0068860_100000114 Ga0068860_100000114119 120
136 3300006042 Ga0075368_10030629 Ga0075368_100306292 120
137 3300009177 Ga0105248_11263719 Ga0105248_112637193 120
138 3300009553 Ga0105249_11638683 Ga0105249_116386832 120
139 3300013102 Ga0157371_10008884 Ga0157371_100088848 120
140 3300013297 Ga0157378_12722432 Ga0157378_127224321 120
141 3300013306 Ga0163162_11210596 Ga0163162_112105962 120
142 3300014325 Ga0163163_10567072 Ga0163163_105670721 120
143 3300014968 Ga0157379_10137611 Ga0157379_101376113 120
144 3300025903 Ga0207680_10017231 Ga0207680_100172314 120
145 3300025904 Ga0207647_10110105 Ga0207647_101101054 120
146 3300025912 Ga0207707_10123398 Ga0207707_101233982 120
147 3300025931 Ga0207644_10047373 Ga0207644_100473733 120
148 3300025932 Ga0207690_10008194 Ga0207690_100081945 120
149 3300025941 Ga0207711_10847108 Ga0207711_108471083 120
150 3300025942 Ga0207689_10741961 Ga0207689_107419612 120
151 3300025944 Ga0207661_10550473 Ga0207661_105504732 120
152 3300025961 Ga0207712_11318862 Ga0207712_113188622 120
153 3300025972 Ga0207668_10396810 Ga0207668_103968103 120
154 3300025986 Ga0207658_10021606 Ga0207658_100216062 120
155 3300025986 Ga0207658_10840941 Ga0207658_108409411 120
156 3300026023 Ga0207677_10015036 Ga0207677_100150366 120
157 3300026035 Ga0207703_10056803 Ga0207703_100568034 120
158 3300026088 Ga0207641_10051452 Ga0207641_100514524 120
159 3300027866 Ga0209813_10090298 Ga0209813_100902982 120
160 3300028379 Ga0268266_10001159 Ga0268266_1000115911 120
161 3300028381 Ga0268264_10000147 Ga0268264_10000147118 120
162 3300037418 Ga0395900_1665001 Ga0395900_1665001_22_384 120
163 3300044693 Ga0466961_0023245 Ga0466961_0023245_1701_2063 120
164 3300045049 Ga0466959_0060496 Ga0466959_0060496_510_872 120
165 3300045836 Ga0466958_0043164 Ga0466958_0043164_1323_1685 120
166 3300049744 Ga0501083_0420520 Ga0501083_0420520_382_744 120
167 3300050490 nmdc:mga03n38_358739_c1 nmdc:mga03n38_358739_c1_35_397 120
168 3300050490 nmdc:mga03n38_584843_c1 nmdc:mga03n38_584843_c1_170_532 120
169 3300050491 nmdc:mga00v17_748210_c1 nmdc:mga00v17_748210_c1_242_604 120
170 3300050495 nmdc:mga04h51_106285_c1 nmdc:mga04h51_106285_c1_457_819 120
171 3300005563 Ga0068855_100322292 Ga0068855_1003222923 121
172 3300005614 Ga0068856_100013129 Ga0068856_1000131297 121
173 3300025949 Ga0207667_10442558 Ga0207667_104425582 121
174 3300026078 Ga0207702_10468495 Ga0207702_104684953 121
175 3300031911 Ga0307412_10240202 Ga0307412_102402023 121
176 3300044693 Ga0466961_0095701 Ga0466961_0095701_260_628 121
177 3300044693 Ga0466961_0631687 Ga0466961_0631687_47_415 121
178 3300044694 Ga0466963_0015704 Ga0466963_0015704_529_897 121
179 3300044719 Ga0466971_0577037 Ga0466971_0577037_52_420 121
180 3300044901 Ga0466960_0131144 Ga0466960_0131144_729_1097 121
181 3300045976 Ga0466967_0020226 Ga0466967_0020226_4541_4909 121
182 3300002067 JGI24735J21928_10047069 JGI24735J21928_100470692 123
183 3300005329 Ga0070683_100317436 Ga0070683_1003174362 123
184 3300005337 Ga0070682_100654316 Ga0070682_1006543162 123
185 3300005355 Ga0070671_101723513 Ga0070671_1017235131 123
186 3300005435 Ga0070714_102134351 Ga0070714_1021343511 123
187 3300005455 Ga0070663_100694632 Ga0070663_1006946321 123
188 3300005530 Ga0070679_102008574 Ga0070679_1020085741 123
189 3300005535 Ga0070684_100072282 Ga0070684_1000722825 123
190 3300005535 Ga0070684_101483628 Ga0070684_1014836281 123
191 3300005548 Ga0070665_100335028 Ga0070665_1003350283 123
192 3300005563 Ga0068855_101080030 Ga0068855_1010800301 123
193 3300005577 Ga0068857_101411895 Ga0068857_1014118951 123
194 3300005578 Ga0068854_101487527 Ga0068854_1014875272 123
195 3300005614 Ga0068856_100047448 Ga0068856_1000474482 123
196 3300005614 Ga0068856_100847460 Ga0068856_1008474602 123
197 3300005617 Ga0068859_100001814 Ga0068859_10000181421 123
198 3300006237 Ga0097621_101786352 Ga0097621_1017863522 123
199 3300006931 Ga0097620_100001814 Ga0097620_10000181421 123
200 3300009101 Ga0105247_10005186 Ga0105247_100051869 123
201 3300010375 Ga0105239_11415316 Ga0105239_114153161 123
202 3300013296 Ga0157374_10163581 Ga0157374_101635814 123
203 3300013308 Ga0157375_11834794 Ga0157375_118347943 123
204 3300013308 Ga0157375_12004125 Ga0157375_120041251 123
205 3300014969 Ga0157376_10912024 Ga0157376_109120243 123
206 3300025900 Ga0207710_10006182 Ga0207710_100061825 123
207 3300025914 Ga0207671_10065014 Ga0207671_100650144 123
208 3300025914 Ga0207671_10553073 Ga0207671_105530732 123
209 3300025935 Ga0207709_10390544 Ga0207709_103905443 123
210 3300025944 Ga0207661_11894797 Ga0207661_118947971 123
211 3300025949 Ga0207667_10604294 Ga0207667_106042942 123
212 3300026078 Ga0207702_10125942 Ga0207702_101259423 123
213 3300026078 Ga0207702_10798646 Ga0207702_107986462 123
214 3300028379 Ga0268266_10360418 Ga0268266_103604182 123
215 3300031903 Ga0307407_11041551 Ga0307407_110415512 123
216 3300032002 Ga0307416_100369293 Ga0307416_1003692933 123
217 3300032004 Ga0307414_10398484 Ga0307414_103984842 123
218 3300032005 Ga0307411_12116204 Ga0307411_121162041 123
219 3300038443 Ga0395901_0017388 Ga0395901_0017388_3789_4160 123
220 3300041413 Ga0439465_0084971 Ga0439465_0084971_190_561 123
221 3300042002 Ga0439442_156641 Ga0439442_156641_22_393 123
222 3300044656 Ga0466969_0208757 Ga0466969_0208757_306_680 123
223 3300044684 Ga0466966_0363902 Ga0466966_0363902_469_858 123
224 3300044693 Ga0466961_0038992 Ga0466961_0038992_2487_2861 123
225 3300044694 Ga0466963_0466842 Ga0466963_0466842_124_507 123
226 3300044706 Ga0466964_0136850 Ga0466964_0136850_123_506 123
227 3300045049 Ga0466959_0037258 Ga0466959_0037258_1479_1853 123
228 3300045049 Ga0466959_0555478 Ga0466959_0555478_79_453 123
229 3300046683 Ga0495658_0649324 Ga0495658_0649324_135_506 123
230 3300047319 Ga0495674_0782848 Ga0495674_0782848_216_587 123
231 3300047322 Ga0495680_0279604 Ga0495680_0279604_109_480 123
232 3300047444 Ga0495675_0377192 Ga0495675_0377192_254_625 123
233 3300048088 Ga0495602_0189180 Ga0495602_0189180_1090_1461 123
234 3300048903 Ga0496100_1023314 Ga0496100_1023314_182_553 123
235 3300048905 Ga0496102_0000013 Ga0496102_0000013_289595_289969 123
236 3300048905 Ga0496102_0701289 Ga0496102_0701289_537_920 123
237 3300048906 Ga0496103_0000239 Ga0496103_0000239_46216_46590 123
238 3300048907 Ga0496104_0075336 Ga0496104_0075336_1564_1935 123
239 3300048907 Ga0496104_0742734 Ga0496104_0742734_37_420 123
240 3300048909 Ga0496106_0723421 Ga0496106_0723421_245_616 123
241 3300048910 Ga0496107_0298572 Ga0496107_0298572_129_500 123
242 3300048913 Ga0496110_0214347 Ga0496110_0214347_52_423 123
243 3300048913 Ga0496110_1350415 Ga0496110_1350415_65_436 123
244 3300048914 Ga0496111_0042710 Ga0496111_0042710_18_401 123
245 3300048915 Ga0496112_0418864 Ga0496112_0418864_885_1256 123
246 3300048918 Ga0496115_0682334 Ga0496115_0682334_75_458 123
247 3300048921 Ga0496118_0017555 Ga0496118_0017555_2487_2861 123
248 3300048922 Ga0496119_0000200 Ga0496119_0000200_18659_19045 123
249 3300048922 Ga0496119_0187184 Ga0496119_0187184_539_913 123
250 3300048923 Ga0496120_0003141 Ga0496120_0003141_4396_4782 123
251 3300049569 Ga0501032_0936862 Ga0501032_0936862_129_500 123
252 3300049591 Ga0501075_0336340 Ga0501075_0336340_533_904 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02635

DsrE

DsrE/DsrF-like family

13

125

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.8419 6 123
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.8287 6 123
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.8145 5 123
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.8005 6 123
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.7963 5 123
ID Description Score Start End Superfamily
af_Q58170_143_270_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.9084 5 117 3.40.1260.10
af_O60112_6_422_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.8451 6 43 3.30.300.30
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.837 7 123 3.40.1260.10
af_P0AB52_1_117_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8365 6 123 3.40.1260.10
af_Q58170_143_270_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8333 5 117 3.40.1260.10
ID Description Score Start End GO Terms
AF-A0A2N0FI13-F1-model_v4 deleted 0.9978 6 123
AF-A0A7H8KVW9-F1-model_v4 DsrE family protein 0.9976 6 123
AF-W9FTH2-F1-model_v4 deleted 0.9974 6 123
AF-A0A4R2ED03-F1-model_v4 deleted 0.9964 5 123
AF-A0A6P0HNW9-F1-model_v4 Sulfur reduction protein DsrE 0.9957 6 123

Feature Viewer

pLDDT pTM Quality
95.48 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map