F363446
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 252 | 161 | 246 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300044684|Ga0466966_0363902|Ga0466966_0363902_469_858 |
| Length | 129 |
| Sequence | VQDIGMAAPNPRTLVVKCTAGVDEPERCSQAFTVAATALAAGAQVSLWLTGEAAWLAVPGRAEAFTLPHAAPLAELRDAVLAGGTLTVCSQCAARRDITEEMLVAGTVIRGSASFVDECLADTAQALVY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 2 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 3 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 4 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 5 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 6 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 47 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 101 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 102 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 103 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 104 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 105 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 106 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 107 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 108 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 111 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 112 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 113 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 114 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 115 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 116 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 117 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 118 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 119 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 120 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 121 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 122 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 123 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 124 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 125 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 126 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 127 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 128 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 140 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 141 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 142 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 143 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 144 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 145 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 146 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 147 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 148 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 149 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 150 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 151 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 152 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 157 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 158 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 159 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 160 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.62 |
| Metatranscriptomes | 0 |
| Isolates | 2.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.97 |
| Nodule | 0 |
| Rhizoplane | 6.35 |
| Rhizosphere | 86.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10047069 | 3300002067 | Bacteria | 1250 |
| 2 | Ga0070658_10000206 | 3300005327 | Bacteria | 52179 |
| 3 | Ga0070683_100005748 | 3300005329 | Bacteria | 10362 |
| 4 | Ga0070683_100317436 | 3300005329 | Bacteria | 1483 |
| 5 | Ga0070683_100596100 | 3300005329 | Bacteria | 1057 |
| 6 | Ga0068869_100019925 | 3300005334 | Bacteria | 4593 |
| 7 | Ga0068869_100144313 | 3300005334 | Bacteria | 1841 |
| 8 | Ga0070666_10187775 | 3300005335 | Bacteria | 1451 |
| 9 | Ga0070680_100038904 | 3300005336 | Unclassified | 3848 |
| 10 | Ga0070682_100004617 | 3300005337 | Bacteria | 7652 |
| 11 | Ga0070682_100654316 | 3300005337 | Bacteria | 837 |
| 12 | Ga0068868_100072499 | 3300005338 | Bacteria | 2748 |
| 13 | Ga0068868_100158631 | 3300005338 | Bacteria | 1867 |
| 14 | Ga0070660_100144839 | 3300005339 | Bacteria | 1908 |
| 15 | Ga0070660_101650085 | 3300005339 | Bacteria | 546 |
| 16 | Ga0070687_100048974 | 3300005343 | Bacteria | 2175 |
| 17 | Ga0070692_10002083 | 3300005345 | Bacteria | 7626 |
| 18 | Ga0070692_10051036 | 3300005345 | Bacteria | 2150 |
| 19 | Ga0070692_10155382 | 3300005345 | Bacteria | 1306 |
| 20 | Ga0070668_100279628 | 3300005347 | Bacteria | 1393 |
| 21 | Ga0070668_101908858 | 3300005347 | Bacteria | 547 |
| 22 | Ga0070675_100529088 | 3300005354 | Bacteria | 1064 |
| 23 | Ga0070671_100079784 | 3300005355 | Bacteria | 2736 |
| 24 | Ga0070671_101723513 | 3300005355 | Bacteria | 556 |
| 25 | Ga0070659_100007094 | 3300005366 | Bacteria | 8126 |
| 26 | Ga0070659_100214772 | 3300005366 | Bacteria | 1586 |
| 27 | Ga0070659_100435045 | 3300005366 | Bacteria | 1111 |
| 28 | Ga0070659_100791366 | 3300005366 | Bacteria | 824 |
| 29 | Ga0070667_100002932 | 3300005367 | Bacteria | 14665 |
| 30 | Ga0070667_100025482 | 3300005367 | Bacteria | 4917 |
| 31 | Ga0070667_100091991 | 3300005367 | Bacteria | 2609 |
| 32 | Ga0070714_102134351 | 3300005435 | Bacteria | 546 |
| 33 | Ga0070701_10803338 | 3300005438 | Bacteria | 642 |
| 34 | Ga0070663_100694632 | 3300005455 | Bacteria | 864 |
| 35 | Ga0070678_100200682 | 3300005456 | Bacteria | 1646 |
| 36 | Ga0070681_10227620 | 3300005458 | Bacteria | 1779 |
| 37 | Ga0070681_10255859 | 3300005458 | Bacteria | 1663 |
| 38 | Ga0070681_10686008 | 3300005458 | Bacteria | 940 |
| 39 | Ga0070681_11505764 | 3300005458 | Bacteria | 597 |
| 40 | Ga0070685_10125377 | 3300005466 | Bacteria | 1599 |
| 41 | Ga0070679_101283661 | 3300005530 | Bacteria | 678 |
| 42 | Ga0070679_101466589 | 3300005530 | Bacteria | 629 |
| 43 | Ga0070679_102008574 | 3300005530 | Viruses | 527 |
| 44 | Ga0070684_100016408 | 3300005535 | Bacteria | 6053 |
| 45 | Ga0070684_100072282 | 3300005535 | Bacteria | 3037 |
| 46 | Ga0070684_101483628 | 3300005535 | Unclassified | 639 |
| 47 | Ga0068853_100853842 | 3300005539 | Bacteria | 873 |
| 48 | Ga0070686_100034770 | 3300005544 | Bacteria | 3108 |
| 49 | Ga0070665_100003883 | 3300005548 | Bacteria | 15786 |
| 50 | Ga0070665_100335028 | 3300005548 | Bacteria | 1518 |
| 51 | Ga0070665_100751960 | 3300005548 | Bacteria | 988 |
| 52 | Ga0068855_100073816 | 3300005563 | Bacteria | 3963 |
| 53 | Ga0068855_100322292 | 3300005563 | Bacteria | 1708 |
| 54 | Ga0068855_100570831 | 3300005563 | Bacteria | 1223 |
| 55 | Ga0068855_101080030 | 3300005563 | Bacteria | 840 |
| 56 | Ga0070664_100809600 | 3300005564 | Bacteria | 876 |
| 57 | Ga0068857_100001796 | 3300005577 | Bacteria | 17261 |
| 58 | Ga0068857_101411895 | 3300005577 | Bacteria | 677 |
| 59 | Ga0068854_101487527 | 3300005578 | Bacteria | 614 |
| 60 | Ga0068856_100010096 | 3300005614 | Bacteria | 9175 |
| 61 | Ga0068856_100013129 | 3300005614 | Bacteria | 8024 |
| 62 | Ga0068856_100047448 | 3300005614 | Bacteria | 4231 |
| 63 | Ga0068856_100847460 | 3300005614 | Bacteria | 933 |
| 64 | Ga0070702_100641658 | 3300005615 | Bacteria | 802 |
| 65 | Ga0068859_100001814 | 3300005617 | Bacteria | 21752 |
| 66 | Ga0068864_100006283 | 3300005618 | Bacteria | 9744 |
| 67 | Ga0068864_100374508 | 3300005618 | Bacteria | 1348 |
| 68 | Ga0068866_10192947 | 3300005718 | Bacteria | 1211 |
| 69 | Ga0068863_100015970 | 3300005841 | Bacteria | 7202 |
| 70 | Ga0068858_100031845 | 3300005842 | Bacteria | 4901 |
| 71 | Ga0068858_100036146 | 3300005842 | Bacteria | 4580 |
| 72 | Ga0068860_100000114 | 3300005843 | Bacteria | 128789 |
| 73 | Ga0068860_100075501 | 3300005843 | Bacteria | 3206 |
| 74 | Ga0075365_10443740 | 3300006038 | Bacteria | 916 |
| 75 | Ga0075368_10030629 | 3300006042 | Bacteria | 2084 |
| 76 | Ga0075367_10167533 | 3300006178 | Bacteria | 1368 |
| 77 | Ga0097621_101786352 | 3300006237 | Bacteria | 586 |
| 78 | Ga0068871_100260640 | 3300006358 | Bacteria | 1512 |
| 79 | Ga0097620_100001814 | 3300006931 | Bacteria | 21752 |
| 80 | Ga0105247_10005186 | 3300009101 | Bacteria | 8242 |
| 81 | Ga0105248_11263719 | 3300009177 | Unclassified | 835 |
| 82 | Ga0105249_11638683 | 3300009553 | Bacteria | 716 |
| 83 | Ga0105239_11415316 | 3300010375 | Unclassified | 803 |
| 84 | Ga0157373_10297767 | 3300013100 | Bacteria | 1145 |
| 85 | Ga0157371_10008884 | 3300013102 | Bacteria | 7957 |
| 86 | Ga0157374_10163581 | 3300013296 | Bacteria | 2168 |
| 87 | Ga0157378_12722432 | 3300013297 | Bacteria | 547 |
| 88 | Ga0163162_11210596 | 3300013306 | Bacteria | 857 |
| 89 | Ga0157375_11834794 | 3300013308 | Bacteria | 719 |
| 90 | Ga0157375_12004125 | 3300013308 | Bacteria | 688 |
| 91 | Ga0163163_10567072 | 3300014325 | Bacteria | 1198 |
| 92 | Ga0163163_11520567 | 3300014325 | Bacteria | 731 |
| 93 | Ga0157379_10137611 | 3300014968 | Bacteria | 2201 |
| 94 | Ga0157376_10912024 | 3300014969 | Bacteria | 897 |
| 95 | Ga0207642_10058605 | 3300025899 | Bacteria | 1777 |
| 96 | Ga0207710_10006182 | 3300025900 | Bacteria | 5123 |
| 97 | Ga0207688_10020860 | 3300025901 | Bacteria | 3577 |
| 98 | Ga0207680_10017231 | 3300025903 | Bacteria | 3813 |
| 99 | Ga0207647_10110105 | 3300025904 | Unclassified | 1629 |
| 100 | Ga0207647_10126912 | 3300025904 | Bacteria | 1501 |
| 101 | Ga0207705_10000289 | 3300025909 | Bacteria | 46941 |
| 102 | Ga0207654_10328684 | 3300025911 | Bacteria | 1047 |
| 103 | Ga0207707_10123398 | 3300025912 | Bacteria | 2265 |
| 104 | Ga0207707_11460247 | 3300025912 | Bacteria | 543 |
| 105 | Ga0207671_10065014 | 3300025914 | Bacteria | 2712 |
| 106 | Ga0207671_10539375 | 3300025914 | Bacteria | 930 |
| 107 | Ga0207671_10553073 | 3300025914 | Bacteria | 917 |
| 108 | Ga0207662_10554894 | 3300025918 | Bacteria | 796 |
| 109 | Ga0207657_10013107 | 3300025919 | Bacteria | 8144 |
| 110 | Ga0207652_10331262 | 3300025921 | Bacteria | 1375 |
| 111 | Ga0207652_11633790 | 3300025921 | Bacteria | 549 |
| 112 | Ga0207687_10085016 | 3300025927 | Bacteria | 2294 |
| 113 | Ga0207644_10047373 | 3300025931 | Bacteria | 3067 |
| 114 | Ga0207690_10008194 | 3300025932 | Bacteria | 6199 |
| 115 | Ga0207690_10207973 | 3300025932 | Bacteria | 1490 |
| 116 | Ga0207690_10226236 | 3300025932 | Bacteria | 1434 |
| 117 | Ga0207709_10390544 | 3300025935 | Bacteria | 1061 |
| 118 | Ga0207711_10847108 | 3300025941 | Unclassified | 851 |
| 119 | Ga0207711_11297857 | 3300025941 | Bacteria | 670 |
| 120 | Ga0207689_10217490 | 3300025942 | Bacteria | 1579 |
| 121 | Ga0207689_10741961 | 3300025942 | Bacteria | 828 |
| 122 | Ga0207661_10247843 | 3300025944 | Bacteria | 1582 |
| 123 | Ga0207661_10550473 | 3300025944 | Bacteria | 1057 |
| 124 | Ga0207661_11894797 | 3300025944 | Bacteria | 542 |
| 125 | Ga0207679_10543855 | 3300025945 | Bacteria | 1041 |
| 126 | Ga0207667_10192009 | 3300025949 | Bacteria | 2095 |
| 127 | Ga0207667_10442558 | 3300025949 | Bacteria | 1321 |
| 128 | Ga0207667_10604294 | 3300025949 | Bacteria | 1106 |
| 129 | Ga0207712_10577518 | 3300025961 | Bacteria | 970 |
| 130 | Ga0207712_11318862 | 3300025961 | Bacteria | 645 |
| 131 | Ga0207668_10396810 | 3300025972 | Unclassified | 1165 |
| 132 | Ga0207658_10021606 | 3300025986 | Bacteria | 4471 |
| 133 | Ga0207658_10840941 | 3300025986 | Bacteria | 834 |
| 134 | Ga0207677_10015036 | 3300026023 | Bacteria | 4538 |
| 135 | Ga0207703_10036436 | 3300026035 | Bacteria | 3916 |
| 136 | Ga0207703_10056803 | 3300026035 | Bacteria | 3189 |
| 137 | Ga0207639_10063120 | 3300026041 | Bacteria | 2867 |
| 138 | Ga0207639_10349031 | 3300026041 | Bacteria | 1321 |
| 139 | Ga0207702_10125942 | 3300026078 | Bacteria | 2300 |
| 140 | Ga0207702_10468495 | 3300026078 | Bacteria | 1224 |
| 141 | Ga0207702_10798646 | 3300026078 | Bacteria | 933 |
| 142 | Ga0207641_10051452 | 3300026088 | Bacteria | 3488 |
| 143 | Ga0207676_10164123 | 3300026095 | Bacteria | 1928 |
| 144 | Ga0207674_10006958 | 3300026116 | Bacteria | 13240 |
| 145 | Ga0207683_10208297 | 3300026121 | Bacteria | 1779 |
| 146 | Ga0209813_10090298 | 3300027866 | Bacteria | 1027 |
| 147 | Ga0268266_10001159 | 3300028379 | Bacteria | 32594 |
| 148 | Ga0268266_10360418 | 3300028379 | Bacteria | 1368 |
| 149 | Ga0268266_10658392 | 3300028379 | Bacteria | 1008 |
| 150 | Ga0268266_11877253 | 3300028379 | Bacteria | 573 |
| 151 | Ga0268264_10000147 | 3300028381 | Bacteria | 164790 |
| 152 | Ga0316177_1105534 | 3300030731 | Bacteria | 807 |
| 153 | Ga0316577_10152432 | 3300031733 | Bacteria | 1303 |
| 154 | Ga0307407_11041551 | 3300031903 | Bacteria | 634 |
| 155 | Ga0307412_10240202 | 3300031911 | Bacteria | 1401 |
| 156 | Ga0307416_100369293 | 3300032002 | Bacteria | 1460 |
| 157 | Ga0307414_10398484 | 3300032004 | Bacteria | 1195 |
| 158 | Ga0307411_12116204 | 3300032005 | Bacteria | 527 |
| 159 | Ga0316585_10197338 | 3300032137 | Bacteria | 665 |
| 160 | Ga0316574_0073007 | 3300035398 | Unclassified | 2169 |
| 161 | Ga0395900_1665001 | 3300037418 | Bacteria | 549 |
| 162 | Ga0395901_0017388 | 3300038443 | Bacteria | 7341 |
| 163 | Ga0439438_131091 | 3300041405 | Bacteria | 601 |
| 164 | Ga0439465_0084971 | 3300041413 | Bacteria | 1077 |
| 165 | Ga0439465_0249579 | 3300041413 | Bacteria | 656 |
| 166 | Ga0439442_156641 | 3300042002 | Bacteria | 508 |
| 167 | Ga0439448_0123483 | 3300042005 | Bacteria | 889 |
| 168 | Ga0466969_0208757 | 3300044656 | Bacteria | 890 |
| 169 | Ga0466969_0277152 | 3300044656 | Bacteria | 759 |
| 170 | Ga0466966_0025573 | 3300044684 | Bacteria | 3855 |
| 171 | Ga0466966_0216109 | 3300044684 | Bacteria | 1158 |
| 172 | Ga0466966_0363902 | 3300044684 | Bacteria | 869 |
| 173 | Ga0466961_0002462 | 3300044693 | Bacteria | 11487 |
| 174 | Ga0466961_0023245 | 3300044693 | Bacteria | 3988 |
| 175 | Ga0466961_0038992 | 3300044693 | Bacteria | 3046 |
| 176 | Ga0466961_0095701 | 3300044693 | Bacteria | 1872 |
| 177 | Ga0466961_0631687 | 3300044693 | Bacteria | 643 |
| 178 | Ga0466963_0015704 | 3300044694 | Bacteria | 4696 |
| 179 | Ga0466963_0466842 | 3300044694 | Bacteria | 891 |
| 180 | Ga0466964_0136850 | 3300044706 | Bacteria | 1122 |
| 181 | Ga0466971_0079239 | 3300044719 | Bacteria | 1497 |
| 182 | Ga0466971_0154552 | 3300044719 | Bacteria | 1072 |
| 183 | Ga0466971_0162852 | 3300044719 | Bacteria | 1044 |
| 184 | Ga0466971_0577037 | 3300044719 | Bacteria | 559 |
| 185 | Ga0466968_0740485 | 3300044735 | Bacteria | 504 |
| 186 | Ga0466970_0007684 | 3300044765 | Bacteria | 5408 |
| 187 | Ga0466970_0737333 | 3300044765 | Bacteria | 575 |
| 188 | Ga0466957_0129433 | 3300044842 | Bacteria | 1616 |
| 189 | Ga0466957_0687295 | 3300044842 | Bacteria | 721 |
| 190 | Ga0466960_0131144 | 3300044901 | Bacteria | 1323 |
| 191 | Ga0466960_0724884 | 3300044901 | Bacteria | 598 |
| 192 | Ga0466959_0004060 | 3300045049 | Bacteria | 9740 |
| 193 | Ga0466959_0017888 | 3300045049 | Bacteria | 5198 |
| 194 | Ga0466959_0037258 | 3300045049 | Bacteria | 3593 |
| 195 | Ga0466959_0060496 | 3300045049 | Unclassified | 2756 |
| 196 | Ga0466959_0116638 | 3300045049 | Bacteria | 1901 |
| 197 | Ga0466959_0555478 | 3300045049 | Bacteria | 774 |
| 198 | Ga0466958_0035534 | 3300045836 | Bacteria | 2977 |
| 199 | Ga0466958_0043164 | 3300045836 | Bacteria | 2715 |
| 200 | Ga0466967_0020226 | 3300045976 | Bacteria | 5374 |
| 201 | Ga0466967_1164751 | 3300045976 | Bacteria | 768 |
| 202 | Ga0466967_1654665 | 3300045976 | Bacteria | 637 |
| 203 | Ga0495606_0003885 | 3300046507 | Bacteria | 15405 |
| 204 | Ga0495668_0000111 | 3300046616 | Bacteria | 130715 |
| 205 | Ga0495625_0004275 | 3300046660 | Bacteria | 13588 |
| 206 | Ga0495658_0649324 | 3300046683 | Bacteria | 676 |
| 207 | Ga0495674_0782848 | 3300047319 | Bacteria | 743 |
| 208 | Ga0495674_0977158 | 3300047319 | Bacteria | 650 |
| 209 | Ga0495680_0279604 | 3300047322 | Bacteria | 1177 |
| 210 | Ga0495683_0022573 | 3300047323 | Bacteria | 3236 |
| 211 | Ga0495675_0377192 | 3300047444 | Bacteria | 830 |
| 212 | Ga0495602_0189180 | 3300048088 | Bacteria | 1580 |
| 213 | Ga0495626_0000875 | 3300048091 | Bacteria | 26772 |
| 214 | Ga0496100_1023314 | 3300048903 | Bacteria | 650 |
| 215 | Ga0496102_0000013 | 3300048905 | Bacteria | 311668 |
| 216 | Ga0496102_0504100 | 3300048905 | Bacteria | 1132 |
| 217 | Ga0496102_0586014 | 3300048905 | Bacteria | 1038 |
| 218 | Ga0496102_0701289 | 3300048905 | Bacteria | 935 |
| 219 | Ga0496103_0000239 | 3300048906 | Bacteria | 53554 |
| 220 | Ga0496104_0075336 | 3300048907 | Bacteria | 3213 |
| 221 | Ga0496104_0742734 | 3300048907 | Bacteria | 888 |
| 222 | Ga0496105_0953349 | 3300048908 | Bacteria | 644 |
| 223 | Ga0496106_0723421 | 3300048909 | Bacteria | 792 |
| 224 | Ga0496107_0298572 | 3300048910 | Bacteria | 1199 |
| 225 | Ga0496110_0214347 | 3300048913 | Bacteria | 1751 |
| 226 | Ga0496110_1350415 | 3300048913 | Bacteria | 622 |
| 227 | Ga0496111_0042710 | 3300048914 | Bacteria | 3256 |
| 228 | Ga0496112_0418864 | 3300048915 | Bacteria | 1278 |
| 229 | Ga0496115_0682334 | 3300048918 | Bacteria | 809 |
| 230 | Ga0496118_0017555 | 3300048921 | Bacteria | 6506 |
| 231 | Ga0496119_0000200 | 3300048922 | Bacteria | 84506 |
| 232 | Ga0496119_0187184 | 3300048922 | Bacteria | 1081 |
| 233 | Ga0496120_0003141 | 3300048923 | Bacteria | 15447 |
| 234 | Ga0501032_0936862 | 3300049569 | Bacteria | 545 |
| 235 | Ga0501034_0578847 | 3300049571 | Bacteria | 1030 |
| 236 | Ga0501075_0336340 | 3300049591 | Bacteria | 1151 |
| 237 | Ga0501083_0420520 | 3300049744 | Bacteria | 870 |
| 238 | nmdc:mga03n38_358739_c1 | 3300050490 | Bacteria | 795 |
| 239 | nmdc:mga03n38_584843_c1 | 3300050490 | Bacteria | 634 |
| 240 | nmdc:mga00v17_308880_c1 | 3300050491 | Bacteria | 1027 |
| 241 | nmdc:mga00v17_748210_c1 | 3300050491 | Bacteria | 625 |
| 242 | nmdc:mga0yw44_451458_c1 | 3300050492 | Bacteria | 871 |
| 243 | nmdc:mga04h51_106285_c1 | 3300050495 | Bacteria | 1029 |
| 244 | nmdc:mga08y16_1800473_c1 | 3300050511 | Bacteria | 565 |
| 245 | Ga0466962_0124457 | 3300061719 | Bacteria | 1245 |
| 246 | Ga0466962_0324561 | 3300061719 | Bacteria | 764 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044684 | Ga0466966_0216109 | Ga0466966_0216109_301_699 | 94 |
| 2 | 3300044693 | Ga0466961_0002462 | Ga0466961_0002462_997_1395 | 94 |
| 3 | 3300044719 | Ga0466971_0154552 | Ga0466971_0154552_572_970 | 94 |
| 4 | 3300044735 | Ga0466968_0740485 | Ga0466968_0740485_42_410 | 94 |
| 5 | 3300044765 | Ga0466970_0007684 | Ga0466970_0007684_2444_2842 | 94 |
| 6 | 3300044842 | Ga0466957_0687295 | Ga0466957_0687295_205_603 | 94 |
| 7 | 3300045049 | Ga0466959_0017888 | Ga0466959_0017888_3602_4000 | 94 |
| 8 | 3300005530 | Ga0070679_101283661 | Ga0070679_1012836611 | 97 |
| 9 | 3300025921 | Ga0207652_10331262 | Ga0207652_103312622 | 97 |
| 10 | 3300005366 | Ga0070659_100214772 | Ga0070659_1002147722 | 101 |
| 11 | 3300005458 | Ga0070681_10227620 | Ga0070681_102276202 | 101 |
| 12 | 3300013100 | Ga0157373_10297767 | Ga0157373_102977672 | 101 |
| 13 | 3300025932 | Ga0207690_10226236 | Ga0207690_102262362 | 101 |
| 14 | 3300044656 | Ga0466969_0277152 | Ga0466969_0277152_259_621 | 105 |
| 15 | 3300045049 | Ga0466959_0116638 | Ga0466959_0116638_1179_1541 | 105 |
| 16 | 3300044684 | Ga0466966_0025573 | Ga0466966_0025573_1192_1554 | 106 |
| 17 | 3300044719 | Ga0466971_0162852 | Ga0466971_0162852_645_1007 | 106 |
| 18 | 3300044842 | Ga0466957_0129433 | Ga0466957_0129433_482_844 | 106 |
| 19 | 3300045049 | Ga0466959_0004060 | Ga0466959_0004060_1123_1485 | 106 |
| 20 | 3300045836 | Ga0466958_0035534 | Ga0466958_0035534_2039_2401 | 106 |
| 21 | 3300061719 | Ga0466962_0124457 | Ga0466962_0124457_858_1220 | 106 |
| 22 | 3300045976 | Ga0466967_1164751 | Ga0466967_1164751_387_746 | 107 |
| 23 | 3300044719 | Ga0466971_0079239 | Ga0466971_0079239_843_1205 | 109 |
| 24 | 3300044765 | Ga0466970_0737333 | Ga0466970_0737333_53_415 | 109 |
| 25 | 3300061719 | Ga0466962_0324561 | Ga0466962_0324561_208_570 | 109 |
| 26 | 3300005438 | Ga0070701_10803338 | Ga0070701_108033382 | 110 |
| 27 | 3300005347 | Ga0070668_101908858 | Ga0070668_1019088581 | 112 |
| 28 | 3300048908 | Ga0496105_0953349 | Ga0496105_0953349_249_611 | 112 |
| 29 | 3300005329 | Ga0070683_100005748 | Ga0070683_1000057482 | 114 |
| 30 | 3300005334 | Ga0068869_100144313 | Ga0068869_1001443133 | 114 |
| 31 | 3300005337 | Ga0070682_100004617 | Ga0070682_1000046173 | 114 |
| 32 | 3300005338 | Ga0068868_100158631 | Ga0068868_1001586312 | 114 |
| 33 | 3300005339 | Ga0070660_101650085 | Ga0070660_1016500851 | 114 |
| 34 | 3300005343 | Ga0070687_100048974 | Ga0070687_1000489743 | 114 |
| 35 | 3300005345 | Ga0070692_10051036 | Ga0070692_100510362 | 114 |
| 36 | 3300005367 | Ga0070667_100091991 | Ga0070667_1000919913 | 114 |
| 37 | 3300005456 | Ga0070678_100200682 | Ga0070678_1002006822 | 114 |
| 38 | 3300005458 | Ga0070681_10686008 | Ga0070681_106860081 | 114 |
| 39 | 3300005466 | Ga0070685_10125377 | Ga0070685_101253774 | 114 |
| 40 | 3300005535 | Ga0070684_100016408 | Ga0070684_1000164088 | 114 |
| 41 | 3300005544 | Ga0070686_100034770 | Ga0070686_1000347704 | 114 |
| 42 | 3300005548 | Ga0070665_100751960 | Ga0070665_1007519602 | 114 |
| 43 | 3300005563 | Ga0068855_100570831 | Ga0068855_1005708313 | 114 |
| 44 | 3300005564 | Ga0070664_100809600 | Ga0070664_1008096002 | 114 |
| 45 | 3300005577 | Ga0068857_100001796 | Ga0068857_1000017969 | 114 |
| 46 | 3300005614 | Ga0068856_100010096 | Ga0068856_10001009611 | 114 |
| 47 | 3300005615 | Ga0070702_100641658 | Ga0070702_1006416582 | 114 |
| 48 | 3300005618 | Ga0068864_100006283 | Ga0068864_1000062838 | 114 |
| 49 | 3300005718 | Ga0068866_10192947 | Ga0068866_101929473 | 114 |
| 50 | 3300005842 | Ga0068858_100036146 | Ga0068858_1000361464 | 114 |
| 51 | 3300005843 | Ga0068860_100075501 | Ga0068860_1000755014 | 114 |
| 52 | 3300006358 | Ga0068871_100260640 | Ga0068871_1002606402 | 114 |
| 53 | 3300025899 | Ga0207642_10058605 | Ga0207642_100586052 | 114 |
| 54 | 3300025901 | Ga0207688_10020860 | Ga0207688_100208605 | 114 |
| 55 | 3300025911 | Ga0207654_10328684 | Ga0207654_103286842 | 114 |
| 56 | 3300025912 | Ga0207707_11460247 | Ga0207707_114602471 | 114 |
| 57 | 3300025914 | Ga0207671_10539375 | Ga0207671_105393752 | 114 |
| 58 | 3300025918 | Ga0207662_10554894 | Ga0207662_105548942 | 114 |
| 59 | 3300025927 | Ga0207687_10085016 | Ga0207687_100850164 | 114 |
| 60 | 3300025941 | Ga0207711_11297857 | Ga0207711_112978571 | 114 |
| 61 | 3300025942 | Ga0207689_10217490 | Ga0207689_102174903 | 114 |
| 62 | 3300025944 | Ga0207661_10247843 | Ga0207661_102478432 | 114 |
| 63 | 3300025945 | Ga0207679_10543855 | Ga0207679_105438552 | 114 |
| 64 | 3300025961 | Ga0207712_10577518 | Ga0207712_105775182 | 114 |
| 65 | 3300026035 | Ga0207703_10036436 | Ga0207703_100364363 | 114 |
| 66 | 3300026041 | Ga0207639_10063120 | Ga0207639_100631204 | 114 |
| 67 | 3300026095 | Ga0207676_10164123 | Ga0207676_101641234 | 114 |
| 68 | 3300026116 | Ga0207674_10006958 | Ga0207674_100069582 | 114 |
| 69 | 3300028379 | Ga0268266_10658392 | Ga0268266_106583922 | 114 |
| 70 | 3300028379 | Ga0268266_11877253 | Ga0268266_118772532 | 114 |
| 71 | 3300047319 | Ga0495674_0977158 | Ga0495674_0977158_158_502 | 114 |
| 72 | 3300048905 | Ga0496102_0586014 | Ga0496102_0586014_677_1021 | 114 |
| 73 | 3300050511 | nmdc:mga08y16_1800473_c1 | nmdc:mga08y16_1800473_c1_14_358 | 114 |
| 74 | 3300005327 | Ga0070658_10000206 | Ga0070658_1000020639 | 115 |
| 75 | 3300005336 | Ga0070680_100038904 | Ga0070680_1000389043 | 115 |
| 76 | 3300005366 | Ga0070659_100791366 | Ga0070659_1007913662 | 115 |
| 77 | 3300005458 | Ga0070681_11505764 | Ga0070681_115057641 | 115 |
| 78 | 3300006038 | Ga0075365_10443740 | Ga0075365_104437402 | 115 |
| 79 | 3300006178 | Ga0075367_10167533 | Ga0075367_101675332 | 115 |
| 80 | 3300025909 | Ga0207705_10000289 | Ga0207705_1000028912 | 115 |
| 81 | 3300046507 | Ga0495606_0003885 | Ga0495606_0003885_12222_12602 | 115 |
| 82 | 3300046616 | Ga0495668_0000111 | Ga0495668_0000111_87700_88080 | 115 |
| 83 | 3300046660 | Ga0495625_0004275 | Ga0495625_0004275_3936_4316 | 115 |
| 84 | 3300047323 | Ga0495683_0022573 | Ga0495683_0022573_367_747 | 115 |
| 85 | 3300048091 | Ga0495626_0000875 | Ga0495626_0000875_14107_14487 | 115 |
| 86 | 3300050491 | nmdc:mga00v17_308880_c1 | nmdc:mga00v17_308880_c1_298_660 | 115 |
| 87 | 3300050492 | nmdc:mga0yw44_451458_c1 | nmdc:mga0yw44_451458_c1_193_555 | 115 |
| 88 | iso_pu_bacteria | 2855386786 | 2855389710 | 115 |
| 89 | 3300048905 | Ga0496102_0504100 | Ga0496102_0504100_18_368 | 116 |
| 90 | iso_pu_bacteria | 2643221604 | 2644033107 | 116 |
| 91 | iso_pu_bacteria | 2643221617 | 2644099870 | 116 |
| 92 | iso_pu_bacteria | 2643221620 | 2644117476 | 116 |
| 93 | 3300041405 | Ga0439438_131091 | Ga0439438_131091_119_472 | 117 |
| 94 | 3300042005 | Ga0439448_0123483 | Ga0439448_0123483_410_763 | 117 |
| 95 | 3300044901 | Ga0466960_0724884 | Ga0466960_0724884_12_365 | 117 |
| 96 | 3300005345 | Ga0070692_10155382 | Ga0070692_101553821 | 118 |
| 97 | 3300014325 | Ga0163163_11520567 | Ga0163163_115205672 | 118 |
| 98 | 3300026121 | Ga0207683_10208297 | Ga0207683_102082972 | 118 |
| 99 | 3300005339 | Ga0070660_100144839 | Ga0070660_1001448392 | 119 |
| 100 | 3300005366 | Ga0070659_100435045 | Ga0070659_1004350452 | 119 |
| 101 | 3300005530 | Ga0070679_101466589 | Ga0070679_1014665892 | 119 |
| 102 | 3300005539 | Ga0068853_100853842 | Ga0068853_1008538422 | 119 |
| 103 | 3300005563 | Ga0068855_100073816 | Ga0068855_1000738165 | 119 |
| 104 | 3300025904 | Ga0207647_10126912 | Ga0207647_101269122 | 119 |
| 105 | 3300025919 | Ga0207657_10013107 | Ga0207657_100131079 | 119 |
| 106 | 3300025921 | Ga0207652_11633790 | Ga0207652_116337901 | 119 |
| 107 | 3300025932 | Ga0207690_10207973 | Ga0207690_102079732 | 119 |
| 108 | 3300025949 | Ga0207667_10192009 | Ga0207667_101920093 | 119 |
| 109 | 3300026041 | Ga0207639_10349031 | Ga0207639_103490312 | 119 |
| 110 | 3300030731 | Ga0316177_1105534 | Ga0316177_11055343 | 119 |
| 111 | 3300031733 | Ga0316577_10152432 | Ga0316577_101524323 | 119 |
| 112 | 3300032137 | Ga0316585_10197338 | Ga0316585_101973381 | 119 |
| 113 | 3300035398 | Ga0316574_0073007 | Ga0316574_0073007_946_1323 | 119 |
| 114 | 3300041413 | Ga0439465_0249579 | Ga0439465_0249579_37_396 | 119 |
| 115 | 3300045976 | Ga0466967_1654665 | Ga0466967_1654665_129_488 | 119 |
| 116 | 3300049571 | Ga0501034_0578847 | Ga0501034_0578847_300_659 | 119 |
| 117 | iso_pu_bacteria | 2818991318 | 2819426032 | 119 |
| 118 | iso_pu_bacteria | 2919446982 | 2919448268 | 119 |
| 119 | 3300005329 | Ga0070683_100596100 | Ga0070683_1005961002 | 120 |
| 120 | 3300005334 | Ga0068869_100019925 | Ga0068869_1000199252 | 120 |
| 121 | 3300005335 | Ga0070666_10187775 | Ga0070666_101877752 | 120 |
| 122 | 3300005338 | Ga0068868_100072499 | Ga0068868_1000724994 | 120 |
| 123 | 3300005345 | Ga0070692_10002083 | Ga0070692_100020835 | 120 |
| 124 | 3300005347 | Ga0070668_100279628 | Ga0070668_1002796281 | 120 |
| 125 | 3300005354 | Ga0070675_100529088 | Ga0070675_1005290882 | 120 |
| 126 | 3300005355 | Ga0070671_100079784 | Ga0070671_1000797842 | 120 |
| 127 | 3300005366 | Ga0070659_100007094 | Ga0070659_1000070942 | 120 |
| 128 | 3300005367 | Ga0070667_100002932 | Ga0070667_10000293210 | 120 |
| 129 | 3300005367 | Ga0070667_100025482 | Ga0070667_1000254825 | 120 |
| 130 | 3300005458 | Ga0070681_10255859 | Ga0070681_102558593 | 120 |
| 131 | 3300005548 | Ga0070665_100003883 | Ga0070665_10000388321 | 120 |
| 132 | 3300005618 | Ga0068864_100374508 | Ga0068864_1003745083 | 120 |
| 133 | 3300005841 | Ga0068863_100015970 | Ga0068863_1000159704 | 120 |
| 134 | 3300005842 | Ga0068858_100031845 | Ga0068858_1000318456 | 120 |
| 135 | 3300005843 | Ga0068860_100000114 | Ga0068860_100000114119 | 120 |
| 136 | 3300006042 | Ga0075368_10030629 | Ga0075368_100306292 | 120 |
| 137 | 3300009177 | Ga0105248_11263719 | Ga0105248_112637193 | 120 |
| 138 | 3300009553 | Ga0105249_11638683 | Ga0105249_116386832 | 120 |
| 139 | 3300013102 | Ga0157371_10008884 | Ga0157371_100088848 | 120 |
| 140 | 3300013297 | Ga0157378_12722432 | Ga0157378_127224321 | 120 |
| 141 | 3300013306 | Ga0163162_11210596 | Ga0163162_112105962 | 120 |
| 142 | 3300014325 | Ga0163163_10567072 | Ga0163163_105670721 | 120 |
| 143 | 3300014968 | Ga0157379_10137611 | Ga0157379_101376113 | 120 |
| 144 | 3300025903 | Ga0207680_10017231 | Ga0207680_100172314 | 120 |
| 145 | 3300025904 | Ga0207647_10110105 | Ga0207647_101101054 | 120 |
| 146 | 3300025912 | Ga0207707_10123398 | Ga0207707_101233982 | 120 |
| 147 | 3300025931 | Ga0207644_10047373 | Ga0207644_100473733 | 120 |
| 148 | 3300025932 | Ga0207690_10008194 | Ga0207690_100081945 | 120 |
| 149 | 3300025941 | Ga0207711_10847108 | Ga0207711_108471083 | 120 |
| 150 | 3300025942 | Ga0207689_10741961 | Ga0207689_107419612 | 120 |
| 151 | 3300025944 | Ga0207661_10550473 | Ga0207661_105504732 | 120 |
| 152 | 3300025961 | Ga0207712_11318862 | Ga0207712_113188622 | 120 |
| 153 | 3300025972 | Ga0207668_10396810 | Ga0207668_103968103 | 120 |
| 154 | 3300025986 | Ga0207658_10021606 | Ga0207658_100216062 | 120 |
| 155 | 3300025986 | Ga0207658_10840941 | Ga0207658_108409411 | 120 |
| 156 | 3300026023 | Ga0207677_10015036 | Ga0207677_100150366 | 120 |
| 157 | 3300026035 | Ga0207703_10056803 | Ga0207703_100568034 | 120 |
| 158 | 3300026088 | Ga0207641_10051452 | Ga0207641_100514524 | 120 |
| 159 | 3300027866 | Ga0209813_10090298 | Ga0209813_100902982 | 120 |
| 160 | 3300028379 | Ga0268266_10001159 | Ga0268266_1000115911 | 120 |
| 161 | 3300028381 | Ga0268264_10000147 | Ga0268264_10000147118 | 120 |
| 162 | 3300037418 | Ga0395900_1665001 | Ga0395900_1665001_22_384 | 120 |
| 163 | 3300044693 | Ga0466961_0023245 | Ga0466961_0023245_1701_2063 | 120 |
| 164 | 3300045049 | Ga0466959_0060496 | Ga0466959_0060496_510_872 | 120 |
| 165 | 3300045836 | Ga0466958_0043164 | Ga0466958_0043164_1323_1685 | 120 |
| 166 | 3300049744 | Ga0501083_0420520 | Ga0501083_0420520_382_744 | 120 |
| 167 | 3300050490 | nmdc:mga03n38_358739_c1 | nmdc:mga03n38_358739_c1_35_397 | 120 |
| 168 | 3300050490 | nmdc:mga03n38_584843_c1 | nmdc:mga03n38_584843_c1_170_532 | 120 |
| 169 | 3300050491 | nmdc:mga00v17_748210_c1 | nmdc:mga00v17_748210_c1_242_604 | 120 |
| 170 | 3300050495 | nmdc:mga04h51_106285_c1 | nmdc:mga04h51_106285_c1_457_819 | 120 |
| 171 | 3300005563 | Ga0068855_100322292 | Ga0068855_1003222923 | 121 |
| 172 | 3300005614 | Ga0068856_100013129 | Ga0068856_1000131297 | 121 |
| 173 | 3300025949 | Ga0207667_10442558 | Ga0207667_104425582 | 121 |
| 174 | 3300026078 | Ga0207702_10468495 | Ga0207702_104684953 | 121 |
| 175 | 3300031911 | Ga0307412_10240202 | Ga0307412_102402023 | 121 |
| 176 | 3300044693 | Ga0466961_0095701 | Ga0466961_0095701_260_628 | 121 |
| 177 | 3300044693 | Ga0466961_0631687 | Ga0466961_0631687_47_415 | 121 |
| 178 | 3300044694 | Ga0466963_0015704 | Ga0466963_0015704_529_897 | 121 |
| 179 | 3300044719 | Ga0466971_0577037 | Ga0466971_0577037_52_420 | 121 |
| 180 | 3300044901 | Ga0466960_0131144 | Ga0466960_0131144_729_1097 | 121 |
| 181 | 3300045976 | Ga0466967_0020226 | Ga0466967_0020226_4541_4909 | 121 |
| 182 | 3300002067 | JGI24735J21928_10047069 | JGI24735J21928_100470692 | 123 |
| 183 | 3300005329 | Ga0070683_100317436 | Ga0070683_1003174362 | 123 |
| 184 | 3300005337 | Ga0070682_100654316 | Ga0070682_1006543162 | 123 |
| 185 | 3300005355 | Ga0070671_101723513 | Ga0070671_1017235131 | 123 |
| 186 | 3300005435 | Ga0070714_102134351 | Ga0070714_1021343511 | 123 |
| 187 | 3300005455 | Ga0070663_100694632 | Ga0070663_1006946321 | 123 |
| 188 | 3300005530 | Ga0070679_102008574 | Ga0070679_1020085741 | 123 |
| 189 | 3300005535 | Ga0070684_100072282 | Ga0070684_1000722825 | 123 |
| 190 | 3300005535 | Ga0070684_101483628 | Ga0070684_1014836281 | 123 |
| 191 | 3300005548 | Ga0070665_100335028 | Ga0070665_1003350283 | 123 |
| 192 | 3300005563 | Ga0068855_101080030 | Ga0068855_1010800301 | 123 |
| 193 | 3300005577 | Ga0068857_101411895 | Ga0068857_1014118951 | 123 |
| 194 | 3300005578 | Ga0068854_101487527 | Ga0068854_1014875272 | 123 |
| 195 | 3300005614 | Ga0068856_100047448 | Ga0068856_1000474482 | 123 |
| 196 | 3300005614 | Ga0068856_100847460 | Ga0068856_1008474602 | 123 |
| 197 | 3300005617 | Ga0068859_100001814 | Ga0068859_10000181421 | 123 |
| 198 | 3300006237 | Ga0097621_101786352 | Ga0097621_1017863522 | 123 |
| 199 | 3300006931 | Ga0097620_100001814 | Ga0097620_10000181421 | 123 |
| 200 | 3300009101 | Ga0105247_10005186 | Ga0105247_100051869 | 123 |
| 201 | 3300010375 | Ga0105239_11415316 | Ga0105239_114153161 | 123 |
| 202 | 3300013296 | Ga0157374_10163581 | Ga0157374_101635814 | 123 |
| 203 | 3300013308 | Ga0157375_11834794 | Ga0157375_118347943 | 123 |
| 204 | 3300013308 | Ga0157375_12004125 | Ga0157375_120041251 | 123 |
| 205 | 3300014969 | Ga0157376_10912024 | Ga0157376_109120243 | 123 |
| 206 | 3300025900 | Ga0207710_10006182 | Ga0207710_100061825 | 123 |
| 207 | 3300025914 | Ga0207671_10065014 | Ga0207671_100650144 | 123 |
| 208 | 3300025914 | Ga0207671_10553073 | Ga0207671_105530732 | 123 |
| 209 | 3300025935 | Ga0207709_10390544 | Ga0207709_103905443 | 123 |
| 210 | 3300025944 | Ga0207661_11894797 | Ga0207661_118947971 | 123 |
| 211 | 3300025949 | Ga0207667_10604294 | Ga0207667_106042942 | 123 |
| 212 | 3300026078 | Ga0207702_10125942 | Ga0207702_101259423 | 123 |
| 213 | 3300026078 | Ga0207702_10798646 | Ga0207702_107986462 | 123 |
| 214 | 3300028379 | Ga0268266_10360418 | Ga0268266_103604182 | 123 |
| 215 | 3300031903 | Ga0307407_11041551 | Ga0307407_110415512 | 123 |
| 216 | 3300032002 | Ga0307416_100369293 | Ga0307416_1003692933 | 123 |
| 217 | 3300032004 | Ga0307414_10398484 | Ga0307414_103984842 | 123 |
| 218 | 3300032005 | Ga0307411_12116204 | Ga0307411_121162041 | 123 |
| 219 | 3300038443 | Ga0395901_0017388 | Ga0395901_0017388_3789_4160 | 123 |
| 220 | 3300041413 | Ga0439465_0084971 | Ga0439465_0084971_190_561 | 123 |
| 221 | 3300042002 | Ga0439442_156641 | Ga0439442_156641_22_393 | 123 |
| 222 | 3300044656 | Ga0466969_0208757 | Ga0466969_0208757_306_680 | 123 |
| 223 | 3300044684 | Ga0466966_0363902 | Ga0466966_0363902_469_858 | 123 |
| 224 | 3300044693 | Ga0466961_0038992 | Ga0466961_0038992_2487_2861 | 123 |
| 225 | 3300044694 | Ga0466963_0466842 | Ga0466963_0466842_124_507 | 123 |
| 226 | 3300044706 | Ga0466964_0136850 | Ga0466964_0136850_123_506 | 123 |
| 227 | 3300045049 | Ga0466959_0037258 | Ga0466959_0037258_1479_1853 | 123 |
| 228 | 3300045049 | Ga0466959_0555478 | Ga0466959_0555478_79_453 | 123 |
| 229 | 3300046683 | Ga0495658_0649324 | Ga0495658_0649324_135_506 | 123 |
| 230 | 3300047319 | Ga0495674_0782848 | Ga0495674_0782848_216_587 | 123 |
| 231 | 3300047322 | Ga0495680_0279604 | Ga0495680_0279604_109_480 | 123 |
| 232 | 3300047444 | Ga0495675_0377192 | Ga0495675_0377192_254_625 | 123 |
| 233 | 3300048088 | Ga0495602_0189180 | Ga0495602_0189180_1090_1461 | 123 |
| 234 | 3300048903 | Ga0496100_1023314 | Ga0496100_1023314_182_553 | 123 |
| 235 | 3300048905 | Ga0496102_0000013 | Ga0496102_0000013_289595_289969 | 123 |
| 236 | 3300048905 | Ga0496102_0701289 | Ga0496102_0701289_537_920 | 123 |
| 237 | 3300048906 | Ga0496103_0000239 | Ga0496103_0000239_46216_46590 | 123 |
| 238 | 3300048907 | Ga0496104_0075336 | Ga0496104_0075336_1564_1935 | 123 |
| 239 | 3300048907 | Ga0496104_0742734 | Ga0496104_0742734_37_420 | 123 |
| 240 | 3300048909 | Ga0496106_0723421 | Ga0496106_0723421_245_616 | 123 |
| 241 | 3300048910 | Ga0496107_0298572 | Ga0496107_0298572_129_500 | 123 |
| 242 | 3300048913 | Ga0496110_0214347 | Ga0496110_0214347_52_423 | 123 |
| 243 | 3300048913 | Ga0496110_1350415 | Ga0496110_1350415_65_436 | 123 |
| 244 | 3300048914 | Ga0496111_0042710 | Ga0496111_0042710_18_401 | 123 |
| 245 | 3300048915 | Ga0496112_0418864 | Ga0496112_0418864_885_1256 | 123 |
| 246 | 3300048918 | Ga0496115_0682334 | Ga0496115_0682334_75_458 | 123 |
| 247 | 3300048921 | Ga0496118_0017555 | Ga0496118_0017555_2487_2861 | 123 |
| 248 | 3300048922 | Ga0496119_0000200 | Ga0496119_0000200_18659_19045 | 123 |
| 249 | 3300048922 | Ga0496119_0187184 | Ga0496119_0187184_539_913 | 123 |
| 250 | 3300048923 | Ga0496120_0003141 | Ga0496120_0003141_4396_4782 | 123 |
| 251 | 3300049569 | Ga0501032_0936862 | Ga0501032_0936862_129_500 | 123 |
| 252 | 3300049591 | Ga0501075_0336340 | Ga0501075_0336340_533_904 | 123 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jx7-assembly1.cif.gz_E | crystal structure of ychn protein from e.coli | 0.8419 | 6 | 123 |
| 1jx7-assembly1.cif.gz_E | crystal structure of ychn protein from e.coli | 0.8287 | 6 | 123 |
| 3mc3-assembly1.cif.gz_A | crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution | 0.8145 | 5 | 123 |
| 2qs7-assembly2.cif.gz_D | crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution | 0.8005 | 6 | 123 |
| 3mc3-assembly1.cif.gz_A | crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution | 0.7963 | 5 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58170_143_270_3.40.1260.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.9084 | 5 | 117 | 3.40.1260.10 |
| af_O60112_6_422_3.30.300.30 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain | 0.8451 | 6 | 43 | 3.30.300.30 |
| af_Q58396_1_114_3.40.1260.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.837 | 7 | 123 | 3.40.1260.10 |
| af_P0AB52_1_117_3.40.1260.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.8365 | 6 | 123 | 3.40.1260.10 |
| af_Q58170_143_270_3.40.1260.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.8333 | 5 | 117 | 3.40.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N0FI13-F1-model_v4 | deleted | 0.9978 | 6 | 123 |
|
| AF-A0A7H8KVW9-F1-model_v4 | DsrE family protein | 0.9976 | 6 | 123 |
|
| AF-W9FTH2-F1-model_v4 | deleted | 0.9974 | 6 | 123 |
|
| AF-A0A4R2ED03-F1-model_v4 | deleted | 0.9964 | 5 | 123 |
|
| AF-A0A6P0HNW9-F1-model_v4 | Sulfur reduction protein DsrE | 0.9957 | 6 | 123 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar